(data stored in ACNUC8465 zone)

HOGENOMDNA: CELFN_1

ID   CELFN_1; SV 1; empty ; DNA; empty ; PRO; 4123179 BP.
XX
AC   NC_014151;
XX
PR   Project: 48821;
XX
DE   Cellulomonas flavigena DSM 20109 chromosome, complete genome.
XX
OS   Cellulomonas flavigena DSM 20109
OC   Bacteria; Actinobacteria; Actinobacteridae; Actinomycetales;
OC   Micrococcineae; Cellulomonadaceae; Cellulomonas.
XX
RN   [1]
RP   1-4123179
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Goodwin,L., Pitluck,S., Kyrpides,N., Mavromatis,K., Ivanova,N.,
RA   Ovchinnikova,G., Foster,B., Clum,A., Larimer,F., Land,M., Hauser,L.,
RA   Markowitz,V., Cheng,J.-F., Hugenholtz,P., Woyke,T., Wu,D., Pukall,R.,
RA   Gehrich-Schroeter,G., Schneider,S., Klenk,H.-P. and Eisen,J.A.;
RT   "The complete genome of Cellulomonas flavigena DSM 20109";
RL   Unpublished
XX
RN   [2]
RP   1-4123179
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (14-MAY-2010) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-4123179
RG   US DOE Joint Genome Institute (JGI-PGF)
RA   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E., Tice,H.,
RA   Bruce,D., Goodwin,L., Pitluck,S., Kyrpides,N., Mavromatis,K., Ivanova,N.,
RA   Ovchinnikova,G., Foster,B., Clum,A., Larimer,F., Land,M., Hauser,L.,
RA   Markowitz,V., Cheng,J.-F., Hugenholtz,P., Woyke,T., Wu,D., Pukall,R.,
RA   Gehrich-Schroeter,G., Schneider,S., Klenk,H.-P. and Eisen,J.A.;
RT   "Direct Submission";
RL   Submitted (03-MAR-2010) US DOE Joint Genome Institute, 2800 Mitchell
RL   Drive, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence is identical to CP001964.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4082375
CC   Source DNA and organism available from Hans-Peter Klenk at the
CC   German Collection of Microorganisms and Cell Cultures (DSMZ)
CC   (hans-peter.klenk@dsmz.de)
CC   Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
CC   David Bruce (microbe@cuba.jgi-psf.org)
CC   Whole genome sequencing and draft assembly at JGI-PGF
CC   Finishing done by JGI-LANL
CC   Annotation by JGI-ORNL and JGI-PGF
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. It is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..4123179
FT                   /note="type strain of Cellulomonas flavigena"
FT                   /strain="DSM 20109"
FT                   /mol_type="genomic DNA"
FT                   /organism="Cellulomonas flavigena DSM 20109"
FT                   /db_xref="taxon:446466"
FT   gene            68..1672
FT                   /db_xref="GeneID:9147647"
FT                   /locus_tag="Cfla_0001"
FT   CDS_pept        68..1672
FT                   /locus_tag="Cfla_0001"
FT                   /gene_family="HOG000235658" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /codon_start="1"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   bcv:Bcav_0001 chromosomal replication initiator protein
FT                   DnaA; SMART: Chromosomal replication initiator DnaA domain;
FT                   AAA ATPase"
FT                   /db_xref="GI:296127870"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="GeneID:9147647"
FT                   /translation="MSQDEEPTRVWGHVVTSLEASPDITPRQLAFVRLAHPLGLLDGTM
FT                   LLAVGNDLTKEYLETRVRAEVTQALTEALGREARFAITVDAEVADDVPPALRVVPPAPS
FT                   APAGPSYDSPAYDGNAYEPPGYERSAEQRPDLALVTSHPGFLRDQGADEDAALVTPAEQ
FT                   PVEARPSLRAVDGSSYDAPAPRRGLSEPARLNPKYRFETFVIGSSNRFAHAAAVAVAEA
FT                   PAKAYNPLFIYGDSGLGKTHLLHAIGHYAQNLYPTVRVRYVNSEEFTNDFINSIGEGKA
FT                   GAFQRRYREVDVLLIDDIQFLQGKEQTMEEFFHTFNTLHNASKQVVITSDVPPKQLNGF
FT                   EDRMRSRFEWGLITDVQPPDLETRIAILRKKAASERLQAPDDVLEYIASRISTNIRELE
FT                   GALIRVTAFANLNRQLVDVSLAEIVLKDLISDDQTQEITATTVIGQTAAYFGLSIEDLC
FT                   GSSRSRVLVTARQIAMYLCRELTDLSLPKIGQAFGGRDHTTVMHANRKIRELMAERRSI
FT                   YNQVTELTNRIKQQHRG"
FT                   /protein_id="YP_003635120.1"
FT   misc_feature    95..>322
FT                   /note="chromosomal replication initiation protein;
FT                   Provisional; Region: dnaA; PRK14086"
FT                   /db_xref="CDD:172576"
FT                   /locus_tag="Cfla_0001"
FT   misc_feature    746..1123
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Cfla_0001"
FT   misc_feature    749..1123
FT                   /note="ATPases associated with a variety of cellular
FT                   activities; Region: AAA; smart00382"
FT                   /db_xref="CDD:128665"
FT                   /locus_tag="Cfla_0001"
FT   misc_feature    767..790
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Cfla_0001"
FT   misc_feature    order(770..793,956..958,1055..1057)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Cfla_0001"
FT   misc_feature    944..961
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Cfla_0001"
FT   misc_feature    1094..1096
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Cfla_0001"
FT   misc_feature    1388..1651
FT                   /note="C-terminal domain of bacterial DnaA proteins. The
FT                   DNA-binding C-terminal domain of DnaA contains a
FT                   helix-turn-helix motif that specifically interacts with the
FT                   DnaA box, a 9-mer motif that occurs repetitively in the
FT                   replication origin oriC. Multiple...; Region: Bac_DnaA_C;
FT                   cd06571"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="Cfla_0001"
FT   misc_feature    order(1451..1453,1475..1480,1499..1501,1517..1525,
FT                   1550..1564,1571..1573,1580..1585)
FT                   /note="DnaA box-binding interface; other site"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="Cfla_0001"
FT   gene            2426..3556
FT                   /db_xref="GeneID:9143864"
FT                   /locus_tag="Cfla_0002"
FT   CDS_pept        2426..3556
FT                   /locus_tag="Cfla_0002"
FT                   /gene_family="HOG000071793" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /codon_start="1"
FT                   /EC_number="2.7.7.7"
FT                   /transl_table="11"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: DNA polymerase III,
FT                   beta subunit; PFAM: DNA polymerase III beta chain"
FT                   /db_xref="GI:296127871"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="GeneID:9143864"
FT                   /translation="MRFRVDRDVLADAVTWTARSLPTRPPVPVLAGVRIEADTTGTVQL
FT                   SSFDYEVSARAQLPADVSEPGTVLVSGRLLAEISRALPAKPVDVVLDGTKVQVTCGASR
FT                   FTLLTMPVEDYPSLPVMPEVTGTVDGDELTHAVAQVSVAASRDDTLPLLTGVRVEIEGE
FT                   RVTLLATDRYRLALREMTWKPASPTVEAVALVRARTLSDAAKSLGGAGSVSVALSDGGG
FT                   VDLIGFEAGGRQTTSLLVDGDYPPVRRLFPDETPIHAIVHRQALAEAAKRVALVAERNT
FT                   PIRLSFSDGQVVLDAGQGDDAQASEALEASLVGDDISVAFNPQFLADGLGALDTTFVRM
FT                   SFTHPNKPVEFTGQESLEGDDRKDYRYLLVPIRFAT"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /protein_id="YP_003635121.1"
FT   misc_feature    2426..3550
FT                   /note="DNA polymerase III subunit beta; Validated; Region:
FT                   PRK07761"
FT                   /db_xref="CDD:169087"
FT                   /locus_tag="Cfla_0002"
FT   misc_feature    2426..3544
FT                   /note="Beta clamp domain.  The beta subunit (processivity
FT                   factor) of DNA polymerase III holoenzyme, refered to as the
FT                   beta clamp, forms a ring shaped dimer that encircles dsDNA
FT                   (sliding clamp) in bacteria.  The beta-clamp is
FT                   structurally similar to the...; Region: beta_clamp;
FT                   cd00140"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Cfla_0002"
FT   misc_feature    order(2495..2497,2642..2644,2663..2665,3017..3019)
FT                   /note="putative DNA binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Cfla_0002"
FT   misc_feature    order(2645..2647,2654..2656,2729..2731,2735..2737,
FT                   3248..3250,3338..3343)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Cfla_0002"
FT   misc_feature    order(2933..2935,2939..2950,3389..3391,3533..3544)
FT                   /note="beta-clamp/clamp loader binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Cfla_0002"
FT   misc_feature    order(2933..2935,2939..2944,3173..3175,3275..3277,
FT                   3314..3319,3398..3400,3533..3544)
FT                   /note="beta-clamp/translesion DNA polymerase binding
FT                   surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Cfla_0002"
FT   gene            3658..4587
FT                   /db_xref="GeneID:9143865"
FT                   /locus_tag="Cfla_0003"
FT   CDS_pept        3658..4587
FT                   /locus_tag="Cfla_0003"
FT                   /gene_family="HOG000255146" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00872"
FT                   /codon_start="1"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /transl_table="11"
FT                   /note="KEGG: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: 6-phosphogluconate dehydrogenase
FT                   NAD-binding; 6-phosphogluconate dehydrogenase domain
FT                   protein"
FT                   /db_xref="GI:296127872"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9143865"
FT                   /translation="MHIGLVGLGKMGANMRRRIREAGIEVTGFDRNPEVTDVPSLEALV
FT                   EALPAGERIVWVMVPSGPITDAVVQDLARLLSPGDLVIDGGNSYYQDDEPHAAALAEHG
FT                   VGFVDAGVSGGIWGLENGYGLMVGGSPQDVERAMPVFDALRPPGERADGFVHVGPVGAG
FT                   HYAKMVHNGIEYGLMQAYAEGYELLAAKDLVTDVQATMRAWTQGTVVRSWLLDLLVQAL
FT                   TEDPRFGAIDDWVEDSGEGRWTVDEAIDLAVPAPVISAALFARFASRQGESPAMKAVAA
FT                   LRQQFGGHAVRAAGAETVTPSAPPTSEA"
FT                   /protein_id="YP_003635122.1"
FT   misc_feature    3658..4542
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="Cfla_0003"
FT   misc_feature    3658..4539
FT                   /note="6-phosphogluconate dehydrogenase-like protein;
FT                   Reviewed; Region: PRK12490"
FT                   /db_xref="CDD:171538"
FT                   /locus_tag="Cfla_0003"
FT   gene            4593..5789
FT                   /db_xref="GeneID:9143866"
FT                   /locus_tag="Cfla_0004"
FT   CDS_pept        4593..5789
FT                   /locus_tag="Cfla_0004"
FT                   /gene_family="HOG000269561" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /codon_start="1"
FT                   /product="DNA replication and repair protein RecF"
FT                   /transl_table="11"
FT                   /note="KEGG: bcv:Bcav_0004 DNA replication and repair
FT                   protein RecF; TIGRFAM: DNA replication and repair protein
FT                   RecF; PFAM: SMC domain protein"
FT                   /db_xref="GI:296127873"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="GeneID:9143866"
FT                   /translation="MYVAHLSLTDFRSYPQVELPLEPGITALVGPNGQGKTNLVEAVGY
FT                   VATLGSHRVPSDAALVRAGTSRAVVRAKVVREERSTLVEVEITPGKANRSRVNGGSPGR
FT                   ARDVLGILRTVLFAPEDLALVKGDPDGRRRFLDELLVQLTPRIAGVLGDYERVLRQRSA
FT                   LLKSAAAATRARAGADLRTLDVWDAKLAQTGAQVVVARQALVRALQPRAADAYRQVSAG
FT                   QGELVLTYRSSLDAALDEAPDALTGAPDVGVELVEARLLDAMGRLRGKEIERGVCLVGP
FT                   HRDDLVLELGGLPAKGYASHGESWSVALALRLASYGLLTHGVDDAGAWSADWGPDGEPV
FT                   LILDDVFAELDARRRERLAELVAPARQVLVTAAVPQDVPEPLAGARVDVLGGEVARVL"
FT                   /protein_id="YP_003635123.1"
FT   misc_feature    4605..>5063
FT                   /note="RecF is a recombinational DNA repair ATPase that
FT                   maintains replication in the presence of DNA damage.  When
FT                   replication is prematurely disrupted by DNA damage, several
FT                   recF pathway gene products play critical roles processing
FT                   the arrested replication...; Region: ABC_RecF; cd03242"
FT                   /db_xref="CDD:73001"
FT                   /locus_tag="Cfla_0004"
FT   misc_feature    4680..4703
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73001"
FT                   /locus_tag="Cfla_0004"
FT   misc_feature    order(4689..4694,4698..4706,4896..4898)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73001"
FT                   /locus_tag="Cfla_0004"
FT   misc_feature    4887..4898
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73001"
FT                   /locus_tag="Cfla_0004"
FT   misc_feature    <5409..5744
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Cfla_0004"
FT   misc_feature    5487..5516
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0004"
FT   misc_feature    5610..5627
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0004"
FT   misc_feature    5634..5645
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0004"
FT   misc_feature    5700..5720
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0004"
FT   gene            5779..6402
FT                   /db_xref="GeneID:9143867"
FT                   /locus_tag="Cfla_0005"
FT   CDS_pept        5779..6402
FT                   /locus_tag="Cfla_0005"
FT                   /gene_family="HOG000235671" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF721"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   protein of unknown function DUF721"
FT                   /db_xref="GI:296127874"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="GeneID:9143867"
FT                   /translation="MSSRPGPRPASPAAARRADAPPADAGDDALLPAPTAVPDGLPVSE
FT                   LVTLTPPEQVARAALARAKAAARARGLRPGVVRGTATTSGAAPGPRDPQPLAVSAGLLA
FT                   RDLGWEPGLVVGDLVHRWAQIVGPQVADHCEYVSFASGLLTVRASSTAWAANLRLLAPA
FT                   MLARFDEALGAGVVVQVDVLGPVGHGFGRGPRRVAGRGPRDTYG"
FT                   /protein_id="YP_003635124.1"
FT   misc_feature    <6028..6294
FT                   /note="Protein of unknown function (DUF721); Region:
FT                   DUF721; cl02324"
FT                   /db_xref="CDD:174721"
FT                   /locus_tag="Cfla_0005"
FT   gene            6613..8709
FT                   /db_xref="GeneID:9143868"
FT                   /locus_tag="Cfla_0006"
FT   CDS_pept        6613..8709
FT                   /locus_tag="Cfla_0006"
FT                   /gene_family="HOG000075155" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /codon_start="1"
FT                   /EC_number="5.99.1.3"
FT                   /transl_table="11"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: DNA gyrase, B subunit; PFAM: DNA topoisomerase type
FT                   IIA subunit B region 2 domain protein; ATP-binding region
FT                   ATPase domain protein; TOPRIM domain protein; DNA gyrase
FT                   subunit B domain protein"
FT                   /db_xref="GI:296127875"
FT                   /db_xref="InterPro:IPR000565"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="GeneID:9143868"
FT                   /translation="MADQSTPRDPQDETAEGQDPGGAPTPDAPPAAKPSGSTYDASNIT
FT                   VLEGLEAVRKRPGMYIGSTGARGLHHLVYEVVDNSVDEALAGYCDTIEVTLLADGGVRV
FT                   TDNGRGIPVAIHPTEGRPTVEVVMTILHAGGKFGGGGYAVSGGLHGVGISVVNALSSRV
FT                   ETVVKRDGYAWSQSFADGGKPVGELRQGPATDETGTSQTFWADGTIFETTEYDFETLRA
FT                   RFQQYAFLNKGLKISLTDERPQHTGTEDEVTGETPSEAPATTARNVTYKYDGGLVDYVK
FT                   HLNSAKKVDHVHPDVIDFEAEDTTRRISVEIALQWTTAYSESVHTFANTISTTEGGTHE
FT                   EGFRAAMTSLMNRYARDKGILKEKDENLTGDDIREGLTAVISVKLGEPQFEGQTKTKLG
FT                   NTEAKRFVQTVVNDQLGAWLDAHPSEAKDVIRKSIQAAAARMAARKAREATRRKGLLES
FT                   NSMPGKLRDCQSNNPAECEVFIVEGDSAGGSAVRGRNPRTQAIMPIRGKILNVERARLD
FT                   KALGNQEVQALITAFGTGIGEDFDVSKLRYHKIVLMADADVDGQHIRTLLLTLLFRYMP
FT                   QLITGGFVYMAQPPLYRIKWSNAPHDYVYSDRERDAVITDGRANGRRLPKENGVQRYKG
FT                   LGEMDYTELWETTMSPEHRTLLQVTLDEAAAADEIFSVLMGEDVEARRGFIQRNAKDVR
FT                   FLDI"
FT                   /product="DNA gyrase, B subunit"
FT                   /protein_id="YP_003635125.1"
FT   misc_feature    6727..8706
FT                   /note="DNA gyrase, B subunit; Region: gyrB; TIGR01059"
FT                   /db_xref="CDD:162180"
FT                   /locus_tag="Cfla_0006"
FT   misc_feature    6808..>6978
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cl00075"
FT                   /db_xref="CDD:173995"
FT                   /locus_tag="Cfla_0006"
FT   misc_feature    7432..7917
FT                   /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
FT                   a ribosomal S5 domain 2-like fold, of the type found in
FT                   proteins of the type IIA family of DNA topoisomerases
FT                   similar to the B subunits of E. coli DNA gyrase and E. coli
FT                   Topoisomerase IV which are...; Region:
FT                   TopoII_Trans_DNA_gyrase; cd00822"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Cfla_0006"
FT   misc_feature    7597..7599
FT                   /note="anchoring element; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Cfla_0006"
FT   misc_feature    order(7771..7773,7780..7785,7789..7791)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Cfla_0006"
FT   misc_feature    order(7789..7791,7795..7797)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Cfla_0006"
FT   misc_feature    8038..8379
FT                   /note="TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM)
FT                   nucleotidyl transferase/hydrolase domain of the type found
FT                   in proteins of the type IIA family of DNA topoisomerases
FT                   similar to the Escherichia coli GyrB subunit. TopoIIA
FT                   enzymes cut both strands of...; Region:
FT                   TOPRIM_TopoIIA_GyrB; cd03366"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Cfla_0006"
FT   misc_feature    order(8056..8061,8068..8070,8275..8277,8281..8283,
FT                   8287..8289)
FT                   /note="active site"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Cfla_0006"
FT   misc_feature    order(8056..8058,8275..8277)
FT                   /note="putative metal-binding site; other site"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Cfla_0006"
FT   misc_feature    8500..8673
FT                   /note="DNA gyrase B subunit, carboxyl terminus; Region:
FT                   DNA_gyraseB_C; pfam00986"
FT                   /db_xref="CDD:144542"
FT                   /locus_tag="Cfla_0006"
FT   gene            8776..11388
FT                   /db_xref="GeneID:9143869"
FT                   /locus_tag="Cfla_0007"
FT   CDS_pept        8776..11388
FT                   /locus_tag="Cfla_0007"
FT                   /gene_family="HOG000076278" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /codon_start="1"
FT                   /EC_number="5.99.1.3"
FT                   /transl_table="11"
FT                   /note="SMART: DNA gyrase/topoisomerase IV subunit A;
FT                   TIGRFAM: DNA gyrase, A subunit; KEGG: DNA gyrase, A
FT                   subunit; PFAM: DNA gyrase/topoisomerase IV subunit A; DNA
FT                   gyrase repeat beta-propeller"
FT                   /db_xref="GI:296127876"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="GeneID:9143869"
FT                   /translation="MTETPGEIEHGRIDQVDLQLEMQRSYLDYAMAVIVGRALPDVRDG
FT                   LKPVHRRVLYAMYDGGYRPDRQFSKCSRVVGDVMGKYHPHGDSAIYDALVRLVQDWSLR
FT                   YPLVAGQGNFGSPGDDPAAAPRYTECKMAPLAMEMVRDIDEDAVDFQDNYDGHTQEPAV
FT                   LPSRFPNLLVNGSAGIAVGMATNIPPHNLREVAAGVQWHLEHPDASKEELLEALMARIK
FT                   GPDFPTAATILGRKGIEEAYRTGRGSITMRAVVEVEEIQGRQCLVVTELPYQVNPDTLA
FT                   KKIADLVKDNRVQGIADIRDETSGRAGQRLVIVLKRDAVAKVVLNNLYKHTQLQDTFGA
FT                   NMLALVDGVPRTLSIDAFVRHWVSHQIDVIQRRTRFRLRKAEEDIHIYRGYLKALDALD
FT                   EVIALIRRSPDAEEARNGLMELLGIDELQAQAILNLQLRRLAALQRQEIMDRHDALEAD
FT                   ITELNAILGSPERQRTIVSEELATVVDKFGDERRTHILPFDGEVSIEDLIAEEDVVVTI
FT                   TRGGYAKRTRVDAYRAQRRGGKGVRGAQLREDDLVDHFFVTTTHRWLLFFTNLGRVYRA
FT                   KAYELPEAGRDAKGQHVANLLAFQPGEKIAQVLDLRDYEQAEHLVLATKRGLVKKTRLT
FT                   EYDSNRSGGVIAINLREDEDGRPDELVAARLVDSDQDVILVSRQGQSVRFTASDEALRP
FT                   MGRATSGVTGMKFRGDDDLLAMDVVREDAFLFTVTEGGIAKRTALTVENYRQQGRGGLG
FT                   IKVANLPEANGDLVGALVTDADDEVLVIMERGKIVRSATSEVNATGRTTQGVIFAKPDT
FT                   GDRIIAVARNSERHLEDDGGTVSENVPNHDVPDPDQPDPAGSVTDGSVPDGDRPAEDA"
FT                   /product="DNA gyrase, A subunit"
FT                   /protein_id="YP_003635126.1"
FT   misc_feature    8779..11283
FT                   /note="DNA gyrase subunit A; Validated; Region: PRK05560"
FT                   /db_xref="CDD:168095"
FT                   /locus_tag="Cfla_0007"
FT   misc_feature    8878..10224
FT                   /note="DNA Topoisomerase, subtype IIA; domain A'; bacterial
FT                   DNA topoisomerase IV (C subunit, ParC), bacterial DNA
FT                   gyrases (A subunit, GyrA),mammalian DNA toposiomerases II.
FT                   DNA topoisomerases are essential enzymes that regulate the
FT                   conformational changes in...; Region: TOP4c; cd00187"
FT                   /db_xref="CDD:29149"
FT                   /locus_tag="Cfla_0007"
FT   misc_feature    order(8878..8961,8974..9123,9127..9183,9187..9258,
FT                   9265..9267)
FT                   /note="CAP-like domain; other site"
FT                   /db_xref="CDD:29149"
FT                   /locus_tag="Cfla_0007"
FT   misc_feature    9154..9156
FT                   /note="active site"
FT                   /db_xref="CDD:29149"
FT                   /locus_tag="Cfla_0007"
FT   misc_feature    order(9961..9969,9976..9987,10009..10014,10063..10113)
FT                   /note="primary dimer interface; other site"
FT                   /db_xref="CDD:29149"
FT                   /locus_tag="Cfla_0007"
FT   misc_feature    10306..10455
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Cfla_0007"
FT   misc_feature    10456..10602
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Cfla_0007"
FT   misc_feature    10627..10782
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Cfla_0007"
FT   misc_feature    10783..10938
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Cfla_0007"
FT   misc_feature    10939..11094
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Cfla_0007"
FT   misc_feature    11098..11247
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Cfla_0007"
FT   gene            11385..12302
FT                   /db_xref="GeneID:9143870"
FT                   /locus_tag="Cfla_0008"
FT   CDS_pept        11385..12302
FT                   /locus_tag="Cfla_0008"
FT                   /gene_family="HOG000235682" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcv:Bcav_0008 hypothetical protein"
FT                   /db_xref="GI:296127877"
FT                   /db_xref="GeneID:9143870"
FT                   /translation="MSETPPSIPPRRRPTSPTTSSSRPDQGGGVQAADHGGSSWASLGD
FT                   DSTPPTYTVDVRSSALPPASTSTGRTSAPSGPRPDDRPRSGSTAPHRTPTAGEEHGGDE
FT                   PPSPLVTAVDATTVWLKKAAGVTGSGLSRAYSQLTKPRSEDDPMTTTPTAGAAQRPAAR
FT                   TTAPVTGATPRPATGRIPTVGGGPRRVRLAISRVDPWSVMKLAFLLSVAIGIMIVVAAV
FT                   VVWFTLDSLQVFTQIDGLVRQVVGKESPLDILSYVSFQKTVSAATLVGVIDVFLLTALA
FT                   TIGAFLYNIVAALVGGVNVTMTDE"
FT                   /protein_id="YP_003635127.1"
FT   misc_feature    11940..12299
FT                   /note="Transmembrane domain of unknown function (DUF3566);
FT                   Region: DUF3566; pfam12089"
FT                   /db_xref="CDD:152524"
FT                   /locus_tag="Cfla_0008"
FT   gene            12444..12517
FT                   /note="tRNA-Ile1"
FT                   /db_xref="GeneID:9143871"
FT                   /locus_tag="Cfla_R0001"
FT   tRNA            12444..12517
FT                   /db_xref="GeneID:9143871"
FT                   /locus_tag="Cfla_R0001"
FT                   /product="tRNA-Ile"
FT   gene            12577..12696
FT                   /db_xref="GeneID:9143872"
FT                   /locus_tag="Cfla_0009"
FT   CDS_pept        12577..12696
FT                   /locus_tag="Cfla_0009"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bcav_0009"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcv:Bcav_0009 hypothetical protein"
FT                   /db_xref="GI:296127878"
FT                   /db_xref="GeneID:9143872"
FT                   /translation="MKKLLVLAALAAVGYVAWQKYAEDRDERDLWAEVTDTFE"
FT                   /protein_id="YP_003635128.1"
FT   gene            12713..12788
FT                   /note="tRNA-Ala1"
FT                   /db_xref="GeneID:9143873"
FT                   /locus_tag="Cfla_R0002"
FT   tRNA            12713..12788
FT                   /db_xref="GeneID:9143873"
FT                   /locus_tag="Cfla_R0002"
FT                   /product="tRNA-Ala"
FT   gene            12978..13370
FT                   /db_xref="GeneID:9143874"
FT                   /locus_tag="Cfla_0010"
FT   CDS_pept        12978..13370
FT                   /locus_tag="Cfla_0010"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mms:mma_1921 ECF subfamily RNA polymerase
FT                   sigma factor"
FT                   /db_xref="GI:296127879"
FT                   /db_xref="GeneID:9143874"
FT                   /translation="MEREKSDVLTETVRLQAARAVACGDLPDDVLTDVGRRLGDLRVSK
FT                   YIKWLDICMYGICIDLDFPWDIWQHGVFDEIFDDGLPVHRLGFEAVGLERPEVARVRVE
FT                   YRVDELAAKVQPRFTGLRLPQDPIPV"
FT                   /protein_id="YP_003635129.1"
FT   gene            13374..14390
FT                   /db_xref="GeneID:9143875"
FT                   /locus_tag="Cfla_0011"
FT   CDS_pept        13374..14390
FT                   /locus_tag="Cfla_0011"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /codon_start="1"
FT                   /product="Radical SAM domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ami:Amir_5373 radical SAM domain protein;
FT                   PFAM: Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="GI:296127880"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="GeneID:9143875"
FT                   /translation="MADAAGARAQTVVQLHPTLACNLTCAHCYSSSSPHERGGTDPAAL
FT                   ERALPELAAEGYRVVSVSGGEPFLYPHLQRVARAAHAAGMRVNLVTNGTVRVPSWVLDD
FT                   PASLDVVAVSLDGTASRHDELRRRAGAFDRALGTLRRLRAHGVRTAVVSCVTRASLPDV
FT                   PDLYEVCAAEGVDLLRLHPLARVGRGTELVDEPGGGLGLDAAQLLRLRVVAEMLSTMGG
FT                   PVVVADAPLAGELRALARDAAARRAGSDRAALADTVNPLVVREDGAVLPFAYGLPVSCS
FT                   LGTLESFTAGSEAHRRGRAAAELLERAVAALPEDDGACLDWEAHLVRCASSVGVGGR"
FT                   /protein_id="YP_003635130.1"
FT   misc_feature    13416..13961
FT                   /note="Radical SAM superfamily. Enzymes of this family
FT                   generate radicals by combining a 4Fe-4S cluster and
FT                   S-adenosylmethionine (SAM) in close proximity. They are
FT                   characterized by a conserved CxxxCxxC motif, which
FT                   coordinates the conserved iron-sulfur cluster...; Region:
FT                   Radical_SAM; cd01335"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="Cfla_0011"
FT   misc_feature    order(13434..13436,13440..13442,13446..13448,13452..13460,
FT                   13560..13562,13566..13571,13641..13649,13713..13715,
FT                   13833..13835,13908..13913)
FT                   /note="FeS/SAM binding site; other site"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="Cfla_0011"
FT   gene            14510..15739
FT                   /db_xref="GeneID:9143876"
FT                   /locus_tag="Cfla_0012"
FT   CDS_pept        14510..15739
FT                   /locus_tag="Cfla_0012"
FT                   /gene_family="HOG000220066" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01139"
FT                   /codon_start="1"
FT                   /product="protein of unknown function UPF0027"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function UPF0027; KEGG:
FT                   jde:Jden_1934 protein of unknown function UPF0027"
FT                   /db_xref="GI:296127881"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="GeneID:9143876"
FT                   /translation="MTTTTFPVELRGTAAPTLMWAHEHDVEQAALQQLRNIAALPWVHG
FT                   VRVMPDVHLGKGATVGSVIAMRDAVSPNAVGVDIGCGMIGVRTSLTAADLPDDLHALRT
FT                   AVESRIPVGFHAHDDPVDLRRLRPIGATARTAEALRGADAFWARFETLTPRVQQLESRA
FT                   RKQLGSLGGGNHFLEVCLDQDDQVWLQLHSGSRNIGKSLAEVHVAVAKGQPHNQGLVDR
FT                   DLAVLLAGTPEMDAYLNDLWWAQEYAARSRAVMMTLFVDAVRATFADRDVTFEEVANVH
FT                   HNYVATEHIDGADLVVTRKGAIRAGAGDLGLIPGSMGTGSYIVRGLGNPASYWSASHGA
FT                   GRRMSRAAAKRTFTLDDLAAQTAGVECRKDAGVLDEIPGAYKDLDEVIAAQADLVEVVA
FT                   RLRTIVCVKG"
FT                   /protein_id="YP_003635131.1"
FT   misc_feature    14552..15736
FT                   /note="Hedgehog/Intein domain, found in Hedgehog proteins
FT                   as well as proteins which contain inteins and undergo
FT                   protein splicing (e.g. DnaB, RIR1-2, GyrA and Pol). In
FT                   protein splicing an intervening polypeptide sequence - the
FT                   intein - is excised from a...; Region: Hint; cl12032"
FT                   /db_xref="CDD:175391"
FT                   /locus_tag="Cfla_0012"
FT   misc_feature    14585..15736
FT                   /note="hypothetical protein; Reviewed; Region: PRK09588"
FT                   /db_xref="CDD:169991"
FT                   /locus_tag="Cfla_0012"
FT   gene            16323..16526
FT                   /db_xref="GeneID:9143877"
FT                   /locus_tag="Cfla_0013"
FT   CDS_pept        16323..16526
FT                   /locus_tag="Cfla_0013"
FT                   /gene_family="HOG000070674" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /codon_start="1"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ach:Achl_0641 cold-shock DNA-binding domain
FT                   protein; PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein"
FT                   /db_xref="GI:296127882"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="GeneID:9143877"
FT                   /translation="MATGTVKWFNAEKGFGFIAPSDGSADVFAHYSAIASSGFRTLEEN
FT                   QQVEFEVTQGPKGLQASDIRPL"
FT                   /protein_id="YP_003635132.1"
FT   misc_feature    16329..16520
FT                   /note="Cold-Shock Protein (CSP) contains an S1-like
FT                   cold-shock domain (CSD) that is found in eukaryotes,
FT                   prokaryotes, and archaea.  CSP's include the major
FT                   cold-shock proteins CspA and CspB in bacteria and the
FT                   eukaryotic gene regulatory factor Y-box protein...; Region:
FT                   CSP_CDS; cd04458"
FT                   /db_xref="CDD:88424"
FT                   /locus_tag="Cfla_0013"
FT   misc_feature    order(16344..16346,16371..16373,16404..16406,16491..16493)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:88424"
FT                   /locus_tag="Cfla_0013"
FT   misc_feature    order(16362..16382,16401..16412)
FT                   /note="RNA-binding motif; other site"
FT                   /db_xref="CDD:88424"
FT                   /locus_tag="Cfla_0013"
FT   gene            complement(16699..17259)
FT                   /db_xref="GeneID:9143878"
FT                   /locus_tag="Cfla_0014"
FT   CDS_pept        complement(16699..17259)
FT                   /locus_tag="Cfla_0014"
FT                   /gene_family="HOG000097786" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Xcel_0973"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="GI:296127883"
FT                   /db_xref="GeneID:9143878"
FT                   /translation="MLLADLQARVRISLTTTLVDEWTLFAPSAGTSRPSERTISSHLGW
FT                   ALRGCVERSWDVDVDYDRSGMVLEASVRLDGATSRPPHLIVHQRGRLGPEHNLLLVELT
FT                   TDAADPGTPQLAVARAIQQRFGYRYAVLLDLRLDEDGTTAHVHPHWQWATLEDGLVTDE
FT                   PVPVYAEEVLAGILQRARRTTGR"
FT                   /protein_id="YP_003635133.1"
FT   gene            complement(17312..18001)
FT                   /db_xref="GeneID:9143879"
FT                   /locus_tag="Cfla_0015"
FT   CDS_pept        complement(17312..18001)
FT                   /locus_tag="Cfla_0015"
FT                   /gene_family="HOG000241187" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bcv:Bcav_3064 GCN5-related protein N- acetyltransferase"
FT                   /db_xref="GI:296127884"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="GeneID:9143879"
FT                   /translation="MSDTPRAPTAELTDVEIWPLTGLRVVSGDLELRAPDDRMLLDLAR
FT                   VAAQGVHREDYMPFLVPWTRGTPTQVARSVMTYQWGLRQRTTPADWAIELAVVRDGEPM
FT                   GTQGFYAKDFPVTRTVETGSWLGLRYQHGGIGTRMRLMVLHLLFEGFGARHATSSAFTD
FT                   NPGSAGVSRKIGYRENGVLHQAREGGPVDSQLFVLDRADWDARRDDLRIDVTIEGLEPV
FT                   KEQLGIA"
FT                   /protein_id="YP_003635134.1"
FT   misc_feature    complement(17414..17935)
FT                   /note="Acetyltransferases, including N-acetylases of
FT                   ribosomal proteins [Translation, ribosomal structure and
FT                   biogenesis]; Region: RimL; COG1670"
FT                   /db_xref="CDD:31856"
FT                   /locus_tag="Cfla_0015"
FT   gene            complement(18226..21198)
FT                   /db_xref="GeneID:9143880"
FT                   /locus_tag="Cfla_0016"
FT   CDS_pept        complement(18226..21198)
FT                   /locus_tag="Cfla_0016"
FT                   /gene_family="HOG000021032" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00759"
FT                   /codon_start="1"
FT                   /product="glycoside hydrolase family 9"
FT                   /transl_table="11"
FT                   /note="KEGG: tfu:Tfu_2176 endoglucanase; PFAM: glycoside
FT                   hydrolase family 9; type 3a cellulose-binding domain
FT                   protein; cellulose-binding family II; SMART:
FT                   cellulose-binding family II; Fibronectin type III domain
FT                   protein"
FT                   /db_xref="GI:296127885"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR001701"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR001956"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR008957"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR018221"
FT                   /db_xref="InterPro:IPR018366"
FT                   /db_xref="GeneID:9143880"
FT                   /translation="MPSTSAHRARRRSLWARTAAVALVVSGTVLPLQGAQAAPAYNYAE
FT                   ALQKSMFFYQAQRSGDLPANYPVSWRGDSGLDDGKDVGKDLTGGWYDAGDHVKFGLPMA
FT                   FTATMLAWGALESPDGYAAAGQTDELRDNLRAVNDYFVKAHTAPNELYVQVGKGDDDHK
FT                   WWGPAEVMTMARPAYKITAACPGSDAAAETAAAMASASLVFQGSDPSYAATLLTHAKQL
FT                   YSFADTYRGKYSDCVTDAQSFYKSWSGYQDELVWGAYWLYKATGDATYLAKAEAEYDKL
FT                   SNENQTTTKSYKWTVAWDDKSYAAYALLAMETGKQKYVDDANRWLDYWTVGVNGAKVTY
FT                   SPGGMAVLDSWGALRYAANTSFVALVYSDWLTDSTRKARYHDFGVRQINYALGDNPRKS
FT                   SYVVGFGANPPKNPHHRTAHGSWLDSLKDPAETRHVLYGALVGGPGSANDAYTDDRGDY
FT                   VANEVATDYNAGFTSALAYLTAQYGGTPLASFPRPETPDQDEFFVEAKLNQPAGGTFTE
FT                   VKAVVRNRSAFPARSLTNASIRYWFTLDAGVDASAVTVSTNYSECGTTPSKVVHAGGSL
FT                   YYAELSCAGQNIHPGGQSQHRREIQFRVAGTTGWDATNDPSFAGLPASGDPVRTKGITL
FT                   HEGSTLLWGTVPGGTTPTPTPTPTPTPTPTPTPTPTPTPTPTPSPSPTMHPIIASPQDV
FT                   RLVAAGDELRLTWTAPTIGAAVTGYQTQLDDEPLQSTRNTWYNRLDLAPGEHTIRVRSQ
FT                   AAEGTSAWVERTVSIPADGEWPTTVPVPANFEAKGGSHGFSFTWETPTGGPEVVAFETI
FT                   MTWSGSTGSPTISRDTAHAIMGYDFPRGDYTVSVRSVAADNSVSPWVTGTATITEGGIP
FT                   GITPPPTPPPTTPPAASCAVTYTANSWNSGFTASIRLTNTGATAVTWKLAFDLAAGQKV
FT                   QQGWSATWAQSGTTVTATGAAWNATLAPGGTIDLGFNGSHTGQNPDPTSFTLNGATCTA
FT                   G"
FT                   /protein_id="YP_003635135.1"
FT   misc_feature    complement(19765..21060)
FT                   /note="hydrolase, hydrolyzing O-glycosyl compounds; Region:
FT                   PLN00119"
FT                   /db_xref="CDD:165688"
FT                   /locus_tag="Cfla_0016"
FT   misc_feature    complement(19771..21060)
FT                   /note="Glycosyl hydrolase family 9; Region: Glyco_hydro_9;
FT                   cl02959"
FT                   /db_xref="CDD:174742"
FT                   /locus_tag="Cfla_0016"
FT   misc_feature    complement(19453..19698)
FT                   /note="Cellulose binding domain; Region: CBM_3; pfam00942"
FT                   /db_xref="CDD:109977"
FT                   /locus_tag="Cfla_0016"
FT   misc_feature    complement(18238..18534)
FT                   /note="Cellulose binding domain; Region: CBM_2; cl02709"
FT                   /db_xref="CDD:155069"
FT                   /locus_tag="Cfla_0016"
FT   gene            complement(21419..22330)
FT                   /db_xref="GeneID:9143881"
FT                   /locus_tag="Cfla_0017"
FT   CDS_pept        complement(21419..22330)
FT                   /locus_tag="Cfla_0017"
FT                   /gene_family="HOG000156369" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Xcel_0010"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="GI:296127886"
FT                   /db_xref="GeneID:9143881"
FT                   /translation="MTHRPKIDVDTERLKGQAAELGATLADGAKDAAARAGDAAGHAKD
FT                   WTAPKVEAFVAWLLPRLDHLYKESVKNAAPRVEEAAKRATPAIDTAHDKLVDELIPKLV
FT                   TALNEAAVKAGAQVEHAADVAAVTAGKQSKKLAKAAQKAAREAAKAERKHSGAKTFWLV
FT                   AGVLGAGAALFAWLRGRSTTDPWAEPWEPADGGDSLKARAQTVVGDAADAVGEVAGAAV
FT                   AKGREAAEAVAHATEELTDKAKHATEELTDKAKEAAEAAQDTARKATRRSATKKPDTPA
FT                   AGATPEAPESTATTTDGPGTAS"
FT                   /protein_id="YP_003635136.1"
FT   gene            22512..23051
FT                   /db_xref="GeneID:9143882"
FT                   /locus_tag="Cfla_0018"
FT   CDS_pept        22512..23051
FT                   /locus_tag="Cfla_0018"
FT                   /gene_family="HOG000065981" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:5.2.1.8"
FT                   /codon_start="1"
FT                   /EC_number="5.2.1.8"
FT                   /transl_table="11"
FT                   /note="KEGG: jde:Jden_0164 peptidylprolyl isomerase; PFAM:
FT                   peptidyl-prolyl cis-trans isomerase cyclophilin type"
FT                   /db_xref="GI:296127887"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR015891"
FT                   /db_xref="GeneID:9143882"
FT                   /translation="MFATIHTSAGDIRVELFENHAPRTVENFVGLAQGTKEWTDPSTGA
FT                   PRTDPLYKDVVFHRVIPDFMIQGGDPLGNGRGGPGYNFDDEIHPELTFSEPYLLAMANA
FT                   GKRLDPVTGRVGGTNGSQFFISVAATTWLNGKHTIFGKVVDDESRKVVDAIATTPTRPG
FT                   DRPVQDVTITSVTVEA"
FT                   /product="Peptidylprolyl isomerase"
FT                   /protein_id="YP_003635137.1"
FT   misc_feature    22521..23033
FT                   /note="cyclophilin: cyclophilin-type peptidylprolyl cis-
FT                   trans isomerases. This family contains eukaryotic,
FT                   bacterial and archeal proteins which exhibit a
FT                   peptidylprolyl cis- trans isomerases activity (PPIase,
FT                   Rotamase) and in addition bind the...; Region: cyclophilin;
FT                   cd00317"
FT                   /db_xref="CDD:29390"
FT                   /locus_tag="Cfla_0018"
FT   misc_feature    order(22686..22688,22692..22694,22701..22706,22710..22712,
FT                   22815..22820,22875..22877,22881..22883,22905..22910,
FT                   22920..22922)
FT                   /note="active site"
FT                   /db_xref="CDD:29390"
FT                   /locus_tag="Cfla_0018"
FT   gene            23227..23943
FT                   /db_xref="GeneID:9143883"
FT                   /locus_tag="Cfla_0019"
FT   CDS_pept        23227..23943
FT                   /locus_tag="Cfla_0019"
FT                   /gene_family="HOG000235716" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /codon_start="1"
FT                   /product="Rhomboid family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Rhomboid family protein; KEGG: rhomboid family
FT                   protein"
FT                   /db_xref="GI:296127888"
FT                   /db_xref="InterPro:IPR002610"
FT                   /db_xref="GeneID:9143883"
FT                   /translation="MHCVDCVAEAARTSREGRTVFGGRVRDGRPIVTLTIIGLCVASYV
FT                   LQLAVPGWTSRWAFSPVAGAFEPWRFLTAAFLHSTGVFHILFNMVALWMVGPSLEQTLG
FT                   RARFATLYLVSALGGSVGAVLLAPATGSWLTPIVGASGAVFGMFGAVLVVLRRMGRDAG
FT                   PIIGILVLNGVLGFVLPNIAWQAHLGGLVTGALLGAAYAYAPRERRAAVGWVAPATLVS
FT                   VLVVVTWVMYGANGLV"
FT                   /protein_id="YP_003635138.1"
FT   misc_feature    23422..23781
FT                   /note="Rhomboid family; Region: Rhomboid; cl11446"
FT                   /db_xref="CDD:175259"
FT                   /locus_tag="Cfla_0019"
FT   gene            complement(24148..24399)
FT                   /db_xref="GeneID:9143884"
FT                   /locus_tag="Cfla_0020"
FT   CDS_pept        complement(24148..24399)
FT                   /locus_tag="Cfla_0020"
FT                   /gene_family="HOG000235738" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06781"
FT                   /codon_start="1"
FT                   /product="protein of unknown function UPF0233"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function UPF0233; KEGG:
FT                   bcv:Bcav_0021 protein of unknown function UPF0233"
FT                   /db_xref="GI:296127889"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="GeneID:9143884"
FT                   /translation="MPESKSRKKATYTPPPVKASAPKPLPRWYLPLSLGLMILGLVSLV
FT                   VTYLSSGAALPVPGIGQWNLAVGFSIIIVGFGMLTRWR"
FT                   /protein_id="YP_003635139.1"
FT   misc_feature    complement(24151..24399)
FT                   /note="Uncharacterized protein family (UPF0233); Region:
FT                   UPF0233; cl11506"
FT                   /db_xref="CDD:175296"
FT                   /locus_tag="Cfla_0020"
FT   gene            24594..25436
FT                   /db_xref="GeneID:9143885"
FT                   /locus_tag="Cfla_0021"
FT   CDS_pept        24594..25436
FT                   /locus_tag="Cfla_0021"
FT                   /gene_family="HOG000019297" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05949"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF881"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF881; KEGG:
FT                   protein of unknown function DUF881"
FT                   /db_xref="GI:296127890"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="GeneID:9143885"
FT                   /translation="MTPTADVRAPRTRRRGLGRGAVSVGLVLGLSGLMFTVNARSSAGT
FT                   DDRHPQDLRELTQKQSATVERLSSEVDLLRAEVEQLTAEQNALAGRPAVQPRAGDVVAS
FT                   GSVPVSGRGLTVTMDDAPVDARREALSPDLLVVHQQDIQAVMNALWAGGAEAMGLMDQR
FT                   VVSTTGVQCQGNVLRLHGRMYSPPFVISVVGDPERLRAALDADGAVSVYVRDAGDLGLG
FT                   WDVQDRDTVDLPAYSGATELTWARVPDDVEVLPGYPATEPADAAPPVAAAPAAEGGLL"
FT                   /protein_id="YP_003635140.1"
FT   misc_feature    24903..25334
FT                   /note="Bacterial protein of unknown function (DUF881);
FT                   Region: DUF881; pfam05949"
FT                   /db_xref="CDD:147869"
FT                   /locus_tag="Cfla_0021"
FT   gene            25433..26239
FT                   /db_xref="GeneID:9143886"
FT                   /locus_tag="Cfla_0022"
FT   CDS_pept        25433..26239
FT                   /locus_tag="Cfla_0022"
FT                   /gene_family="HOG000235749" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01076"
FT                   /codon_start="1"
FT                   /product="sortase family protein"
FT                   /transl_table="11"
FT                   /note="KEGG: peptidase C60 sortase A and B; TIGRFAM:
FT                   sortase family protein; PFAM: peptidase C60 sortase A and
FT                   B"
FT                   /db_xref="GI:296127891"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="GeneID:9143886"
FT                   /translation="MSATSVRPPAHARTPRAAGGASFVYGLVGVVGELLITVGVLLLGF
FT                   LVWQLWWTDVEGNAAQAEIVREMNYTPPPPADDGGIRIAEPRRDEPPVPDEPGHAEQIA
FT                   QFVTPRWAGEQLRPISQGTDRPTVLDVLGIGHYEGTAMPGGLGNFALAGHRVTFGKPFN
FT                   RIEELQIGDALVVRTKDTWYVYKATATEVVLPRDVRVIWPVPNQEGVEPTERYITLTTC
FT                   HPMFSARERYVVHGVLDYWAPTADGVPAELAEMVESGQLDLSGGTA"
FT                   /protein_id="YP_003635141.1"
FT   misc_feature    25739..26149
FT                   /note="Sortase D (SrtD) is a membrane transpeptidase found
FT                   in gram-positive bacteria that anchors surface proteins to
FT                   peptidoglycans of the bacterial cell wall envelope. This
FT                   involves a transpeptidation reaction in which the surface
FT                   protein substrate is...; Region: Sortase_D_5; cd05830"
FT                   /db_xref="CDD:99713"
FT                   /locus_tag="Cfla_0022"
FT   misc_feature    order(25802..25804,25844..25846,25880..25882,25886..25888,
FT                   25892..25894,26093..26098,26114..26116,26123..26125)
FT                   /note="active site"
FT                   /db_xref="CDD:99713"
FT                   /locus_tag="Cfla_0022"
FT   misc_feature    order(25892..25894,26096..26098,26123..26125)
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:99713"
FT                   /locus_tag="Cfla_0022"
FT   gene            26286..26447
FT                   /db_xref="GeneID:9143887"
FT                   /locus_tag="Cfla_0023"
FT   CDS_pept        26286..26447
FT                   /locus_tag="Cfla_0023"
FT                   /gene_family="HOG000235750" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bfae_27010"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bfa:Bfae_27010 hypothetical protein"
FT                   /db_xref="GI:296127892"
FT                   /db_xref="GeneID:9143887"
FT                   /translation="MYGWLWRHLPGPVIVRVLLAAVLAAGVLAACFLWVYPAIAPYMPF
FT                   NETTVGEG"
FT                   /protein_id="YP_003635142.1"
FT   gene            26444..27067
FT                   /db_xref="GeneID:9143888"
FT                   /locus_tag="Cfla_0024"
FT   CDS_pept        26444..27067
FT                   /locus_tag="Cfla_0024"
FT                   /gene_family="HOG000025029" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /codon_start="1"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /transl_table="11"
FT                   /note="KEGG: jde:Jden_0168 glutamine amidotransferase of
FT                   anthranilate synthase; TIGRFAM: glutamine amidotransferase
FT                   of anthranilate synthase; PFAM: glutamine amidotransferase
FT                   class-I"
FT                   /db_xref="GI:296127893"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="InterPro:IPR001317"
FT                   /db_xref="InterPro:IPR006220"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR011702"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="GeneID:9143888"
FT                   /translation="MTRILVVDNYDSFVYTIVGYLDQLGAKTEVVRNDAVPPAAERAGY
FT                   DGVLISPGPGTPSDAGQSMQVIRDCAAAGTPMLGVCLGHQALGEVFGGTVTHAPELMHG
FT                   KTSPVEHGGQGVLAGLPSPFTATRYHSLAVVDGTFSDELEVTARTNGIVMGLQHRELPL
FT                   HGVQFHPESVLTEGGHRLLANWLQVCGAADAVERSQGLHPLVRL"
FT                   /protein_id="YP_003635143.1"
FT   misc_feature    26453..27001
FT                   /note="Type 1 glutamine amidotransferase (GATase1) domain
FT                   found in Anthranilate synthase; Region:
FT                   GATase1_Anthranilate_Synthase; cd01743"
FT                   /db_xref="CDD:153214"
FT                   /locus_tag="Cfla_0024"
FT   misc_feature    26456..27001
FT                   /note="Glutamine amidotransferase class-I; Region: GATase;
FT                   pfam00117"
FT                   /db_xref="CDD:143892"
FT                   /locus_tag="Cfla_0024"
FT   misc_feature    order(26597..26602,26606..26608,26684..26689,26696..26698,
FT                   26828..26839)
FT                   /note="glutamine binding; other site"
FT                   /db_xref="CDD:153214"
FT                   /locus_tag="Cfla_0024"
FT   misc_feature    order(26684..26686,26948..26950,26954..26956)
FT                   /note="catalytic triad; other site"
FT                   /db_xref="CDD:153214"
FT                   /locus_tag="Cfla_0024"
FT   gene            complement(27151..29157)
FT                   /db_xref="GeneID:9143889"
FT                   /locus_tag="Cfla_0025"
FT   CDS_pept        complement(27151..29157)
FT                   /locus_tag="Cfla_0025"
FT                   /gene_family="HOG000037185" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /codon_start="1"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /transl_table="11"
FT                   /note="KEGG: serine/threonine protein kinase with PASTA
FT                   sensor(s); PFAM: Serine/threonine-protein kinase-like
FT                   domain; PASTA domain containing protein; SMART:
FT                   serine/threonine protein kinase; Tyrosine- protein kinase,
FT                   subgroup, catalytic domain; PASTA domain containing
FT                   protein"
FT                   /db_xref="GI:296127894"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="GeneID:9143889"
FT                   /translation="MVDDGSRILAGRYQVGELIGRGGMAEVHIGHDTRLGRTVAIKILR
FT                   SDLARDPSFQARFRREAQSAAALNHPAIVAVYDTGEDVFTEPNGQVAHVPFIVMEYVEG
FT                   HTVRDILRDGHAVPIDEGIEIAAGVLSALEYSHHAGIVHRDIKPANVMITPTGAVKVMD
FT                   FGIARAVADSAATMTQTQAVIGTAQYLSPEQARGEQVDARSDLYSTGCLLFELLTGRPP
FT                   FVGDSPVAVAYQHVREVPPVPSAIASDLPETLDRITLKALAKERDARYSTAAEFRADLE
FT                   AVLRGGHVNAPAVGAALATLPTGDATQVMAPPVATTQAMPPATAPWGATGLAATMTGTP
FT                   PDGDEDEKRPWLIWVLVAVAVLAVGGIVWAILANQDPPEDPTVEIPPVAGMTQEEAFAA
FT                   LREVDLRPVPAQEPSTEFEANLATRTDPPEGTPVDKEAEVRVYISSGPSEVTVPDVTDL
FT                   TEAEAVDALEAAGLTVSPTRQSEDHPTIAKGRVVRTEPAANAPVKAGAEVTLIVGSGTV
FT                   TVPDVRGKHQEDAIPELEALGLRVSTSREESNEPEGTVVTQDRVDAIVPQGTTVNLGIA
FT                   EPSSTATVPTNLRSMTYDDAVAALAAVGLTNVTREEVQSDEPQGTVVSTEPSGGTKIAK
FT                   EQQVKIRVSRGPGGGNNGGGGGGGNTPTPTPTN"
FT                   /protein_id="YP_003635144.1"
FT   misc_feature    complement(28339..29124)
FT                   /note="Protein Kinases, catalytic domain; Region: PKc_like;
FT                   cl09925"
FT                   /db_xref="CDD:175044"
FT                   /locus_tag="Cfla_0025"
FT   misc_feature    complement(order(28594..28605,28660..28662,28669..28671,
FT                   28702..28704,28708..28713,28717..28719,28723..28725,
FT                   28834..28836,28840..28842,28852..28863,28936..28938,
FT                   29032..29034,29038..29040,29077..29079,29089..29103))
FT                   /note="active site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Cfla_0025"
FT   misc_feature    complement(order(28669..28671,28702..28704,28708..28713,
FT                   28717..28719,28723..28725,28840..28842,28852..28863,
FT                   28936..28938,29032..29034,29038..29040,29077..29079,
FT                   29089..29103))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Cfla_0025"
FT   misc_feature    complement(28321..29091)
FT                   /note="Serine/Threonine protein kinases, catalytic domain;
FT                   Region: S_TKc; smart00220"
FT                   /db_xref="CDD:128516"
FT                   /locus_tag="Cfla_0025"
FT   misc_feature    complement(order(28594..28605,28660..28662,28711..28713,
FT                   28717..28719,28723..28725,28834..28836,28840..28842,
FT                   29089..29091))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Cfla_0025"
FT   misc_feature    complement(order(28594..28605,28654..28674))
FT                   /note="activation loop (A-loop); other site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Cfla_0025"
FT   misc_feature    complement(27826..28008)
FT                   /note="PASTA domain of bacterial serine/threonine kinase
FT                   pknB-like proteins. PknB is a member of a group of related
FT                   transmembrane sensor kinases present in many gram positive
FT                   bacteria, which has been shown to regulate cell shape in
FT                   Mycobacterium tubercolosis...; Region: PASTA_pknB; cd06577"
FT                   /db_xref="CDD:119328"
FT                   /locus_tag="Cfla_0025"
FT   misc_feature    complement(27622..27807)
FT                   /note="PASTA domain of bacterial serine/threonine kinase
FT                   pknB-like proteins. PknB is a member of a group of related
FT                   transmembrane sensor kinases present in many gram positive
FT                   bacteria, which has been shown to regulate cell shape in
FT                   Mycobacterium tubercolosis...; Region: PASTA_pknB; cd06577"
FT                   /db_xref="CDD:119328"
FT                   /locus_tag="Cfla_0025"
FT   misc_feature    complement(27439..27606)
FT                   /note="PASTA domain of bacterial serine/threonine kinase
FT                   pknB-like proteins. PknB is a member of a group of related
FT                   transmembrane sensor kinases present in many gram positive
FT                   bacteria, which has been shown to regulate cell shape in
FT                   Mycobacterium tubercolosis...; Region: PASTA_pknB; cd06577"
FT                   /db_xref="CDD:119328"
FT                   /locus_tag="Cfla_0025"
FT   misc_feature    complement(27223..27411)
FT                   /note="PASTA domain. This domain is found at the C-termini
FT                   of several Penicillin-binding proteins (PBPs) and bacterial
FT                   serine/threonine kinases. It is a small globular fold
FT                   consisting of 3 beta-sheets and an alpha-helix. The name
FT                   PASTA is derived from PBP and...; Region: PASTA; cl02768"
FT                   /db_xref="CDD:141692"
FT                   /locus_tag="Cfla_0025"
FT   gene            complement(29157..30491)
FT                   /db_xref="GeneID:9143890"
FT                   /locus_tag="Cfla_0026"
FT   CDS_pept        complement(29157..30491)
FT                   /locus_tag="Cfla_0026"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /codon_start="1"
FT                   /product="serine/threonine protein kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: Serine/threonine-protein kinase-like domain;
FT                   KEGG: jde:Jden_0171 serine/threonine protein kinase"
FT                   /db_xref="GI:296127895"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="GeneID:9143890"
FT                   /translation="MRTAPGVALGGGRYRLLRRIAVGGMGEVWEANDDALARAVAVKVL
FT                   RDEFAGDPGFLERFRTEARNSAALHHPHIAALFDYGEQDGSAYLVMELVVGEPLSDLLE
FT                   REPVLPARRLLPMLAQTARGLHAAHLAGVVHRDVKPGNILIARSGKVKITDFGVSLAAD
FT                   QKTMTATGMVMGTAQYLSPEQAVGRPATPLSDLYSLGVVAYEGLAGKRPFTGPTAVDIA
FT                   VAHVNDPVPPLPASVDRKLAALVMRLLSKEPTDRPASGEELAGLFDRLMPQTPPSGVAV
FT                   LVGKPTRAREARRSTPPPAAPEQTPDGHDGPPSYPPSRRERAGRGPRDATLQDGTRRNR
FT                   HAVDEGPLDGVLATAMGWVRRLRLPLVALVLVLVALLGAALADRLLGSAPVEPTGGVLV
FT                   VAEYPRGGPPGGMIAAEPTRDGAPARADAVPARNGDPRPTEVKDS"
FT                   /protein_id="YP_003635145.1"
FT   misc_feature    complement(29703..30425)
FT                   /note="Protein kinase domain; Region: Pkinase; pfam00069"
FT                   /db_xref="CDD:143851"
FT                   /locus_tag="Cfla_0026"
FT   misc_feature    complement(29721..30425)
FT                   /note="Catalytic domain of Protein Kinases; Region: PKc;
FT                   cd00180"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Cfla_0026"
FT   misc_feature    complement(order(29958..29969,30018..30020,30027..30029,
FT                   30060..30062,30066..30071,30075..30077,30081..30083,
FT                   30192..30194,30198..30200,30210..30221,30267..30269,
FT                   30363..30365,30369..30371,30408..30410,30420..30425))
FT                   /note="active site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Cfla_0026"
FT   misc_feature    complement(order(30027..30029,30060..30062,30066..30071,
FT                   30075..30077,30081..30083,30198..30200,30210..30221,
FT                   30267..30269,30363..30365,30369..30371,30408..30410,
FT                   30420..30425))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Cfla_0026"
FT   misc_feature    complement(order(29958..29969,30018..30020,30069..30071,
FT                   30075..30077,30081..30083,30192..30194,30198..30200,
FT                   30420..30422))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Cfla_0026"
FT   misc_feature    complement(order(29958..29969,30012..30032))
FT                   /note="activation loop (A-loop); other site"
FT                   /db_xref="CDD:173623"
FT                   /locus_tag="Cfla_0026"
FT   gene            complement(30488..31939)
FT                   /db_xref="GeneID:9143891"
FT                   /locus_tag="Cfla_0027"
FT   CDS_pept        complement(30488..31939)
FT                   /locus_tag="Cfla_0027"
FT                   /gene_family="HOG000235771" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /codon_start="1"
FT                   /EC_number="2.4.1.129"
FT                   /transl_table="11"
FT                   /note="KEGG: jde:Jden_0172 peptidoglycan
FT                   glycosyltransferase; PFAM: penicillin-binding protein
FT                   transpeptidase"
FT                   /db_xref="GI:296127896"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="GeneID:9143891"
FT                   /translation="MNTPLRRLATITLVMFVALMGSATWVQFFQAESLNTDGRNVRTLY
FT                   REHGNARGPIVAGGEAIATSVPVDDPFGYQRTYSQGDLYSAVTGFYSIANSRSQLELAE
FT                   NDQLTGRSDQLFFTRIRDLLTGKRPEGAAVETTILPAAQQAARNGLGAQHGAVVALEPA
FT                   TGRILALVSTPGFDPNVLAVHSTSEAAAQYRALDQADGNPLRPNTHQERYAPGSTFKLV
FT                   TAAAALESGDYQADTPVPSPDQLTLPQTSATIGNFGGGSCGGEQVSLADALRTSCNTAF
FT                   ASLGMTLGEDVLREQSERFGFLDPDLAVPMPVVESVFPSDLDQAVLAQSAIGQRDVQAS
FT                   PLQMAMVASAIANGGRLMTPYLVETVRAADLTIVSQTDPEPYSDAVSSATASALTQMMV
FT                   GVVDSGTGKAARIAGVQVAGKTGTAQTVEGQPPHAWFTAFAPADAPRVAVAVIVENGGN
FT                   LGNEATGGAVAAPIARAVIEAVLAS"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /protein_id="YP_003635146.1"
FT   misc_feature    complement(30506..31477)
FT                   /note="Penicillin binding protein transpeptidase domain;
FT                   Region: Transpeptidase; cl01039"
FT                   /db_xref="CDD:154162"
FT                   /locus_tag="Cfla_0027"
FT   gene            complement(31936..33537)
FT                   /db_xref="GeneID:9143892"
FT                   /locus_tag="Cfla_0028"
FT   CDS_pept        complement(31936..33537)
FT                   /locus_tag="Cfla_0028"
FT                   /gene_family="HOG000282687" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /codon_start="1"
FT                   /product="cell cycle protein"
FT                   /transl_table="11"
FT                   /note="PFAM: cell cycle protein; KEGG: bcv:Bcav_0029 cell
FT                   cycle protein"
FT                   /db_xref="GI:296127897"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="GeneID:9143892"
FT                   /translation="MASVQPHRVRPGRGTELLLLVPALGIGIAGYVLAGLGATGAVPPH
FT                   VIAYAAGTTVLAVAVHLVLRLRAPYADPVILPVVVALNGIGLAMIYRISIAYAARGRAD
FT                   ANIADRQLAWTAISVALAVAVLWLLRDHRTLRRYTYTAMVAGLVLILLPLVPVLGQTIN
FT                   GARIWVRVGPVGMQPAEFGKIALAVFFAGYLVTHRDTLALAGKRVLALQLPRARDLGPI
FT                   LLVWAASLVVLVLQRDLGTSLLFFGLFVAVLYLATERTSWIVIGLVLFVGGAAVAAATF
FT                   GHVGARFDVWLHALDDEIFRRDPGGSGQLVYGLFGMASGGLFGTGLGQGRPDLVPFAYS
FT                   DFIVAALGEELGLTGLIAILLLYTILVSRGLRTAIGVRDGFGKLLAGGLSFVMAFQLFV
FT                   VVGGVTRLIPLTGLTTPFLAYGGSSLVANWVIAALLLRISDEARRPVPTVRAVATPDIG
FT                   VPVSAPGRSRPVGGGRSTGRTGTPAVGTPVVVGSAPVRTSTVTPPDGPERGPASDDSPT
FT                   EHLDHASDTDERGETR"
FT                   /protein_id="YP_003635147.1"
FT   misc_feature    complement(32212..33324)
FT                   /note="Cell cycle protein; Region: FTSW_RODA_SPOVE;
FT                   cl00511"
FT                   /db_xref="CDD:174253"
FT                   /locus_tag="Cfla_0028"
FT   gene            complement(33537..34976)
FT                   /db_xref="GeneID:9143893"
FT                   /locus_tag="Cfla_0029"
FT   CDS_pept        complement(33537..34976)
FT                   /locus_tag="Cfla_0029"
FT                   /gene_family="HOG000235782" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:3.1.3.16"
FT                   /codon_start="1"
FT                   /EC_number="3.1.3.16"
FT                   /transl_table="11"
FT                   /note="PFAM: Protein phosphatase 2C-like; KEGG:
FT                   bcv:Bcav_0030 protein serine/threonine phosphatase; SMART:
FT                   protein phosphatase 2C domain protein"
FT                   /db_xref="GI:296127898"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR014045"
FT                   /db_xref="GeneID:9143893"
FT                   /translation="MTVALRYAARSDVGLVRSDNQDSAYAGPHLLVVADGMGGHAGGDV
FT                   ASSVAVAALAPLDGESHGPDDALDELETALDDARAEIIARSDAEPDLAGMGTTVTAILR
FT                   AGNKLAMVHLGDSRGYLFRDGTLTQVTTDHTFVQHLVDTGRITPEEAEHHPQRSVVMRV
FT                   LGDFDSDVTADLSVREARPGDRWLLCSDGLSGYVSAETIAETLGEIEDVDACADRLVQL
FT                   ALRAGGPDNVTVVIADVVELDELPDGAMPSTTSAVVGAAASTRNRPSAAADGPAARAAS
FT                   LSRKARADAAAAGSGPDGDDEKPGDGGDDASATGADRPRDEDDDEDLAPAPRRRGLALT
FT                   WLAVGLALVAALAGGYLWTQSQYFVGAHEGTVAIYRGIAQTLGPVELADIVETSDVQVD
FT                   DLPAYLRERVEQTISAGSLEEARRLVEMLEEGVVETRPTPTPSPTPSPTTSPTPEPTTT
FT                   TAPPPNAGAPTPGHPTVAATL"
FT                   /product="protein serine/threonine phosphatase"
FT                   /protein_id="YP_003635148.1"
FT   misc_feature    complement(34260..34961)
FT                   /note="Serine/threonine phosphatases, family 2C, catalytic
FT                   domain; The protein architecture and deduced catalytic
FT                   mechanism of PP2C phosphatases are similar to the PP1,
FT                   PP2A, PP2B family of protein Ser/Thr phosphatases, with
FT                   which PP2C shares no sequence...; Region: PP2Cc; cd00143"
FT                   /db_xref="CDD:29062"
FT                   /locus_tag="Cfla_0029"
FT   misc_feature    complement(order(34287..34289,34404..34406,34866..34874,
FT                   34911..34916,34926..34928))
FT                   /note="active site"
FT                   /db_xref="CDD:29062"
FT                   /locus_tag="Cfla_0029"
FT   gene            complement(34981..35490)
FT                   /db_xref="GeneID:9143894"
FT                   /locus_tag="Cfla_0030"
FT   CDS_pept        complement(34981..35490)
FT                   /locus_tag="Cfla_0030"
FT                   /gene_family="HOG000235793" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /codon_start="1"
FT                   /product="FHA domain containing protein"
FT                   /transl_table="11"
FT                   /note="KEGG: jde:Jden_0175 FHA domain containing protein;
FT                   PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein"
FT                   /db_xref="GI:296127899"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="GeneID:9143894"
FT                   /translation="MSELTVTLLRLGYLALLWFLVLSAITVLRRDLYGTRIIDRRRTPG
FT                   RATPASSADSPVPVGESPRAPRRPRGTTGPTRLVVTEGPLRGTTLPLGTSAVLVGRAPS
FT                   CTLVLDDDYSSSRHARIFPQGEQWFVEDLGSTNGTFVGETRVEQPTPVPTGTAVRIGQS
FT                   LLELQR"
FT                   /protein_id="YP_003635149.1"
FT   misc_feature    complement(35002..35259)
FT                   /note="Forkhead associated domain (FHA); found in
FT                   eukaryotic and prokaryotic proteins. Putative nuclear
FT                   signalling domain. FHA domains may bind phosphothreonine,
FT                   phosphoserine and sometimes phosphotyrosine. In eukaryotes,
FT                   many FHA domain-containing proteins...; Region: FHA;
FT                   cd00060"
FT                   /db_xref="CDD:28942"
FT                   /locus_tag="Cfla_0030"
FT   misc_feature    complement(order(35077..35085,35143..35148,35152..35154,
FT                   35188..35190))
FT                   /note="phosphopeptide binding site; other site"
FT                   /db_xref="CDD:28942"
FT                   /locus_tag="Cfla_0030"
FT   gene            complement(35500..36207)
FT                   /db_xref="GeneID:9143895"
FT                   /locus_tag="Cfla_0031"
FT   CDS_pept        complement(35500..36207)
FT                   /locus_tag="Cfla_0031"
FT                   /gene_family="HOG000235804" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /codon_start="1"
FT                   /product="FHA domain containing protein"
FT                   /transl_table="11"
FT                   /note="KEGG: FHA domain containing protein; PFAM:
FT                   Forkhead-associated protein; SMART: Forkhead-associated
FT                   protein"
FT                   /db_xref="GI:296127900"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="GeneID:9143895"
FT                   /translation="MGFLDKFENGVERVVNNAFARAFRSDVKPIELADALRRELDDRAA
FT                   VVGRDRTVVPNEFTIELSTPDYDQVEAWGAEALAEELAANVTEHASSQHYAFVGPVTVS
FT                   FSENTDQEAGRFAVHSATVRGPVAPATNAAPSPRHPLIDIDGQRYILTGPVTVIGRGSE
FT                   ADIIVDDPGVSRRHLEIRVTPDGVIASDMGSTNGVFVEGHQVPAATLLDGNTLTIGRTR
FT                   ILFWTGGDADVDE"
FT                   /protein_id="YP_003635150.1"
FT   misc_feature    complement(35848..36198)
FT                   /note="Protein of unknown function (DUF2662); Region:
FT                   DUF3662; pfam12401"
FT                   /db_xref="CDD:152836"
FT                   /locus_tag="Cfla_0031"
FT   misc_feature    complement(35533..35781)
FT                   /note="Forkhead associated domain (FHA); found in
FT                   eukaryotic and prokaryotic proteins. Putative nuclear
FT                   signalling domain. FHA domains may bind phosphothreonine,
FT                   phosphoserine and sometimes phosphotyrosine. In eukaryotes,
FT                   many FHA domain-containing proteins...; Region: FHA;
FT                   cd00060"
FT                   /db_xref="CDD:28942"
FT                   /locus_tag="Cfla_0031"
FT   misc_feature    complement(order(35617..35625,35683..35688,35692..35694,
FT                   35728..35730))
FT                   /note="phosphopeptide binding site; other site"
FT                   /db_xref="CDD:28942"
FT                   /locus_tag="Cfla_0031"
FT   gene            36595..36677
FT                   /note="tRNA-Leu1"
FT                   /db_xref="GeneID:9143896"
FT                   /locus_tag="Cfla_R0003"
FT   tRNA            36595..36677
FT                   /db_xref="GeneID:9143896"
FT                   /locus_tag="Cfla_R0003"
FT                   /product="tRNA-Leu"
FT   gene            complement(36945..38582)
FT                   /db_xref="GeneID:9143897"
FT                   /locus_tag="Cfla_0032"
FT   CDS_pept        complement(36945..38582)
FT                   /locus_tag="Cfla_0032"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rop:ROP_54290 hypothetical protein"
FT                   /db_xref="GI:296127901"
FT                   /db_xref="GeneID:9143897"
FT                   /translation="MKARRAGQSRPLMSSTGLSRIIYKPPPLTSAQKVRRARAWAESDV
FT                   VSRLVTARTHNVGRHRAYPLDAIAAGIFLHALSSPTAFTLAGVTRTLLSASPSDRFALG
FT                   FPPRTVIRYRPILSGFHALEDALGVGFLVPHDHELTADPETGEVDECPEGCPFAPASLD
FT                   EVATGLVQASIPSTWTPPSVVAIDGTDVESAYRARTANTGTDAGDRPAADPDARWAKRT
FT                   GTDRRPNELYFGYEAHIATYAPEPAGEPLPQLAAGLAMRPGVKDRAGAALGILDALRHV
FT                   KEVLLDRGYTTSRAEKLARPLRERGIAVTMDLHSTQRGVRPGPITGSLWIDGALYSDAL
FT                   PDPLRQLEPPKIGDTATQKARARELFDKREAYRFTALARRRDELGSQRWKGPALAGHLR
FT                   CPNTPASMRLGRHLPTAQCLRGGNCACGKTVTVRDTDLERDRQPLPWQSTRWALSFNRR
FT                   SLIEGLNAQLRYQVRNVNRGYFRVAGLVATTLLMAVTLAAHNIERLRGWHLARHQPDPW
FT                   QVKLGEEPSDEPMDRHTWTKGRRRPYRG"
FT                   /protein_id="YP_003635151.1"
FT   gene            complement(38579..39544)
FT                   /db_xref="GeneID:9143898"
FT                   /locus_tag="Cfla_0033"
FT   CDS_pept        complement(38579..39544)
FT                   /locus_tag="Cfla_0033"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cef:CE0267 hypothetical protein"
FT                   /db_xref="GI:296127902"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="GeneID:9143898"
FT                   /translation="MRPSSDSRTRSVYRHAAGPLTPEQAVAGYIPKALRPEDWAPVAAF
FT                   TRAVAVEVHPADDRRAVETMRTLSQFLVWAHREGLPLDREQIFTPDVVSRYIQVGCTHL
FT                   AEPSRATRRSDLRRFGAAVTTKAPWEPPEERLRANQRIVPYTAAEVVRLLEVASQQRTP
FT                   LQQRRMQAFLALGLGAGLYPREIWHVTTENLVERHGHLCLTVPGKLARTIPISPPHDGP
FT                   LQRIREEDPGSLLLSFFAADWDRSRLSRLMQYLELPPDCPPLRLSRLRVTWVKEHLEHG
FT                   VHLGALAQLAGVTSSKIFGYVMPFMAPLPEHEVFASMVRR"
FT                   /protein_id="YP_003635152.1"
FT   gene            complement(39670..39903)
FT                   /db_xref="GeneID:9143899"
FT                   /locus_tag="Cfla_0034"
FT   CDS_pept        complement(39670..39903)
FT                   /locus_tag="Cfla_0034"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:RALTA_B0558"
FT                   /codon_start="1"
FT                   /product="putative MscS mechanosensitive ion channel"
FT                   /transl_table="11"
FT                   /note="KEGG: cti:RALTA_B0558 putative MscS mechanosensitive
FT                   ion channel"
FT                   /db_xref="GI:296127903"
FT                   /db_xref="GeneID:9143899"
FT                   /translation="MNDPGIAVHVAPARSGRPPSRSRDLKPHELVRVEIRMPAAVAGPL
FT                   FARARAAERPVSAVASDLLAAALADAAGDAMA"
FT                   /protein_id="YP_003635153.1"
FT   gene            41751..44126
FT                   /db_xref="GeneID:9143900"
FT                   /locus_tag="Cfla_0035"
FT   CDS_pept        41751..44126
FT                   /locus_tag="Cfla_0035"
FT                   /gene_family="HOG000218326" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02696"
FT                   /codon_start="1"
FT                   /EC_number="2.7.7.8"
FT                   /transl_table="11"
FT                   /note="SMART: KH domain protein; TIGRFAM: guanosine
FT                   pentaphosphate synthetase I/polyribonucleotide
FT                   nucleotidyltransferase; polyribonucleotide
FT                   nucleotidyltransferase; KEGG: guanosine pentaphosphate
FT                   synthetase I/polyribonucleotide   nucleotidyltransferase;
FT                   PFAM: 3' exoribonuclease; Exoribonuclease, phosphorolytic
FT                   domain 2; Polynucleotide phosphorylase, phosphorolytic
FT                   RNA-binding, bacterial/organelle-type; K Homology, type 1,
FT                   subgroup; RNA binding S1 domain protein"
FT                   /db_xref="GI:296127904"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014069"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR018111"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="GeneID:9143900"
FT                   /translation="MTRADLFAGSRIELLSTGPSQVSEAESERIREEVAQALRAHVPVQ
FT                   FAEATIDNGRFGTRTVRFETGRLAKQAAGSAVAYLDDDTMLLSATTAGKHPREAFDFFP
FT                   LTVDVEERQYAAGKIPGAFFRREGRPSTDAILACRLIDRPLRPLFVKGLRNEVQVVVTV
FT                   LSINPDDAYDVLAINAASISTQLSGLPFSGPVAATRLALVDGQWVAFPRYSERERSTFD
FT                   IVVAGRVVGDDVAIAMIEADAPENAWNLIHGGGGTAPTEEVVAQGLEASKPFIKVLVEA
FT                   QQQLAAQAAKETQTFPTFPDYQPDAFAAVEQAASERLSAALQIAGKQERENRLDEIKGE
FT                   VAGELAAQFEGREKEISAAYRSLQKQLIRQRILTDGFRIDGRGLRDIRTLSAEVEVLPR
FT                   THGSALFERGETQILGVTTLNMLRMEQQIDSLSPETRKRYMHHYNFPPYSTGETGRVGS
FT                   PKRREIGHGALAERAIVPVLPAREEFPYAIRQVSEALGSNGSTSMGSVCAATLSLLNAG
FT                   VPLRAPVAGIAMGLVSDTVDGETRYAALTDILGAEDAFGDMDFKVAGTREFVTAIQLDT
FT                   KLDGIPASVLAGALTQAKEARLAILDVIAEAIDVPDEMSPFAPRVISVKVPVDKIGEVI
FT                   GPKGKMINQIQEETGADISIEDDGTVYIGATDGPSAEAARAAINAIANPHMPEIGERFV
FT                   GTVVKTTTFGAFISLSPGKDGLLHISQIRKLVGGKRVENVEDVLAVGQKVQVEIGEIDP
FT                   RGKLSLHAVLDEAQTEGDPADPPAGVEVATATAYRINW"
FT                   /product="guanosine pentaphosphate synthetase
FT                   I/polyribonucleotide nucleotidyltransferase"
FT                   /protein_id="YP_003635154.1"
FT   misc_feature    41880..44027
FT                   /note="guanosine pentaphosphate synthetase I/polynucleotide
FT                   phosphorylase; Region: pppGpp_PNP; TIGR02696"
FT                   /db_xref="CDD:131743"
FT                   /locus_tag="Cfla_0035"
FT   misc_feature    41925..42320
FT                   /note="3' exoribonuclease family, domain 1; Region:
FT                   RNase_PH; pfam01138"
FT                   /db_xref="CDD:144653"
FT                   /locus_tag="Cfla_0035"
FT   misc_feature    42663..42899
FT                   /note="Polyribonucleotide nucleotidyltransferase, RNA
FT                   binding domain; Region: PNPase; pfam03726"
FT                   /db_xref="CDD:146390"
FT                   /locus_tag="Cfla_0035"
FT   misc_feature    42906..43307
FT                   /note="3' exoribonuclease family, domain 1; Region:
FT                   RNase_PH; pfam01138"
FT                   /db_xref="CDD:144653"
FT                   /locus_tag="Cfla_0035"
FT   misc_feature    43605..43760
FT                   /note="Polynucleotide phosphorylase (PNPase) K homology
FT                   RNA-binding domain (KH). PNPase is a polyribonucleotide
FT                   nucleotidyl transferase that degrades mRNA in prokaryotes
FT                   and plant chloroplasts. The C-terminal region of PNPase
FT                   contains domains homologous to...; Region: PNPase_KH;
FT                   cd02393"
FT                   /db_xref="CDD:29003"
FT                   /locus_tag="Cfla_0035"
FT   misc_feature    order(43635..43637,43641..43649,43653..43667,43674..43679,
FT                   43686..43691,43704..43715)
FT                   /note="putative nucleic acid binding region; other site"
FT                   /db_xref="CDD:29003"
FT                   /locus_tag="Cfla_0035"
FT   misc_feature    43656..43667
FT                   /note="G-X-X-G motif; other site"
FT                   /db_xref="CDD:29003"
FT                   /locus_tag="Cfla_0035"
FT   misc_feature    <43863..44027
FT                   /note="S1_PNPase: Polynucleotide phosphorylase (PNPase), ),
FT                   S1-like RNA-binding domain. PNPase  is a polyribonucleotide
FT                   nucleotidyl transferase that degrades mRNA. It is a
FT                   trimeric multidomain protein. The C-terminus contains the
FT                   S1 domain which binds ssRNA...; Region: S1_PNPase; cd04472"
FT                   /db_xref="CDD:88437"
FT                   /locus_tag="Cfla_0035"
FT   misc_feature    order(43866..43868,43896..43898,43902..43904)
FT                   /note="RNA binding site; other site"
FT                   /db_xref="CDD:88437"
FT                   /locus_tag="Cfla_0035"
FT   misc_feature    43971..43976
FT                   /note="domain interface; other site"
FT                   /db_xref="CDD:88437"
FT                   /locus_tag="Cfla_0035"
FT   gene            44619..45458
FT                   /db_xref="GeneID:9143901"
FT                   /locus_tag="Cfla_0036"
FT   CDS_pept        44619..45458
FT                   /locus_tag="Cfla_0036"
FT                   /gene_family="HOG000225463" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Xaut_2257"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: xau:Xaut_2257 hypothetical protein"
FT                   /db_xref="GI:296127905"
FT                   /db_xref="GeneID:9143901"
FT                   /translation="MNGQPDIDLKAAVNAISDVIMNRPRPLREFDQIHMKAGDMVMQAE
FT                   HVARWADAKYLVFVGDGDAISVCVAYLQSRGILPYGPARILVLDFDERVVSAVNRFADK
FT                   ERIPSLEGQLYNCLDDLPELSGFDSFYTNPPWGASNGGASVKLFAYRGMEAVKFSGEGL
FT                   VVIADDDALPWAQGVLHSTQAFAASHGFYVKRMTPRLHSYHLDDAPDLLSCNLLLRSLP
FT                   ADMAPKVHELRVDEELLKNFYGADKSPRVRFVRERKRLDYGMAHDDEYELELLDGGE"
FT                   /protein_id="YP_003635155.1"
FT   misc_feature    <44640..>45089
FT                   /note="Predicted methyltransferases [General function
FT                   prediction only]; Region: COG1568"
FT                   /db_xref="CDD:31756"
FT                   /locus_tag="Cfla_0036"
FT   gene            complement(46673..47677)
FT                   /db_xref="GeneID:9143902"
FT                   /locus_tag="Cfla_0037"
FT   CDS_pept        complement(46673..47677)
FT                   /locus_tag="Cfla_0037"
FT                   /gene_family="HOG000225465" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06114"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF955"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF955; KEGG:
FT                   xau:Xaut_2251 hypothetical protein"
FT                   /db_xref="GI:296127906"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="GeneID:9143902"
FT                   /translation="MSLVDEGIQLRHQLRSAGYSGLAIDAAWPEWWGTEASTSLSAVTE
FT                   LKLTVARRLGITPSSLFGDQGPTFSWADSARFKNLGTTSLREQGILSSFGVSLAGLLTR
FT                   GAPEATVDVPENIGAAWFRERLEELGGYTLRHLVALCWAVGIPVVQTHVFPLPQKRMHA
FT                   VTASVRGRSAIILGESTFYPAKAAFTIAHELGHVFLGHTTGAPTFIDVADPVSEDLDAE
FT                   ESAANTFALRLLTGRAEFEIRAGEAAYTAPQLADAAMSASAASGIDAGLIVLMLARQVD
FT                   DWPRAIAALNLLGREPVAQRINQLARTMLRMDAFNADEIAYLENVLTGRSTSA"
FT                   /protein_id="YP_003635156.1"
FT   misc_feature    complement(<46940..47323)
FT                   /note="Domain of unknown function (DUF955); Region: DUF955;
FT                   cl01076"
FT                   /db_xref="CDD:154183"
FT                   /locus_tag="Cfla_0037"
FT   gene            47736..48374
FT                   /db_xref="GeneID:9143903"
FT                   /locus_tag="Cfla_0038"
FT   CDS_pept        47736..48374
FT                   /locus_tag="Cfla_0038"
FT                   /gene_family="HOG000217891" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Aave_3744"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aav:Aave_3744 hypothetical protein"
FT                   /db_xref="GI:296127907"
FT                   /db_xref="GeneID:9143903"
FT                   /translation="MPPIDTLPSQFCWTKFGTEAGDEVDAIRARKESERRSGGGLFYWG
FT                   IGNSVGPSLRLLVSQVREPEVLFTPMLSRPAYLDVNPASVASWRFGVGLDGVPHALRTG
FT                   VVTSKSPVVNRARRHFALVCHSEDRLDVDLDYEGFTSSSVVNLRTGAQVGSSQVTSIVR
FT                   RVPELGGGRPYRVAFRARLVAPYFLTLTSSSEPLGECESALPMQDALWA"
FT                   /protein_id="YP_003635157.1"
FT   gene            49372..51864
FT                   /db_xref="GeneID:9143904"
FT                   /locus_tag="Cfla_0039"
FT   CDS_pept        49372..51864
FT                   /locus_tag="Cfla_0039"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gym:GYMC10_3817 hypothetical protein"
FT                   /db_xref="GI:296127908"
FT                   /db_xref="GeneID:9143904"
FT                   /translation="MRSTTAQKVGSSAPPEWWERVVGAAAGWFADYPRAAVRLRRARVL
FT                   AAWVAIPLIGAVLVLVPSTRESLRAYAWSFVMLVVWFVLVRTKTLSWGGVLRWFSACVA
FT                   WSAAIGWVTLRVADQLGLSASSHGSGTALAGFLEESGKLVPLLVLAVLAPGRVRRFGAG
FT                   DWALLGFASGVAFNAYEDAVRQIAARQTWLLLVDPSRDYSWNPWASGQFVTLDGVAVSP
FT                   GHHIWTAVGAMGIGLGIALWRTCRLDLRILAFVLPAVLVLWQIADHASFNARNHMSSWP
FT                   AEPAPGFPAVLSGLWSLGGHGRLVNAVSVLLLVACLLVDAHRRHLAAAVAAPAGSARRR
FT                   PGGAVDDDEPGGTALRWWAATLAPHVRAATGPRARAVQLLRGFGTLLIRGLAQWVADVA
FT                   VVVAAHAPLPGEPRRDAMVRGRTIAVRVRQIRCEAMELTTPGPEPTTRRRHAAVAAVVG
FT                   VAAVALCVVWGAAMASAIGPYLAISGDEVYLAGLLDRVGDWWNSLSGWQQVAVGAGVAA
FT                   LVVVSGGSFGLALGISGVATYGLSHAHGAATFVRDPRAATLGYLTTTTPLEAVLDVGDF
FT                   LLTFAPGNFAGAAAGRGVRVLADEITADPRALLDRAHVVLRSGDDAGEATVETLIGPAL
FT                   ARALERRGLDAAPFRMDPASFEDPKVVEEWVAARYADTNPQMSRAAQGRDPSLAYQKQF
FT                   AGPREIRLVAPDGKVIWADGLTIDRDTVVAVLDTKNVDKPGASIYEGTSFLRNLQVEVD
FT                   GEVISKLEEIHRRTFDDEVRRYAAVIRDSGNPVGRLRIPTTTQEAVDYLSGRVRSILGE
FT                   PGVEVDWEVVLQPLEGTP"
FT                   /protein_id="YP_003635158.1"
FT   gene            51861..52253
FT                   /db_xref="GeneID:9143905"
FT                   /locus_tag="Cfla_0040"
FT   CDS_pept        51861..52253
FT                   /locus_tag="Cfla_0040"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mar:MAE_20100 hypothetical protein"
FT                   /db_xref="GI:296127909"
FT                   /db_xref="GeneID:9143905"
FT                   /translation="MILMTREGAGVVITPDALEAALRERYGDELHVVRETTARGTALNV
FT                   GVLAGSFLPILNLSDTMTGLAIQGSWEEGAEIAAVVRRALPEGSPALVLLDDTGAGYAD
FT                   VPFGSTPESVAAGWKDISNYPGYTEG"
FT                   /protein_id="YP_003635159.1"
FT   gene            complement(52258..52791)
FT                   /db_xref="GeneID:9143906"
FT                   /locus_tag="Cfla_0041"
FT   CDS_pept        complement(52258..52791)
FT                   /locus_tag="Cfla_0041"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ami:Amir_4475 hypothetical protein"
FT                   /db_xref="GI:296127910"
FT                   /db_xref="GeneID:9143906"
FT                   /translation="MMSEVLYTTRWNDLTRRPLAGHSWITPDEARRRYDEAQGLEIVDA
FT                   STRDEDGTQRPLWVVGAHGRFRVELLTPGGAVARSVDWDLVDGRLWRWVTVEYVYLDDD
FT                   TAHVDSDATLELTTTARPDGTASFSMRDESGESHVTQFDDVATDGYWLDVPAFGEWGPL
FT                   VNATLGAATGPPAD"
FT                   /protein_id="YP_003635160.1"
FT   gene            complement(52788..52901)
FT                   /db_xref="GeneID:9143907"
FT                   /locus_tag="Cfla_0042"
FT   CDS_pept        complement(52788..52901)
FT                   /locus_tag="Cfla_0042"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296127911"
FT                   /db_xref="GeneID:9143907"
FT                   /translation="MVPVVPPQNVRQEIVEFAAGHGVILRELGPQFATKGP"
FT                   /protein_id="YP_003635161.1"
FT   gene            complement(53013..53888)
FT                   /db_xref="GeneID:9143908"
FT                   /locus_tag="Cfla_0043"
FT   CDS_pept        complement(53013..53888)
FT                   /locus_tag="Cfla_0043"
FT                   /gene_family="HOG000099306" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01076"
FT                   /codon_start="1"
FT                   /product="sortase family protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cdi:DIP2225 putative fimbrial associated
FT                   sortase-like protein; TIGRFAM: sortase family protein;
FT                   PFAM: peptidase C60 sortase A and B"
FT                   /db_xref="GI:296127912"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="GeneID:9143908"
FT                   /translation="MPWTSLGIALTAVLGAGLLLFPTVVSWFSQYEQSQRIDDLTADVA
FT                   DLGSATLQEELARARAYNEGLVGGGADVVANGRLPVADEPDQAGGYDELLRADRTGLMA
FT                   RLKIPAIHVDLPVSHGTSDAVLEHGVGHLEGTALPVGGPSTRAVLTAHRGLATAELFTH
FT                   LDRVEIEDTIVLEVFGEVLTYRVIDTRVVEPTDGQSVLPVDGRDLLTLVTCTPLGVNSH
FT                   RILVTGERVIPTPQADLEDAGRSPEIPTFPWWILISIGVLATAGGYVWLSGRPTGRADV
FT                   TTRHPEARRR"
FT                   /protein_id="YP_003635162.1"
FT   misc_feature    complement(53196..53588)
FT                   /note="Sortase C (SrtC) or subfamily-3 sortases are
FT                   membrane cysteine transpeptidases found in Gram-positive
FT                   bacteria that anchor surface proteins to peptidoglycans of
FT                   the bacterial cell wall envelope. This involves a
FT                   transpeptidation reaction in which the...; Region:
FT                   Sortase_C_3; cd05827"
FT                   /db_xref="CDD:99710"
FT                   /locus_tag="Cfla_0043"
FT   misc_feature    complement(order(53220..53222,53229..53231,53247..53252,
FT                   53433..53435,53439..53441,53445..53447,53487..53489,
FT                   53523..53525))
FT                   /note="active site"
FT                   /db_xref="CDD:99710"
FT                   /locus_tag="Cfla_0043"
FT   misc_feature    complement(order(53220..53222,53247..53249,53433..53435))
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:99710"
FT                   /locus_tag="Cfla_0043"
FT   gene            complement(53998..55521)
FT                   /db_xref="GeneID:9143909"
FT                   /locus_tag="Cfla_0044"
FT   CDS_pept        complement(53998..55521)
FT                   /locus_tag="Cfla_0044"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01167"
FT                   /codon_start="1"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aau:AAur_1909 putative surface protein;
FT                   TIGRFAM: LPXTG-motif cell wall anchor domain protein; PFAM:
FT                   Cna B domain protein; Gram-positive anchor"
FT                   /db_xref="GI:296127913"
FT                   /db_xref="InterPro:IPR001899"
FT                   /db_xref="InterPro:IPR008454"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="GeneID:9143909"
FT                   /translation="MSTSIIRRVTAAIGGLVLAAGAAMVAAAPAQAVTLPGNIDPAQPR
FT                   SLTVHKFALGPANGQVAGTGQQLPSTAGLGTPLPGAVFTATLVAGVDLTTPEGWTIANS
FT                   LTPQSASNRLTGTPYTSTPSAADGTATFPTGMPLGLYYVQETVLPADATNPSAPFLVSL
FT                   PLPTGPSGAPANQWIYDVHVYPKNAVTETTKTRIPAPANSAEARNPDLIRWSISASIPT
FT                   LAAGDTISTFTLTDIVPGALVFPATPPVGVSPSTVTVTNAGGVAQSFAEGDDYTITTTD
FT                   ATGTTDATSVLSFTTTGLTRLTALQGGLVSFDVLTRAVSIPPTGVITNTATANINGATE
FT                   TVTGSTPIGQLTVFAFESSGGGPRTPLAGAVYQVYLTQNDANNQQNPISINGTTSWTTG
FT                   ADGFVAIPIMTPGNYYVREITPPAGYNLPQSNPVQTVVVAGPTSTTAPVQNYVEFNHTQ
FT                   VSAANFLLPLTGGDAGRWFALAGSALLAIAVGAAVVVTRRRALSAPASA"
FT                   /protein_id="YP_003635163.1"
FT   misc_feature    complement(54187..54423)
FT                   /note="Collagen-binding protein B domain, mediates
FT                   bacterial adherence to collagen; the primary sequence has a
FT                   non-repetitive, collagen-binding A region, followed by the
FT                   repetitive B region; the B region has one to four 23 kDa
FT                   repeat units (B1-B4). The B...; Region: CollagenBindB;
FT                   cl14619"
FT                   /db_xref="CDD:176629"
FT                   /locus_tag="Cfla_0044"
FT   gene            complement(55629..60035)
FT                   /db_xref="GeneID:9143910"
FT                   /locus_tag="Cfla_0045"
FT   CDS_pept        complement(55629..60035)
FT                   /locus_tag="Cfla_0045"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01167"
FT                   /codon_start="1"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: LPXTG-motif cell wall anchor domain
FT                   protein; conserved repeat domain protein; KEGG: Muc19;
FT                   mucin 19"
FT                   /db_xref="GI:296127914"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR001899"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="GeneID:9143910"
FT                   /translation="MKFGSTGRGRAKMRSYVGTAATAWVIVVLLALGTAPGASAGPAPL
FT                   AETTERATSASPDPSAATPSVAPSPEPSPDVSSASAEPAGEMTAEPPPAPGPEDERPPP
FT                   AATGPTPDTSAPAPSAPAPSAPAPSAPAPSAPGTSAPDEPAPPTSSRLAATTGVSILAA
FT                   GVPEAPVQLWLEDFEAATPPAQLGTYASNRYTAAAFWLNYANCNGVIVSYTTTFPATGF
FT                   CGASTDVVPRNQVRRMADVLGQLRLGVVGSTSNTAPVNGSTTGTGGSQANRAVAALTMT
FT                   GGTTTANQTVVESAAPVGLTATADRYYAVSLDVAEDSCSARPGGVNNNSRLDVALVAGA
FT                   TVAPLTAAPIIACNVTGGRYTSPALSSGFGTETAVRAGRFFTDTAVRLTATQAAQARVR
FT                   VTNQISASSGNDFALDNLRIVDATPSLDKAFATDVGTAGTPTTLTFTVTNTSELAAKTD
FT                   WGFTDTLPQGLVVAPTPAVGGTCTNVTGAAFVVQAPAGAGSVVVTGGDLAANAVSCTVT
FT                   VNVVAAAPGTYVNGPANVTTVLNAPESATFVAEPPARITIRKNVVGRAAVGDQFRLALS
FT                   LGATEVATATTTGATTGLQTAQVGPVDVTRGSVYTISESIVSTSTLNTYTTTYQCLRGT
FT                   TTIATGTSISGPITISDEAGAEIVCTFTNTPQAASLFCDGTFYYAVRTDGSIAQVNATS
FT                   TAAPTPLVGAVPGATDVNALGVNGNGTSAVAIDRTGTNAVNAGGVITYTVVGGSLQATR
FT                   TALTGTQGAFLDRTGVALDGTIIAGAVDPINGRLLVGKSAAGSVRLWEYTPTALTNGSR
FT                   FLYLGQVATGTTAGENGDISFDAQGNLHVVQAAADSSSVGMFSVTREALLAASGGTIPA
FT                   SATVRRALSGMDAGATLTAVNGMAFSPAGTVYLSNATSGYQFDPVTWVRVPNSPRAVLG
FT                   TTTPNTTTDLAGCATTSTISVEKNVVGRINAADQFRLALSAGSPLVETSVATTSGSATG
FT                   VQTARVGPTPVQINTSVTISETMAAGSVSALASYTTVHECWADGVRILTGTSRTVAVTI
FT                   PNRLSVGVACTFTNSPAPFATVRVTKVVEDWSGGNRTPTAGWTMTTTATATTGSTVSIL
FT                   PSRDPAQQTAADGTATWQVLFGAASHRGRVTVAETTQPGFRFQSLVCTVNGTAAATTVT
FT                   TVGTQVRGAVNVDVAPGGVVECVYANRPTATLTLVKNVSFGTAAPSLWQLAATRSLGTA
FT                   LAGPSGAAGSGAVTAVTVSAQTPYRLSETSGPATYVQVGGWSCATATGSAVPVTPAGDV
FT                   SLARATDVTCTVTNATAALTLLKNVQNPSTGFQPATWDLTATPAALAGLTATTVRGADV
FT                   SPLGNPSSTFDVRPGHTYTLSEALAQSGTRLAYQQLRLEVRGPDGSWTPVASPTITAPA
FT                   AGQSAVYRFVNAPVAPPVLPLTGGPSRDAFLLGGGALLALALTVAVWHRRRQASTSSHS
FT                   KDGDVKS"
FT                   /protein_id="YP_003635164.1"
FT   gene            60180..61100
FT                   /db_xref="GeneID:9143911"
FT                   /locus_tag="Cfla_0046"
FT   CDS_pept        60180..61100
FT                   /locus_tag="Cfla_0046"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mfa:Mfla_2391 ABC transporter related; PFAM:
FT                   ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="GI:296127915"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9143911"
FT                   /translation="MFRNALHMGDGPGRPRVLGGWAVDGGGLLLTITHDLRLARALGGD
FT                   VLVMRDASVVEAGPVEQVLATPAHAYTQRLLGAEPSRWTFGWMRHGTPPVPTGDPLVAA
FT                   DGIAKSYGSSELFRDLSFRIHADERWALTGPSGVGKTTLGNALLRLTPVDAGTVSHAPA
FT                   TRDGRVQKLYQDPGLSFPRRVPLGAALRDVVRRHRVEEARLRTLLDEVGIPQDMLRRRP
FT                   GQVSGGELQRIAIVRAMLPRPVLVFADEATSRLDLATQEVTTDLLVRELAQTGCALLLV
FT                   THDDELATAVADHRLDLRAPAAAVG"
FT                   /protein_id="YP_003635165.1"
FT   misc_feature    <60264..60380
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Cfla_0046"
FT   misc_feature    60267..60287
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0046"
FT   misc_feature    60342..>60422
FT                   /note="Oligopeptide/dipeptide transporter, C-terminal
FT                   region; Region: oligo_HPY; cl07097"
FT                   /db_xref="CDD:157624"
FT                   /locus_tag="Cfla_0046"
FT   misc_feature    60480..61076
FT                   /note="ABC-type antimicrobial peptide transport system,
FT                   ATPase component [Defense mechanisms]; Region: SalX;
FT                   COG1136"
FT                   /db_xref="CDD:31331"
FT                   /locus_tag="Cfla_0046"
FT   misc_feature    60480..61061
FT                   /note="The ABC transporter subfamily specific for the
FT                   transport of dipeptides, oligopeptides (OppD), and nickel
FT                   (NikDE).  The NikABCDE system of E. coli belongs to this
FT                   family and is composed of the periplasmic binding protein
FT                   NikA, two integral membrane...; Region:
FT                   ABC_NikE_OppD_transporters; cd03257"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="Cfla_0046"
FT   misc_feature    60579..60602
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="Cfla_0046"
FT   misc_feature    order(60588..60593,60597..60605,60699..60701,60924..60929,
FT                   61026..61028)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="Cfla_0046"
FT   misc_feature    60690..60701
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="Cfla_0046"
FT   misc_feature    60852..60881
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="Cfla_0046"
FT   misc_feature    60912..60929
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="Cfla_0046"
FT   misc_feature    60936..60947
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="Cfla_0046"
FT   misc_feature    61014..61034
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73016"
FT                   /locus_tag="Cfla_0046"
FT   gene            61324..62115
FT                   /db_xref="GeneID:9143912"
FT                   /locus_tag="Cfla_0047"
FT   CDS_pept        61324..62115
FT                   /locus_tag="Cfla_0047"
FT                   /gene_family="HOG000224857" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05257"
FT                   /codon_start="1"
FT                   /product="CHAP domain containing protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mva:Mvan_5979 CHAP domain-containing protein;
FT                   PFAM: CHAP domain containing protein; SMART: SH3 domain
FT                   protein"
FT                   /db_xref="GI:296127916"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="GeneID:9143912"
FT                   /translation="MDRYGSSVLDPVTTSPDSDRRVTARARRGAATAIAVALAVTLGAT
FT                   SAAAAFTARVISGHGVSYVNVRNQASTAGPVVRTIPAGAAVSLDCYAYGQAITGPYGTS
FT                   TIWYRLVGGGWVTDSLLETGSNSTVTGPCSTSGRSWGQTTSTNTGVWDQCTWGAKEKFR
FT                   EYSGVYPNITGNARQWYDSARANGWTTVLDAQVSSIVVFQPGVHGADATYGHVGWVDAI
FT                   ERRADGLYVHVVEMNYANQGHTWHTRWVKDVVGMSFILAPR"
FT                   /protein_id="YP_003635166.1"
FT   misc_feature    <61513..61833
FT                   /note="Uncharacterized protein with a bacterial SH3 domain
FT                   homologue [Function unknown]; Region: COG4991"
FT                   /db_xref="CDD:34596"
FT                   /locus_tag="Cfla_0047"
FT   misc_feature    61762..62100
FT                   /note="NlpC/P60 family; Region: NLPC_P60; cl11438"
FT                   /db_xref="CDD:164223"
FT                   /locus_tag="Cfla_0047"
FT   gene            62200..62811
FT                   /db_xref="GeneID:9143913"
FT                   /locus_tag="Cfla_0048"
FT   CDS_pept        62200..62811
FT                   /locus_tag="Cfla_0048"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Namu_4779"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: nml:Namu_4779 hypothetical protein"
FT                   /db_xref="GI:296127917"
FT                   /db_xref="GeneID:9143913"
FT                   /translation="MGAMARRVDRRRRLALLVCACGSVAVQAGSTDPTWFLRYFSVWCA
FT                   LLSGLTAAAGLVGRAGTAVAWVRDASCTGAMLAGAVYAGVLLPAERLGAAGGGLTWLAP
FT                   LLLHVTLPVLAVVDAVRVPRAAPPARAVVLSWTLLPAAYLALTLLLHAARGVAPAYTFL
FT                   DVTRVGPHGVGVAVVVAVGLHLVMADRLVRRLRARPPAPH"
FT                   /protein_id="YP_003635167.1"
FT   gene            62865..63566
FT                   /db_xref="GeneID:9143914"
FT                   /locus_tag="Cfla_0049"
FT   CDS_pept        62865..63566
FT                   /locus_tag="Cfla_0049"
FT                   /gene_family="HOG000034813" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /codon_start="1"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /transl_table="11"
FT                   /note="KEGG: fre:Franean1_2216 two component LuxR family
FT                   transcriptional regulator; PFAM: response regulator
FT                   receiver; regulatory protein LuxR; SMART: response
FT                   regulator receiver; regulatory protein LuxR"
FT                   /db_xref="GI:296127918"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="GeneID:9143914"
FT                   /translation="MSGCDRCTAQGSTCETITVAAVDDHPLLLHGISAHLEKNVACMRL
FT                   TVIAATVDELLADAPVDVVLLDVRLLDGSTVEDNVRRIRATGSRVVLFTTEHRSAVIVR
FT                   AMQAGASGLILKEDEDAHLVAAVREVHEGRTYVSSDLAEHLVSDPAGAVRFTPRELEVL
FT                   RLRATGLAWKVIGAQLGITKDTAYDHVKHALAKYQQAVGRVDGPADLLARVVADGHIDA
FT                   PEHAPRTRRSP"
FT                   /protein_id="YP_003635168.1"
FT   misc_feature    62913..63452
FT                   /note="Response regulator containing a CheY-like receiver
FT                   domain and an HTH DNA-binding domain [Signal transduction
FT                   mechanisms / Transcription]; Region: CitB; COG2197"
FT                   /db_xref="CDD:32379"
FT                   /locus_tag="Cfla_0049"
FT   misc_feature    62928..63257
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cl09944"
FT                   /db_xref="CDD:175054"
FT                   /locus_tag="Cfla_0049"
FT   misc_feature    order(62931..62936,63063..63065,63087..63089,63144..63146,
FT                   63201..63203,63210..63215)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cfla_0049"
FT   misc_feature    63063..63065
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cfla_0049"
FT   misc_feature    order(63072..63077,63081..63089)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cfla_0049"
FT   misc_feature    63210..63218
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cfla_0049"
FT   misc_feature    63327..>63452
FT                   /note="C-terminal DNA-binding domain of LuxR-like proteins.
FT                   This domain contains a helix-turn-helix motif and binds
FT                   DNA. Proteins belonging to this group are response
FT                   regulators; some act as transcriptional activators, others
FT                   as transcriptional repressors...; Region: LuxR_C_like;
FT                   cd06170"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="Cfla_0049"
FT   misc_feature    order(63330..63338,63375..63383,63405..63410,63414..63419,
FT                   63423..63437)
FT                   /note="DNA binding residues"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="Cfla_0049"
FT   gene            63563..65782
FT                   /db_xref="GeneID:9143915"
FT                   /locus_tag="Cfla_0050"
FT   CDS_pept        63563..65782
FT                   /locus_tag="Cfla_0050"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /codon_start="1"
FT                   /product="putative signal transduction histidine kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: nml:Namu_4834 putative signal transduction histidine
FT                   kinase"
FT                   /db_xref="GI:296127919"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="GeneID:9143915"
FT                   /translation="MTRRSYRESVDACLRWAYALGVAITAGCWAVIGLSASGTLGPGLA
FT                   AATVAYVLVAGVGAVRAARHRLSDRYLAVLCLAAVAWQVAWALEPSPEFTPGARVMGTA
FT                   AVVLCGFLFARTRARVTAIATALVTQVVVDSMHGWDVGLLLPAVAAGVVVALCAPQMRA
FT                   AADRADAAAAERSRAQAAQAEREAAEQARREAERVVHDHVVSALRAVTVPGLDRAEVRA
FT                   AAAVAVSAIERSFAEDDVRPPCDVAEVLAPVADAAKASFTSTGAASPVPAEVADIVVAA
FT                   VQEALRNVERHTRVTADVSVRTDPGGVAVEVRDDGPGFDPTEAMSRSDGLRGSVVQRMR
FT                   DVGGSAEVDSAPGHATVVRLAWRAPVLEPPRPMQRHERIAAVMIDVRRPLTYACVPYLA
FT                   MYAVFAAQGVAQGAHPWWLTAWFVGLAAVTAAVLLRAHTGLSRAGSTAALTYVVVGTLA
FT                   AIDVLPGSSLRDYSSWALGAGAPLLAVVAIVRPRVESVVTLVIVQAALLTAAFTGRFGP
FT                   GPWQEQLATVVTPALSMVLPVGLGLAIARGILTLGTVVTDAHDAYRDLAVADAARRAAR
FT                   AVRDRRFADLRDQVVPFLRDVATGTTPAATEDAAASARVLEAAARDELRAPGLLDASTR
FT                   ELLRQVRAAGCQVRIQPAVASAGDLDAVRGLLVAALSHGTLPTELVLSAQPAGEEVAVH
FT                   VVARPDDADRAAALGGERGVEVMADAPGTTWARLVVPALAVRAVV"
FT                   /protein_id="YP_003635169.1"
FT   misc_feature    64403..64642
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cl00075"
FT                   /db_xref="CDD:173995"
FT                   /locus_tag="Cfla_0050"
FT   gene            65893..66366
FT                   /db_xref="GeneID:9143916"
FT                   /locus_tag="Cfla_0051"
FT   CDS_pept        65893..66366
FT                   /locus_tag="Cfla_0051"
FT                   /gene_family="HOG000256697" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05360"
FT                   /codon_start="1"
FT                   /product="YiaAB two helix domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: YiaAB two helix domain protein; KEGG:
FT                   bur:Bcep18194_A3880 YiaAB two helix membrane protein"
FT                   /db_xref="GI:296127920"
FT                   /db_xref="InterPro:IPR008024"
FT                   /db_xref="GeneID:9143916"
FT                   /translation="MSQHPVPARPTAAFVGASWVALVIAITAFAVGLWNADMLLSEKGF
FT                   YGTLLLLGLYSAIALQKSVRDRAEGIPVTGIFLGLSWSMVLVSLLLVAIGLANSTLTLS
FT                   EKGFYGLGYTMALFAVIAVQKNVRDLAAAGPAPQPAKPAPADVDPQAAVWQQR"
FT                   /protein_id="YP_003635170.1"
FT   misc_feature    65905..66279
FT                   /note="Predicted membrane protein [Function unknown];
FT                   Region: COG4682"
FT                   /db_xref="CDD:34299"
FT                   /locus_tag="Cfla_0051"
FT   misc_feature    65932..66090
FT                   /note="yiaA/B two helix domain; Region: YiaAB; cl01759"
FT                   /db_xref="CDD:120867"
FT                   /locus_tag="Cfla_0051"
FT   misc_feature    <66169..66279
FT                   /note="yiaA/B two helix domain; Region: YiaAB; cl01759"
FT                   /db_xref="CDD:120867"
FT                   /locus_tag="Cfla_0051"
FT   gene            complement(66394..67374)
FT                   /db_xref="GeneID:9143917"
FT                   /locus_tag="Cfla_0052"
FT   CDS_pept        complement(66394..67374)
FT                   /locus_tag="Cfla_0052"
FT                   /gene_family="HOG000220179" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LacI family"
FT                   /transl_table="11"
FT                   /note="KEGG: kra:Krad_3739 regulatory protein LacI; PFAM:
FT                   regulatory protein LacI; periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein LacI"
FT                   /db_xref="GI:296127921"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="GeneID:9143917"
FT                   /translation="MARVTSADVARESGVSRTTVSYVLNARKDVVLTEATRQRVLDAAA
FT                   RLGYTPSAAARALRAGRSDLVLLVLPDWTLGPAIDTLIEHLSTALATHGLSVLVHIRHG
FT                   GRPLDELWRAVTPCVVLSLSPFPAADTRAMQQAGIPVVGTALDDDPQPDVFAVPQASIG
FT                   ALQADHLVARGHRVLAYAAPHDDRLAAFADRRLAGVRAACERHRVPAPEVASVDLDVAS
FT                   ARAAVDAWRAAGVTAVAAYNDEVALAVLAGLRDAGLDVPGDVAVIGVDDIPAARVAAPA
FT                   LTTVWQAIDAQAEHLAAAVLAALGLAESTPERPDDVFHLVQRAST"
FT                   /protein_id="YP_003635171.1"
FT   misc_feature    complement(66397..67365)
FT                   /note="Transcriptional regulators [Transcription]; Region:
FT                   PurR; COG1609"
FT                   /db_xref="CDD:31797"
FT                   /locus_tag="Cfla_0052"
FT   misc_feature    complement(67219..67356)
FT                   /note="Helix-turn-helix (HTH) DNA binding domain of the
FT                   LacI family of transcriptional regulators; Region:
FT                   HTH_LacI; cd01392"
FT                   /db_xref="CDD:143331"
FT                   /locus_tag="Cfla_0052"
FT   misc_feature    complement(order(67219..67221,67228..67230,67267..67269,
FT                   67276..67278,67285..67287,67300..67302,67309..67314,
FT                   67318..67332,67354..67356))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:143331"
FT                   /locus_tag="Cfla_0052"
FT   misc_feature    complement(66520..67182)
FT                   /note="Ligand binding domain of the LacI tanscriptional
FT                   regulator family belonging to the type I
FT                   periplasmic-binding fold protein superfamily; Region:
FT                   PBP1_LacI_sugar_binding_like; cd06267"
FT                   /db_xref="CDD:107262"
FT                   /locus_tag="Cfla_0052"
FT   misc_feature    complement(order(66610..66615,66622..66624,66634..66636,
FT                   66706..66708,67033..67041,67072..67074,67078..67092,
FT                   67111..67116,67120..67125,67132..67140,67180..67182))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:107262"
FT                   /locus_tag="Cfla_0052"
FT   misc_feature    complement(order(66565..66567,66715..66717,66796..66798,
FT                   66904..66906,66934..66936,67012..67014,67129..67131,
FT                   67138..67143))
FT                   /note="ligand binding site; other site"
FT                   /db_xref="CDD:107262"
FT                   /locus_tag="Cfla_0052"
FT   gene            67515..69161
FT                   /db_xref="GeneID:9143918"
FT                   /locus_tag="Cfla_0053"
FT   CDS_pept        67515..69161
FT                   /locus_tag="Cfla_0053"
FT                   /gene_family="HOG000271632" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sen:SACE_7004 ABC transporter, ATP-binding
FT                   component; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="GI:296127922"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9143918"
FT                   /translation="MSATLQARSVAAAFGDRELFSGLDLVVAPGDVVGLVGPNGAGKTT
FT                   LLRILAGQRAPEAGVVALSPPTAQVGYLVQEVERRADESVRTFLERRTGVADAQAAMDA
FT                   ASDALAADAPGAGDAFTHALERWMALGGADLDARLGGVADDLGLAVDLDLPMTALSGGQ
FT                   AARVGLAALLLSRFDLYLLDEPTNDLDADGLDRLEEFVAQASAPVVVVSHDREFLARTV
FT                   TTVVEIDRSLQRVATYGGSYDAYLEERSTARRQAREAYEDYAGRRDALAARARMQRAWM
FT                   EKGVRNAMRKATDGDKNVKQGRRESSEKQASKARQTDRMIERLVVVEEPRKEWQLRMSI
FT                   ATAPRSGSVVATARAAVVRRGDFVLGPVDLQLDWQDRIAVTGPNGSGKSTLLALLLGRL
FT                   AADEGTAALGSGVLVGEVDQARAAFERDEPLGDAFAREVPEWTTADVRTLLAKFGLAGH
FT                   QVGRPAASLSPGERTRAALALLQARGVNLLVLDEPTNHLDLPAIEQLEQAMESFDGTIL
FT                   LVTHDRRMLDTVRLTRRWHVEDGQVTEVRPD"
FT                   /protein_id="YP_003635172.1"
FT   misc_feature    67518..69134
FT                   /note="ATPase components of ABC transporters with
FT                   duplicated ATPase domains [General function prediction
FT                   only]; Region: Uup; COG0488"
FT                   /db_xref="CDD:30834"
FT                   /locus_tag="Cfla_0053"
FT   misc_feature    67527..>67739
FT                   /note="ABCF_EF-3  Elongation factor 3 (EF-3) is a cytosolic
FT                   protein required by fungal ribosomes for in vitro protein
FT                   synthesis and for in vivo growth.  EF-3 stimulates the
FT                   binding of the EF-1: GTP: aa-tRNA ternary complex to the
FT                   ribosomal A site by...; Region: ABCF_EF-3; cd03221"
FT                   /db_xref="CDD:72980"
FT                   /locus_tag="Cfla_0053"
FT   misc_feature    <67989..68204
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Cfla_0053"
FT   misc_feature    67989..68018
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0053"
FT   misc_feature    68049..68066
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0053"
FT   misc_feature    68073..68084
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0053"
FT   misc_feature    68139..68159
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0053"
FT   misc_feature    68604..69137
FT                   /note="ABCF_EF-3  Elongation factor 3 (EF-3) is a cytosolic
FT                   protein required by fungal ribosomes for in vitro protein
FT                   synthesis and for in vivo growth.  EF-3 stimulates the
FT                   binding of the EF-1: GTP: aa-tRNA ternary complex to the
FT                   ribosomal A site by...; Region: ABCF_EF-3; cd03221"
FT                   /db_xref="CDD:72980"
FT                   /locus_tag="Cfla_0053"
FT   gene            complement(69174..69794)
FT                   /db_xref="GeneID:9143919"
FT                   /locus_tag="Cfla_0054"
FT   CDS_pept        complement(69174..69794)
FT                   /locus_tag="Cfla_0054"
FT                   /gene_family="HOG000075268" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01205"
FT                   /codon_start="1"
FT                   /product="protein of unknown function UPF0029"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function UPF0029; Domain of
FT                   unknown function DUF1949; KEGG: nca:Noca_0960 hypothetical
FT                   protein"
FT                   /db_xref="GI:296127923"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="GeneID:9143919"
FT                   /translation="MRTYLTIARDGEATLEIKRSRFLCTLRRVEQEADARALVEQMRRT
FT                   HWDARHHCSAFVLGADGMLQRSSDDGEPAGTAGAPMLEVLRGHGVSDVVAVVTRWFGGI
FT                   LLGAGGLVRAYGDAVSAGLAEVGTLERQLLEEWEVRLDHAEAGRVEGELRARGVEVLEA
FT                   AYTHDVRLLLGVRDADALRAGVAALTAGRVEAVRVGERWVDVR"
FT                   /protein_id="YP_003635173.1"
FT   misc_feature    complement(69246..69794)
FT                   /note="uncharacterized protein, YigZ family; Region:
FT                   IMPACT_YIGZ; TIGR00257"
FT                   /db_xref="CDD:129359"
FT                   /locus_tag="Cfla_0054"
FT   misc_feature    complement(69426..69746)
FT                   /note="Uncharacterized protein family UPF0029; Region:
FT                   UPF0029; pfam01205"
FT                   /db_xref="CDD:144705"
FT                   /locus_tag="Cfla_0054"
FT   misc_feature    complement(69222..69380)
FT                   /note="Domain of unknown function (DUF1949); Region:
FT                   DUF1949; pfam09186"
FT                   /db_xref="CDD:150017"
FT                   /locus_tag="Cfla_0054"
FT   gene            69918..70463
FT                   /db_xref="GeneID:9143920"
FT                   /locus_tag="Cfla_0055"
FT   CDS_pept        69918..70463
FT                   /locus_tag="Cfla_0055"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="GI:296127924"
FT                   /db_xref="GeneID:9143920"
FT                   /translation="MPPTTRKRALTALVAGATATAYYAVPDFVPSRTARGWIKAGLLAA
FT                   GAVTTLPNREERAELRASWQDAMRARAARASDDPTASDDPTASDDPTASDHPTTSDESS
FT                   TSVPGPVVVAAGLALLAASTAAAVAAERWVYRRGEARAAAGVRYPHTRTALVLGGLSLL
FT                   LGLIPDPDAARSGTPDPS"
FT                   /protein_id="YP_003635174.1"
FT   gene            70589..71578
FT                   /db_xref="GeneID:9143921"
FT                   /locus_tag="Cfla_0056"
FT   CDS_pept        70589..71578
FT                   /locus_tag="Cfla_0056"
FT                   /gene_family="HOG000275162" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /codon_start="1"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /transl_table="11"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   deh:cbdb_A1668 hypothetical protein"
FT                   /db_xref="GI:296127925"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9143921"
FT                   /translation="MSNVLVVGGSGLLGFHTVVELVARGHRVTSLSLPPAATDVEFPAG
FT                   VRALWEDVTTATDDELTAALDGMDAVVYAAGADERTVPPAPAAHFFYEANVLPTQRLAR
FT                   LARAAGATRFVLLGSYTAEFAERWPELGYRARHGYPRTRLAQEEVAHLEGDGAMDVMVL
FT                   RLPYIFGLVGERRPLWQFVVDRVQGPGPVAVLGGSTSSVTVRQVAQAAVGAMERGTHGA
FT                   RYAINAYDLTYVELYRLACEAVGRDPDDVVQVPLDAMLPYGEQADAAAAAAGTEHGIHV
FT                   VDSLRFQDRDAVSDWEPTASELGIEPDDVRAAVRETFRWCVEHPADAA"
FT                   /protein_id="YP_003635175.1"
FT   misc_feature    70634..71476
FT                   /note="Nucleoside-diphosphate-sugar epimerases [Cell
FT                   envelope biogenesis, outer membrane / Carbohydrate
FT                   transport and metabolism]; Region: WcaG; COG0451"
FT                   /db_xref="CDD:30800"
FT                   /locus_tag="Cfla_0056"
FT   gene            71702..73168
FT                   /db_xref="GeneID:9143922"
FT                   /locus_tag="Cfla_0057"
FT   CDS_pept        71702..73168
FT                   /locus_tag="Cfla_0057"
FT                   /gene_family="HOG000097578" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Tter_1478"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="GI:296127926"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:9143922"
FT                   /translation="MPENPKDRTTSAADGPQHRSGLGRRAFLALAGGTAAVVAGATSAG
FT                   ALDGRAWGPRPVLPHRPGRHHGGRAGSERAAVAFVRAAADAYPQLNTGPRLAQSYTDEL
FT                   GLFSTAFVYDNALAICALLADGRRSSVDSARVIGDGLVFAQENDPDHADGRLRQGYNVG
FT                   PYTFYDGSPQPDGFVRADGYANIGRQFGFLGTAVGDMAWPGLALLQLFRVTRDRTYLRA
FT                   AVAIGEWITSTTWSTAPLGGFSFGVDGGNQPVPNGSTEHNVDCVAFFSMLRKATGDRRW
FT                   TAASEHALAFVDRMWDSGNGWFWTGTNDGVEINRDPVPLDPATWSRLAIREKRYDRALD
FT                   WAGEALAVTDEPTAPTSQLPDDAQQVSGVTFSTASLTSTAQYNGLTVHPQGVWLEGTAQ
FT                   LATSLLDRNHRGDKQRAEWLLSQVRRAQDTVGAGQHLGGAEVDGGVVAASSLIDTGFGF
FT                   GYFQVQHVGATSWFLLASAGANPMRWDGLR"
FT                   /protein_id="YP_003635176.1"
FT   misc_feature    <72305..72679
FT                   /note="Highly conserved protein containing a thioredoxin
FT                   domain [Posttranslational modification, protein turnover,
FT                   chaperones]; Region: COG1331"
FT                   /db_xref="CDD:31522"
FT                   /locus_tag="Cfla_0057"
FT   gene            complement(73217..73615)
FT                   /db_xref="GeneID:9143923"
FT                   /locus_tag="Cfla_0058"
FT   CDS_pept        complement(73217..73615)
FT                   /locus_tag="Cfla_0058"
FT                   /gene_family="HOG000252587" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Xcel_0877"
FT                   /codon_start="1"
FT                   /product="sec-C motif domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sec-C motif domain protein"
FT                   /db_xref="GI:296127927"
FT                   /db_xref="GeneID:9143923"
FT                   /translation="MIGPVSDTRCPCGTGLPLAGCCGPLHAGERTAGTAEQLMRSRYSA
FT                   FAVGDAAYLQRSWHPSTRPADLVLDAGVRWYRLDVLATTGGGVFDTTGTVEFEAFWRGP
FT                   DGRGSLREVSRFRRGPDGWQYVAGDVAR"
FT                   /protein_id="YP_003635177.1"
FT   misc_feature    complement(73226..73588)
FT                   /note="SEC-C motif; Region: SEC-C; cl12132"
FT                   /db_xref="CDD:175403"
FT                   /locus_tag="Cfla_0058"
FT   misc_feature    complement(73238..73588)
FT                   /note="hypothetical protein; Provisional; Region: PRK04233"
FT                   /db_xref="CDD:167763"
FT                   /locus_tag="Cfla_0058"
FT   gene            73691..74359
FT                   /db_xref="GeneID:9143924"
FT                   /locus_tag="Cfla_0059"
FT   CDS_pept        73691..74359
FT                   /locus_tag="Cfla_0059"
FT                   /gene_family="HOG000000225" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bcav_3305"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcv:Bcav_3305 hypothetical protein"
FT                   /db_xref="GI:296127928"
FT                   /db_xref="GeneID:9143924"
FT                   /translation="MPRATPRALVLAGRARYGDPWHDHAATSHGVALELQSAGFTVDVR
FT                   STFPDALAGLTPDDLLVVNSGLGPAEDDDAPWRPLHEAVRDHAAADGPVLALHQSTMTF
FT                   RDSPWWSDVIGGHWVDGTSWHPPQAEHTFDVAPSHPVTEGLGPLVVDDERYTDLVVAPA
FT                   VRPLVTHDEGGTTHPVVWLAPSRRAVYDGLGHDLGSYRTPARAALLRREARWLVRLPPA
FT                   "
FT                   /protein_id="YP_003635178.1"
FT   misc_feature    73709..74299
FT                   /note="Type 1 glutamine amidotransferase (GATase1)-like
FT                   domain; Region: GAT_1; cl00020"
FT                   /db_xref="CDD:173987"
FT                   /locus_tag="Cfla_0059"
FT   gene            complement(74287..75780)
FT                   /db_xref="GeneID:9143925"
FT                   /locus_tag="Cfla_0060"
FT   CDS_pept        complement(74287..75780)
FT                   /locus_tag="Cfla_0060"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sco:SCO4423 serine/threonine protein kinase
FT                   (fragment)"
FT                   /db_xref="GI:296127929"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="GeneID:9143925"
FT                   /translation="MLVELDDDPGTPAPQGRTGRARRRWPAALPLVVVLALVVAQLVAD
FT                   ARERVRLAALADVPGVLAPLPEPPAVAWYLAGDATDDVLVDRDVLLEERVTDRGAMSLV
FT                   AHAVATGDVRWSVPLADAPDAPEPGRYGLQCVRGPGDAVTCLVHDATDGDPTNAARPPG
FT                   HAATAASVAVVEAGEVAARYPAGAGDEVAAAVGVVGDALVLAAPLDDGTAVWALDARTG
FT                   DERWRVHAATGLGGGVLRWGATTRVVPVGDDAVGVLGAGTVLLDAADGATLASAGTLAT
FT                   VVGARQDGTALVVGSEGFTRLVGPAGEVRLDGVPVRVTVDDGSVPGLALTTGGGLRAWD
FT                   ARSGEQRWRTDAPAQGALLLGGLLHAHDGFRVATLDAGTGEVRWEATAPELFHDELALV
FT                   THLATDGRRLLVAGSSPTTARALLVALDPGDGLVTWRADLAALGAPSHVEVGGGALLGV
FT                   GAQGNAVLAPRGRRPGHAGGRRTSQRASRRSSAARAGVR"
FT                   /protein_id="YP_003635179.1"
FT   gene            complement(75821..77266)
FT                   /db_xref="GeneID:9143926"
FT                   /locus_tag="Cfla_0061"
FT   CDS_pept        complement(75821..77266)
FT                   /locus_tag="Cfla_0061"
FT                   /gene_family="HOG000101832" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcv:Bcav_2123 hypothetical protein"
FT                   /db_xref="GI:296127930"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="GeneID:9143926"
FT                   /translation="MARRPTLHEVEVVDDESDPGPSPPAARPAVPRRGWVLGGAVLAVL
FT                   LAVGVTAQVLQTRRDRAQVAAVAAHAGGVALLDGPPAALWQLPTRDLYGVAEVRTPEGL
FT                   LVGVRDSDSGPVEVAAVDAVTGAQRWHVELVDGATRPQARPGFSTYADSGRCAAHGTQE
FT                   HLVVCLAHDGTYVVGQGATLPLPPSTTRLVVLDTRAGTLVADLGTAVADDERPTSFAAV
FT                   GDLVVVTVASQRGTTVRATTLDGAVVWERPVTSAPDAGGDPYVLRLGELVALLTAREMT
FT                   LLDADGRTVRTRPLGDEYAVADAETIRLVPSDAAAGDARTTVVRPAGDLDVPGDVLHLT
FT                   VDDGSVPGLVLTTAGGELTALVHGEELWSVPDPQGWNALVVGGRVHLDAGLELLTLDAR
FT                   TGAELWTTTVATTLPVTDGRHLLAVARPVEADDPPELVALDPADGSVSWRSPLPPGSIE
FT                   LTSHLGLLLVSSGEGAQLLTVLG"
FT                   /protein_id="YP_003635180.1"
FT   gene            complement(77306..78775)
FT                   /db_xref="GeneID:9143927"
FT                   /locus_tag="Cfla_0062"
FT   CDS_pept        complement(77306..78775)
FT                   /locus_tag="Cfla_0062"
FT                   /gene_family="HOG000101832" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcv:Bcav_2124 hypothetical protein"
FT                   /db_xref="GI:296127931"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="GeneID:9143927"
FT                   /translation="MARRATLHDVELVDDDSDDGTGAPPPTDGSTTAAAPRRRWPLVLG
FT                   AAVLAVLVVVGVTGQVLQDRRERARLAAVAASPQSVPLLDGPPVPRWETHSETFYEATQ
FT                   VRTPEGLLVGLRSAVEGPVAAAALDVATGREVWRVELVDGSTRPAVDPGFEAYPDSGYC
FT                   TAHGDRADLAVCLAHDGARVIGRESAGYVAPTTSRLVVLDTRDGTVVTDLTASLEPGTH
FT                   PTSVATLGDLVVAVVEASDGTTVRASTTDGTARWSVPVTTTADPEAGGTRVERVGDLVA
FT                   VLGETEVVLLDEDGATVRTHPLAGGYAYSADGGVHVRPRSQAADAPTTIVRQDGVVEVR
FT                   GDVLTPLVDDGSAPGLALTSDGRHLVAWVDGEQSWTADDPGWWNLLVLGGRVVVDDGGG
FT                   LTALDARDGTRAWRSEVVRGLPVTDGRVLLGVARVAERGEQAQMVALDPADGTELWRAP
FT                   LPDGTTELVAWRHLLLAGRDDGHETHLTVLG"
FT                   /protein_id="YP_003635181.1"
FT   misc_feature    complement(<77396..>77572)
FT                   /note="outer membrane assembly lipoprotein YfgL; Region:
FT                   assembly_YfgL; TIGR03300"
FT                   /db_xref="CDD:163208"
FT                   /locus_tag="Cfla_0062"
FT   gene            complement(78826..80310)
FT                   /db_xref="GeneID:9143928"
FT                   /locus_tag="Cfla_0063"
FT   CDS_pept        complement(78826..80310)
FT                   /locus_tag="Cfla_0063"
FT                   /gene_family="HOG000101833" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hut:Huta_3012 pyrrolo-quinoline quinone"
FT                   /db_xref="GI:296127932"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="GeneID:9143928"
FT                   /translation="MARARRVDVDLGDGSPDADARDGDGPEQRGPAGRRRWWLAVPVVA
FT                   VLALVVGQVVTDTRERTDLADLARQPLVVDPVEGPVEVAWQVPRGTQIASAARAGSVLV
FT                   AARVTPDLAVALEGVDVATGAGLWSSEVVAARPDLGEDAVADPVVCVPAPDDERQVACL
FT                   VPDSAWSVVDGAPVTVAATTTRLLVLDAADGTVRVDREVPTWAQWLTPVGDDVLLVGDL
FT                   HGTLTAELQALRDGATRWRTTSERKAGGPSSRVLPVTTVLDEETIAVDRLGEVVFLSAT
FT                   NGEELGSVVSGLDVGGDGQLVTFTATMSIALGAALVFSDAGTQVATPGRAVSVEGVLPQ
FT                   VLVDDGSVPGLVLTRTPRLTAWDADDGTERWATDVVDAEDVTVFDGRVHVGTSTDLVTF
FT                   DGATGDELWRFDRPSAEGTPVTDGRYLYTTARRGERHSAPYDLVALHPADGSEAWRAPL
FT                   PERSWPQSVAGLLVATSFGPNIDDYEEIHQVLRGRG"
FT                   /protein_id="YP_003635182.1"
FT   misc_feature    complement(79048..>79239)
FT                   /note="PQQ-dependent dehydrogenase, methanol/ethanol
FT                   family; Region: PQQ_enz_alc_DH; TIGR03075"
FT                   /db_xref="CDD:163127"
FT                   /locus_tag="Cfla_0063"
FT   misc_feature    complement(<78886..79128)
FT                   /note="outer membrane assembly lipoprotein YfgL; Region:
FT                   assembly_YfgL; TIGR03300"
FT                   /db_xref="CDD:163208"
FT                   /locus_tag="Cfla_0063"
FT   gene            complement(80380..81807)
FT                   /db_xref="GeneID:9143929"
FT                   /locus_tag="Cfla_0064"
FT   CDS_pept        complement(80380..81807)
FT                   /locus_tag="Cfla_0064"
FT                   /gene_family="HOG000101833" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcv:Bcav_2124 hypothetical protein"
FT                   /db_xref="GI:296127933"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="GeneID:9143929"
FT                   /translation="MPRARRVDVELGDLTPVGATDPADAPHPGGRRRWWWWLAVPVAAV
FT                   LALVGGQLVTDQRERTRLGALAALPGVVAPLDGPPEVAWQPDRGTLVGGAVRVGPVLVA
FT                   RHVADDGGALLVGLDATTGERRWELDVVGEPAPAPPWWPDTGGCAAVPDGSGHVACLLT
FT                   ADDAGTDRPPAPRLVVVDAADGTVQVDRELPAWVQWPTLRGDDVLLVGDVDGTLHVASQ
FT                   GLRDGTEHWSTTAEGSGAGTTAAAALLDDGTLAVARGGAVTLVSTDGAVLRTVGDAPQG
FT                   GLTGQVATRGVVVSRTLGAVLVGSGSTTTVVTPTGEVRLDGSAAPVVVDDGSVPGLVLT
FT                   RTPGLQAWDARDGSPRWGAPVVDAQDVTVLEGRVHVGTSAAVVTFDGATGEELWRVARP
FT                   TASGTPLTDGRHLLVLARQGGRHTTPYDLVALHVADGSEAWRVPLPPQTWLTAAAGLLV
FT                   AVSYDTDALTETHRVLR"
FT                   /protein_id="YP_003635183.1"
FT   misc_feature    complement(80485..>80850)
FT                   /note="outer membrane assembly lipoprotein YfgL; Region:
FT                   assembly_YfgL; TIGR03300"
FT                   /db_xref="CDD:163208"
FT                   /locus_tag="Cfla_0064"
FT   gene            complement(81858..83351)
FT                   /db_xref="GeneID:9143930"
FT                   /locus_tag="Cfla_0065"
FT   CDS_pept        complement(81858..83351)
FT                   /locus_tag="Cfla_0065"
FT                   /gene_family="HOG000101832" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcv:Bcav_2123 hypothetical protein"
FT                   /db_xref="GI:296127934"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="GeneID:9143930"
FT                   /translation="MARDRARRDVELVEDDGSPAGAPPAGGPGRGDAHDGPGRTRRRAW
FT                   VVGAALVAALVAAGAVAQGVVTSRERERIAAVAGRPGVVGLLDGPVRVLDERRDDTLLY
FT                   DSAAASGGLVVAVQEQLDGREVARAVDPVTGTTAWETELVTGRGLTEVPGGEVLTSRGA
FT                   CRALGAGAAQVVCLADDAVSLVGRGTLTQQAPTTTRVVVLDARDGSVVTDLSDAAGEPL
FT                   TSRALAVLDDLVVLAGTGGGEARVRALTADGTVAWDVAFPVTTTTAFGSTVELHVTTDA
FT                   VALISSGPLRLLDATGTVRREVPLASADGVVGTAGDAVVVSTADGGTLLARPAGVERVP
FT                   GAFLRPTVDAPAAPGLVLTAQDATLHAWRPDGTAVWSVEQRVTDGGAALLPGHVLVGSG
FT                   TQVLALDAATGGELWRTSGLLPQSGLVTDGRHLLALAPLRDDSRPQVVAALDLADGDVA
FT                   WRVELPAVVTGIRGFHGVLATYTFGASVSGRGPLVTVLG"
FT                   /protein_id="YP_003635184.1"
FT   gene            complement(83400..84941)
FT                   /db_xref="GeneID:9143931"
FT                   /locus_tag="Cfla_0066"
FT   CDS_pept        complement(83400..84941)
FT                   /locus_tag="Cfla_0066"
FT                   /gene_family="HOG000101832" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01011"
FT                   /codon_start="1"
FT                   /product="Pyrrolo-quinoline quinone"
FT                   /transl_table="11"
FT                   /note="KEGG: bcv:Bcav_2124 hypothetical protein; PFAM:
FT                   Pyrrolo-quinoline quinone; SMART: Pyrrolo-quinoline quinone
FT                   beta-propeller repeat"
FT                   /db_xref="GI:296127935"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="GeneID:9143931"
FT                   /translation="MARRGARTHVELVDDDVDGGSGDGTDAGAPGPADPPQPLRGRRRA
FT                   ITLAAVLVVVLATVAVVGEVRQDARERERLAVLAASRTALAPLDGPPQVLWTSDREEVL
FT                   WASARTPDGLLVVPGTQGERVVRALDPATGDVVWERELLPPRDTAPAPNEDVAGASCVG
FT                   HGAAGDLLACLASDAMTVFDERTTDIRYVAPTVVRLVLLDPQDGTVVADLSDAVAGTGT
FT                   APAYVALGDLVVVSSVVDDATRVVAVAPDGSVAWRTEVPPSTRPAPGLPGLRRADVLAL
FT                   GDHLVVATAEEMRLLDATGATVRTVPLADDESLGGAEGTTAFARTGLDRVTLMQVGSEV
FT                   VARGEGTKVVRADHVGELPGGRVRADVDDGSDPRLVLTSDAEGLHGWDAEGVRRWSADV
FT                   QVTRSAMVLAGRVHATTRADALVTFDARTGAELWRRDGLVLDQAPLADGRVLLVRERGA
FT                   DGAALDLVALDVADGEVAWRTPWPEGVDQLQAVFGVIVGLSYDVEGEDWSVTALG"
FT                   /protein_id="YP_003635185.1"
FT   gene            complement(85007..86182)
FT                   /db_xref="GeneID:9143932"
FT                   /locus_tag="Cfla_0067"
FT   CDS_pept        complement(85007..86182)
FT                   /locus_tag="Cfla_0067"
FT                   /gene_family="HOG000003107" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02913"
FT                   /codon_start="1"
FT                   /product="extracellular repeat protein, HAF family"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: extracellular repeat protein, HAF family;
FT                   KEGG: geo:Geob_2004 extracellular repeat protein, HAF
FT                   family"
FT                   /db_xref="GI:296127936"
FT                   /db_xref="InterPro:IPR014262"
FT                   /db_xref="GeneID:9143932"
FT                   /translation="MPTRTTPRLLPVSLLACTLAVSPIAAAPAGAGPGITVQDLGTLGG
FT                   VSSGATDVNERGQVVGTSLVANGDRHAFLWERGVMRDLGTLDGLDSYAEAVNDRGQVVG
FT                   GATDGTGVLRPFLWERGVMRELPAPAGAWSSAVLVNQRGQVVIWAALGDQSHHYLWDRG
FT                   RITELRVPGTDAWISPTDINDKGWVTGSVVLAPDPVGRAVLWRDGEVVLLGSPVPPGDG
FT                   SYARGAALNEAGQVAATLPAVGDSEVAALWQDGGWTLLGSLGGSSDARDVNEHGTVVGR
FT                   SFVDGLSHAVLHRDGEVEDLGALDTQWDGSVAHRLNDREQVIGTVWPSRREGLPRDVLW
FT                   QDGELHVLPPLVTDGVTHALDINERGQVVGHAATGVPGVDHAVLWTTRRGS"
FT                   /protein_id="YP_003635186.1"
FT   misc_feature    complement(85271..86068)
FT                   /note="Predicted integral membrane proteins containing
FT                   uncharacterized repeats [Function unknown]; Region:
FT                   COG5563"
FT                   /db_xref="CDD:35122"
FT                   /locus_tag="Cfla_0067"
FT   misc_feature    complement(85919..86035)
FT                   /note="probable extracellular repeat, HAF family; Region:
FT                   HAF_rpt; TIGR02913"
FT                   /db_xref="CDD:131959"
FT                   /locus_tag="Cfla_0067"
FT   misc_feature    complement(85805..85906)
FT                   /note="probable extracellular repeat, HAF family; Region:
FT                   HAF_rpt; TIGR02913"
FT                   /db_xref="CDD:131959"
FT                   /locus_tag="Cfla_0067"
FT   gene            complement(86232..87386)
FT                   /db_xref="GeneID:9143933"
FT                   /locus_tag="Cfla_0068"
FT   CDS_pept        complement(86232..87386)
FT                   /locus_tag="Cfla_0068"
FT                   /gene_family="HOG000003107" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02913"
FT                   /codon_start="1"
FT                   /product="extracellular repeat protein, HAF family"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: extracellular repeat protein, HAF family;
FT                   KEGG: geo:Geob_2004 extracellular repeat protein, HAF
FT                   family"
FT                   /db_xref="GI:296127937"
FT                   /db_xref="InterPro:IPR014262"
FT                   /db_xref="GeneID:9143933"
FT                   /translation="MLTRTAPRLLLVGVLACTLAAVPVTADPPAAARAGSGITVRDLGT
FT                   LPGDSWSVAVDVNEHGQVIGFSQAGNGDTRGFLWDRGVMRDLGTFSAVAINDSGQVVGT
FT                   ALNGSGAQQAAMWDGGRLRYLTTPDGAPSRAVLLNEHGQVVVQTREYGGDEPDRLRNYV
FT                   WDDGAVTEIPPLPGSPYMHPLDINDQGWVTGYSPGPGSLRHGFLWRDGVVTDLGSAASG
FT                   DVASTMGLAVNEAGQVAGQASASDTEHAAAVWQDGEWMRLGHREGWSGATDINEHGTVV
FT                   GWASDGGPHEHAVLYRDGEWTDLAPAGSRAIELNDRDQVIGSVDGYTLTAVLWQDGETH
FT                   LLPPLYPGSATTAYDISERGQVAGSARVLSGVEHAVLWTTARGS"
FT                   /protein_id="YP_003635187.1"
FT   misc_feature    complement(86733..>87272)
FT                   /note="Predicted integral membrane proteins containing
FT                   uncharacterized repeats [Function unknown]; Region:
FT                   COG5563"
FT                   /db_xref="CDD:35122"
FT                   /locus_tag="Cfla_0068"
FT   misc_feature    complement(87111..87227)
FT                   /note="probable extracellular repeat, HAF family; Region:
FT                   HAF_rpt; TIGR02913"
FT                   /db_xref="CDD:131959"
FT                   /locus_tag="Cfla_0068"
FT   misc_feature    complement(86463..86576)
FT                   /note="probable extracellular repeat, HAF family; Region:
FT                   HAF_rpt; TIGR02913"
FT                   /db_xref="CDD:131959"
FT                   /locus_tag="Cfla_0068"
FT   gene            87725..88771
FT                   /db_xref="GeneID:9143934"
FT                   /locus_tag="Cfla_0069"
FT   CDS_pept        87725..88771
FT                   /locus_tag="Cfla_0069"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01167"
FT                   /codon_start="1"
FT                   /product="LPXTG-motif cell wall anchor domain protein"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: LPXTG-motif cell wall anchor domain
FT                   protein; KEGG: ter:Tery_4644 allergen V5/TPX-1 related"
FT                   /db_xref="GI:296127938"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="GeneID:9143934"
FT                   /translation="MKRRLPLVLLSVAALVILPATTSTATGGGHHGASTPGYSSGYGPG
FT                   YDKPRPGKPKPTPSAPAGELCGGKRADEIIAWDAYTCDKATGYFLYEKLDKRRSAGYWN
FT                   SGPQHRVALHHTWAWPTGDAEARKEASSTLPRDADTIPLVLDAADAAAVCAAPSAYGLQ
FT                   VDLVGDGVAGRGLDVPALVPTTITPGRDSGGFPIPHTLAYYGHYEVKQLVDLSALCAPA
FT                   PTPTPEPTPEPTVAPTPQPTVAPTPEPTVAPTAEPTVAPTPEPSPSPTERSEVLPAPAE
FT                   TPTPSASPTPAAAPSPTPTERAEVLSATDDRTLAATGAQTAVGLLAAIAAIAGGSALVL
FT                   ARRRRTQG"
FT                   /protein_id="YP_003635188.1"
FT   gene            complement(89068..89676)
FT                   /db_xref="GeneID:9143935"
FT                   /locus_tag="Cfla_0070"
FT   CDS_pept        complement(89068..89676)
FT                   /locus_tag="Cfla_0070"
FT                   /gene_family="HOG000223849" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, TetR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG: nca:Noca_2098
FT                   TetR family transcriptional regulator"
FT                   /db_xref="GI:296127939"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="GeneID:9143935"
FT                   /translation="MNLPEGGGHRSVDERRAQLLDAALAVLREQGLAGLTTRAVTARAG
FT                   APHGIFHYAFGSKAALVRALIERELRGATDAWAPALATDDLEAALRHALRAQLDLVRAD
FT                   PAHQAAMFELIRAARDDGDVSTVAFERQRYHAAITERLTTWSQRSGAVWAGSAEQVAAL
FT                   ILSATDGVIQAWVTDHDDTLAEASIDLLARAITSLASPA"
FT                   /protein_id="YP_003635189.1"
FT   misc_feature    complement(<89359..89649)
FT                   /note="pyrimidine utilization regulatory protein R; Region:
FT                   RutR; TIGR03613"
FT                   /db_xref="CDD:132652"
FT                   /locus_tag="Cfla_0070"
FT   misc_feature    complement(89482..89622)
FT                   /note="Bacterial regulatory proteins, tetR family; Region:
FT                   TetR_N; pfam00440"
FT                   /db_xref="CDD:144144"
FT                   /locus_tag="Cfla_0070"
FT   gene            89779..90471
FT                   /db_xref="GeneID:9143936"
FT                   /locus_tag="Cfla_0071"
FT   CDS_pept        89779..90471
FT                   /locus_tag="Cfla_0071"
FT                   /gene_family="HOG000053784" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:CMM_2678"
FT                   /codon_start="1"
FT                   /product="putative acetyltransferase"
FT                   /transl_table="11"
FT                   /note="KEGG: cmi:CMM_2678 putative acetyltransferase"
FT                   /db_xref="GI:296127940"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="GeneID:9143936"
FT                   /translation="MIVVTRAVPGDLDAAADVLAEAFLDDPVTSAIVGGADHDRLARMR
FT                   HLFVAFLRLAIADGTVDVARRAGDPQVLGAAIWEAPDASGGLLRLARQLPSFWRAFGLG
FT                   GLRRGVGAKAAIDRYRPRRPHWYLQEIGVAAAARGQGVGGLLLAARLADVDAADAPAYL
FT                   ESSTARNRRLYLRHGFAETMLLTGVAGEPMAMWRAPRSEREAAARDGETTTPPGEAGAG
FT                   RRPSARRV"
FT                   /protein_id="YP_003635190.1"
FT   gene            complement(90478..91944)
FT                   /db_xref="GeneID:9143937"
FT                   /locus_tag="Cfla_0072"
FT   CDS_pept        complement(90478..91944)
FT                   /locus_tag="Cfla_0072"
FT                   /gene_family="HOG000238476" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, XRE family"
FT                   /transl_table="11"
FT                   /note="KEGG: transcriptional regulator, XRE family; PFAM:
FT                   helix-turn-helix domain protein; protein of unknown
FT                   function DUF955; SMART: helix-turn-helix domain protein"
FT                   /db_xref="GI:296127941"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="GeneID:9143937"
FT                   /translation="MEGGATGAASGTGVDTLVLGRRVRHLRTARGMTLDDLGRAIGRAP
FT                   SQVSMLENGHREPKLSLLAQVAEALGVELGDLLSTEPPTRRAALEVELERAQRGPLFAS
FT                   LGVPQVKVGRSLPSDALEALVALQEQVQRLLTENAATPEEARRANAELRARMRAQDNYF
FT                   PELEQHARTLLDAVGHHGGPLSQRATSEIAAHLGFSLHYVADLPHSTRTVTDLAHGRIY
FT                   LPQRGAAHNDSRSPLLQAIASHVLGHTEPVDYADFLRQRVEANYLAAALMIPEASAVAF
FT                   LGEAKAERRVSVEDLRDTYAVPYETAAHRFTNLATQHLQIPVHFMKVHEGGTLHKAYEN
FT                   DGVVFPSDPLGAIEGQPVCREWTARTVFELPDRFSPYYQYTDTSSGTFWCTSRVQSSSQ
FT                   GAFSVSVGTPFAHVRWFRGRETTVRSASRCPDPSCCREAPRALASRWADQAFPSARPHA
FT                   SLLAALPVGVFPGVDQTEVYEFLERHAPQD"
FT                   /protein_id="YP_003635191.1"
FT   misc_feature    complement(91558..91890)
FT                   /note="Predicted transcriptional regulators
FT                   [Transcription]; Region: HipB; COG1396"
FT                   /db_xref="CDD:31586"
FT                   /locus_tag="Cfla_0072"
FT   misc_feature    complement(91714..91887)
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cd00093"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Cfla_0072"
FT   misc_feature    complement(order(91786..91788,91861..91863,91873..91875))
FT                   /note="non-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Cfla_0072"
FT   misc_feature    complement(order(91789..91791,91864..91866))
FT                   /note="salt bridge; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Cfla_0072"
FT   misc_feature    complement(order(91783..91788,91798..91800,91807..91809,
FT                   91840..91845))
FT                   /note="sequence-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Cfla_0072"
FT   misc_feature    complement(<90736..91470)
FT                   /note="Predicted transcriptional regulator [General
FT                   function prediction only]; Region: COG3800"
FT                   /db_xref="CDD:33594"
FT                   /locus_tag="Cfla_0072"
FT   misc_feature    complement(91009..91368)
FT                   /note="Domain of unknown function (DUF955); Region: DUF955;
FT                   cl01076"
FT                   /db_xref="CDD:154183"
FT                   /locus_tag="Cfla_0072"
FT   gene            92499..93857
FT                   /db_xref="GeneID:9143938"
FT                   /locus_tag="Cfla_0073"
FT   CDS_pept        92499..93857
FT                   /locus_tag="Cfla_0073"
FT                   /gene_family="HOG000238475" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01346"
FT                   /codon_start="1"
FT                   /product="isocitrate lyase"
FT                   /transl_table="11"
FT                   /note="KEGG: tfu:Tfu_1377 isocitrate lyase; TIGRFAM:
FT                   isocitrate lyase; PFAM: isocitrate lyase and
FT                   phosphorylmutase"
FT                   /db_xref="GI:296127942"
FT                   /db_xref="InterPro:IPR000918"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="GeneID:9143938"
FT                   /translation="MTAPTTQIDDLQGTPAAVAGAVPARPGDQTRTAEQLEHDWATDPR
FT                   WSGIERRHTGADVVRLRGSVREDPTLARRGAQRLWELLHTRTHVPALGALTGNQAVQQV
FT                   RAGLEAIYLSGWQVAADANLSGQTYPDQSLYPANSVPAVVRRINNALMRADQIDVAENG
FT                   RATREWLAPIVADAEAGFGGPLNAYELMHAMIQAGAAGVHWEDQLAAEKKCGHLGGKVL
FT                   VPTSQHVRTLSAARLAADVAGAPTVVIARTDSLGADLLTSDVDERDQEFLTGERTAEGY
FT                   FRVRPGLDAVVSRATAYAPYSDLIWVETSTPDVALAVEFAERIHEAFPGKLLAYNCSPS
FT                   FNWRAHLDDAQIARFQRELAGHGYAFQFITLAGFHALNESMFTLAKGYAERGMSAYVDL
FT                   QTAEFAAEADGYTATRHQREVGTGYFDQVATAISPDSATLALAGSTETAQFQH"
FT                   /protein_id="YP_003635192.1"
FT   misc_feature    92706..93740
FT                   /note="PEP phosphonomutase and related enzymes
FT                   [Carbohydrate transport and metabolism]; Region: PrpB;
FT                   COG2513"
FT                   /db_xref="CDD:32583"
FT                   /locus_tag="Cfla_0073"
FT   misc_feature    92733..93659
FT                   /note="Members of the ICL/PEPM enzyme family catalyze
FT                   either P-C or C-C bond formation/cleavage. Known members
FT                   are phosphoenolpyruvate mutase (PEPM), phosphonopyruvate
FT                   hydrolase (PPH), carboxyPEP mutase (CPEP mutase),
FT                   oxaloacetate hydrolase (OAH), isocitrate...; Region:
FT                   ICL_PEPM; cd00377"
FT                   /db_xref="CDD:119340"
FT                   /locus_tag="Cfla_0073"
FT   misc_feature    order(92739..92741,92760..92762,92766..92777,92781..92795,
FT                   92799..92804,92811..92813,92817..92825,92844..92846,
FT                   92856..92861,92883..92888,92895..92906,92910..92915,
FT                   92922..92927,92931..92936,92943..92948,93042..93044,
FT                   93060..93065,93075..93077,93084..93086,93174..93179,
FT                   93186..93188,93195..93200,93207..93209,93624..93632,
FT                   93636..93644,93648..93656)
FT                   /note="tetramer interface; other site"
FT                   /db_xref="CDD:119340"
FT                   /locus_tag="Cfla_0073"
FT   misc_feature    order(92832..92834,92838..92846,92889..92891,93024..93026,
FT                   93030..93032,93111..93113,93249..93251,93420..93422,
FT                   93504..93506,93510..93512,93606..93608)
FT                   /note="active site"
FT                   /db_xref="CDD:119340"
FT                   /locus_tag="Cfla_0073"
FT   misc_feature    order(92889..92891,93024..93026,93030..93032,93111..93113)
FT                   /note="Mg2+/Mn2+ binding site; other site"
FT                   /db_xref="CDD:119340"
FT                   /locus_tag="Cfla_0073"
FT   gene            94005..95672
FT                   /db_xref="GeneID:9143939"
FT                   /locus_tag="Cfla_0074"
FT   CDS_pept        94005..95672
FT                   /locus_tag="Cfla_0074"
FT                   /gene_family="HOG000238464" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01344"
FT                   /codon_start="1"
FT                   /EC_number="2.3.3.9"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: malate synthase A; KEGG: aau:AAur_0721
FT                   malate synthase; PFAM: Malate synthase family protein"
FT                   /db_xref="GI:296127943"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR006252"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR019830"
FT                   /db_xref="GeneID:9143939"
FT                   /translation="MTIIDTSPVAANLTPAFSHPRLTITGPRVDGIDHVLTPEAMDFLT
FT                   DLHQRFSGRRHELLLARQRRRDRFGNGADPDFLPLTAHIRADPTWRVAGPGPGLEDRRV
FT                   EITGPTDRKMTVNALNSGAKVWLADHEDAMSPTWSNAISGQVNLYDAIRGQIDFTSPEG
FT                   KEYKVGETTPTIVFRPRGWHLTEKHLRFTDRAGQSCAASASLVDAGLYLFHNAQALIDA
FT                   GRGPYLYLPKIEGHLEARLWDDVFRFTETYLNLRHGTIRATVLIETITAAFEMEEILYE
FT                   LRDHCAGLNAGRWDYIFSVIKNFRARGPRFVMPDRGKVTMTVPFMKAYTELLVQTCHKR
FT                   GAQAIGGMSAFIPNRREPEVTARALEQVRADKEREAGQGYDGTWVAHPDLVPVAREVFD
FT                   AAFGDRTDQRHRLREDVRVTAADLLNVPSAGGGEPGAVTDAGLRQNVSVAVRYLEAWLR
FT                   GSGAVAIDNLMEDAATAEISRSQVWQWVHQGTVTAEGTRIDATTVEKVLADVLGSLERR
FT                   EGDRYDAAATLFREVSLSEDFPTFLTIPAYTQHLVTPA"
FT                   /product="malate synthase A"
FT                   /protein_id="YP_003635193.1"
FT   misc_feature    94107..95654
FT                   /note="Malate synthase A (MSA), present in some bacteria,
FT                   plants and fungi. Prokaryotic MSAs tend to be monomeric,
FT                   whereas eukaryotic enzymes are homomultimers. In general,
FT                   malate synthase catalyzes the Claisen condensation of
FT                   glyoxylate and acetyl-CoA to...; Region: malate_synt_A;
FT                   cd00727"
FT                   /db_xref="CDD:48433"
FT                   /locus_tag="Cfla_0074"
FT   misc_feature    94107..95645
FT                   /note="malate synthase A; Region: malate_syn_A; TIGR01344"
FT                   /db_xref="CDD:130411"
FT                   /locus_tag="Cfla_0074"
FT   misc_feature    order(94536..94538,94803..94805,94881..94883,94887..94889,
FT                   95415..95417)
FT                   /note="active site"
FT                   /db_xref="CDD:48433"
FT                   /locus_tag="Cfla_0074"
FT   gene            96234..96998
FT                   /db_xref="GeneID:9143940"
FT                   /locus_tag="Cfla_0075"
FT   CDS_pept        96234..96998
FT                   /locus_tag="Cfla_0075"
FT                   /gene_family="HOG000030426" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00500"
FT                   /codon_start="1"
FT                   /product="methionine aminopeptidase, type I"
FT                   /transl_table="11"
FT                   /note="KEGG: nca:Noca_2738 methionine aminopeptidase, type
FT                   I; TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24"
FT                   /db_xref="GI:296127944"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="GeneID:9143940"
FT                   /translation="MALKSPAEIEQMRPAGRFVADVLTSLREHAKVGMTTDDLDAHARE
FT                   MIAKAGARSVYLGYHPSFGAMPYPGVLCTSVNDHALHGLPSQRVLADGDVLSIDFACEV
FT                   EGWVADSALTFQLGTTTPEAQRLITATEQALAAGIAAAQPNGRMGDISAAIGKVARQTG
FT                   FSLNTDFGGHGVGRTMHEDPHVPNDGRAGTGVKLKPGTVIAIEPWFMAGSSDYVIDDDG
FT                   WTIRSADGALTAHAEHTVAITRRGPVVLTSRD"
FT                   /protein_id="YP_003635194.1"
FT   misc_feature    96234..96992
FT                   /note="methionine aminopeptidase; Reviewed; Region:
FT                   PRK07281"
FT                   /db_xref="CDD:168892"
FT                   /locus_tag="Cfla_0075"
FT   misc_feature    96258..96989
FT                   /note="Methionine Aminopeptidase 1. E.C. 3.4.11.18. Also
FT                   known as methionyl aminopeptidase and Peptidase M.
FT                   Catalyzes release of N-terminal amino acids, preferentially
FT                   methionine, from peptides and arylamides; Region: MetAP1;
FT                   cd01086"
FT                   /db_xref="CDD:29971"
FT                   /locus_tag="Cfla_0075"
FT   misc_feature    order(96477..96479,96528..96530,96561..96563,96750..96752,
FT                   96849..96851,96942..96944)
FT                   /note="active site"
FT                   /db_xref="CDD:29971"
FT                   /locus_tag="Cfla_0075"
FT   gene            complement(97104..98837)
FT                   /db_xref="GeneID:9143941"
FT                   /locus_tag="Cfla_0076"
FT   CDS_pept        complement(97104..98837)
FT                   /locus_tag="Cfla_0076"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.7.7.7"
FT                   /codon_start="1"
FT                   /EC_number="2.7.7.7"
FT                   /transl_table="11"
FT                   /note="KEGG: kra:Krad_4326 DNA-directed DNA polymerase;
FT                   PFAM: UMUC domain protein DNA-repair protein"
FT                   /db_xref="GI:296127945"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR017962"
FT                   /db_xref="InterPro:IPR017963"
FT                   /db_xref="GeneID:9143941"
FT                   /translation="MERGGDRAQRLVDAVRVRDAATVLHLDADAFFAAVEQRDKPSLRG
FT                   RPVLVGGTGGRGVVSTASYEARRDGARSAMPMSRARRLSPAAAVLFPRFAAYAAYSQVI
FT                   MGVLRDLTPAVEPLSIDEAFADLTLAPGGTPEPEEAAAQVQARVTELTGLTVSVGVGRS
FT                   KLVAKIASDLRKPGGVVVVRPEDEDDVLLPLDVRKVPGVGPATQGALERLGVRTVADLR
FT                   RQPLDTLTMTLGEAHGTGLYLMSRGLDDRPVVTTSERKSAGAERTFAVDLRGRDVVLSA
FT                   VDDVVDEALQRLERHGGAARTVVAKVRYADFSTVTRSVTFPHPTASGSELRDAARRAVL
FT                   AAGVVEPVRLLGVAFHSLSSHAQLALDLDAHLFDAPRRAVVGEHDHVSGRLVDDVASSP
FT                   EGMDTADGEVTGVLEDGEVTGVLEDGEGTGVLEDGEGAPTLGHDATGSGGDTSSSTAPA
FT                   VAQAGAGDVPEVDATVARLVADDARLVGAEKAVVGRPLGAPVTGRPLDEANARPGLDVE
FT                   HATLGRGWVVHVRGREATVRFETALTAPARSRVLDLDEDPLVLVEPVGVTPPSVVPAHL
FT                   R"
FT                   /product="DNA-directed DNA polymerase"
FT                   /protein_id="YP_003635195.1"
FT   misc_feature    complement(97779..98768)
FT                   /note="DNA Polymerase IV/Kappa; Region: Pol_IV_kappa;
FT                   cd03586"
FT                   /db_xref="CDD:176459"
FT                   /locus_tag="Cfla_0076"
FT   misc_feature    complement(97779..98765)
FT                   /note="DNA polymerase IV; Validated; Region: PRK02406"
FT                   /db_xref="CDD:167372"
FT                   /locus_tag="Cfla_0076"
FT   misc_feature    complement(order(98313..98315,98475..98477,98637..98639,
FT                   98646..98648,98655..98660,98742..98750,98754..98759))
FT                   /note="active site"
FT                   /db_xref="CDD:176459"
FT                   /locus_tag="Cfla_0076"
FT   misc_feature    complement(order(97788..97793,97878..97880,97884..97895,
FT                   97962..97964,98037..98060,98127..98132,98220..98240,
FT                   98334..98336,98472..98477,98481..98483,98610..98612,
FT                   98682..98684))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:176459"
FT                   /locus_tag="Cfla_0076"
FT   misc_feature    complement(97191..>97427)
FT                   /note="DNA polymerase IV; Provisional; Region: PRK03348"
FT                   /db_xref="CDD:167517"
FT                   /locus_tag="Cfla_0076"
FT   gene            complement(99000..100007)
FT                   /db_xref="GeneID:9143942"
FT                   /locus_tag="Cfla_0077"
FT   CDS_pept        complement(99000..100007)
FT                   /locus_tag="Cfla_0077"
FT                   /gene_family="HOG000223811" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:CMM_0466"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cmi:CMM_0466 hypothetical protein"
FT                   /db_xref="GI:296127946"
FT                   /db_xref="GeneID:9143942"
FT                   /translation="MPTTTRPSRGVLLACAVVLAGCRTDATVPGPDPGAVGPAATVPAT
FT                   TSSAAPATPAPASTATDTPAPVTTVTTPPPSPTAGPTPAPVDTPTARAVTLPEPGARFE
FT                   YQIGGPDAPADDTVVVVRDSTAAPTGRYDVCYVNGFQTQPSETDRLLRTEPELVLHHAG
FT                   EPVRDDGWPDEVLYDLTRADLRARVLERVGKVVDGCAAAGFDAVEVDNLDSYTRSLGLI
FT                   APADTLAYVALLVERAHAAGLAFAQKNTAELTTEVRALGADLVVAEECREWEECDVYTS
FT                   VYPVVLDVEYDRASFDAACAEQSDAVTRLPGLTVVLRDRDVSPRSAPGSVHAAC"
FT                   /protein_id="YP_003635196.1"
FT   misc_feature    complement(99168..99620)
FT                   /note="TM1410 hypothetical-related protein; Region: DUF297;
FT                   cl00997"
FT                   /db_xref="CDD:163942"
FT                   /locus_tag="Cfla_0077"
FT   gene            100137..100673
FT                   /db_xref="GeneID:9143943"
FT                   /locus_tag="Cfla_0078"
FT   CDS_pept        100137..100673
FT                   /locus_tag="Cfla_0078"
FT                   /gene_family="HOG000273094" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01451"
FT                   /codon_start="1"
FT                   /product="protein tyrosine phosphatase"
FT                   /transl_table="11"
FT                   /note="KEGG: protein tyrosine phosphatase; PFAM:
FT                   Protein-tyrosine phosphatase, low molecular weight; SMART:
FT                   Protein-tyrosine phosphatase, low molecular weight"
FT                   /db_xref="GI:296127947"
FT                   /db_xref="InterPro:IPR000106"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="GeneID:9143943"
FT                   /translation="MPRLYRVMTVCTGNICRSPMAEIVLRERLADAGLGDAVEVDSTGI
FT                   SDEEHGNPVDWRARSVLRRHGYPTGEGHRARQVRPTELRERDLLLPMTAVHARALRRLA
FT                   DGDSMVTGRIRMFRSFDPAAPAEPGQPEHVLDVDDPWYGPEDGFEVTLAEVEAAADGIV
FT                   AYVRAALDRAGAPAE"
FT                   /protein_id="YP_003635197.1"
FT   misc_feature    100149..100628
FT                   /note="Low molecular weight phosphatase family; Region:
FT                   LMWPc; cd00115"
FT                   /db_xref="CDD:29014"
FT                   /locus_tag="Cfla_0078"
FT   misc_feature    100149..100613
FT                   /note="Low molecular weight phosphotyrosine protein
FT                   phosphatase; Region: LMWPc; pfam01451"
FT                   /db_xref="CDD:144880"
FT                   /locus_tag="Cfla_0078"
FT   misc_feature    order(100167..100169,100173..100178,100182..100190)
FT                   /note="active site"
FT                   /db_xref="CDD:29014"
FT                   /locus_tag="Cfla_0078"
FT   gene            100796..102370
FT                   /db_xref="GeneID:9143944"
FT                   /locus_tag="Cfla_0079"
FT   CDS_pept        100796..102370
FT                   /locus_tag="Cfla_0079"
FT                   /gene_family="HOG000040236" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /codon_start="1"
FT                   /product="Methyltransferase type 12"
FT                   /transl_table="11"
FT                   /note="PFAM: Methyltransferase type 12; KEGG: lbf:LBF_0345
FT                   hypothetical protein"
FT                   /db_xref="GI:296127948"
FT                   /db_xref="InterPro:IPR013217"
FT                   /db_xref="GeneID:9143944"
FT                   /translation="MLAVPDIRHVLFPGRHHLVTAFQAAYLADLLAGRVRDAAGEPVTC
FT                   APDARVVWAVTSATHSGTRRNPVPAHRREAMIEAVTARAGLPSLVVPVADVPPSPRFAH
FT                   TVLATAELVLGAPLTPADTVVACSTPSVAALYTAEGFRVAPVEDGAPGDPPRPWDVLER
FT                   MVAGDQTWRTLAHPDAVAYYERYRLDAHVRLVHTDPTVQDDGDLTETRDYATYTAAFDD
FT                   ASDRKWAQVAPHVVPGRVVDLGCAAGGLLERAARDPRLAESDLYGVDVSRHLVAEAEHR
FT                   RAQGVFANPNVFFAQRNLLLGPVFPDRSVDTTTTIALTHEIASYGNGRADLELLARRVF
FT                   AHTRPGGVWINSDVLGPGDPDRVVDLVLEGDGDVPPRDLSGLARDEAAAYVAGLAPAAR
FT                   FVQFAQDFPALSGADVDVEWVAAEPGVSVARTSLRTAMEYLYTRDYTDSWLSECHERFC
FT                   DMTGDDWRDLLEGVGFELDPGSGPWRNEWLVENRLRVGAALHDPATGERVPWPDTHVLT
FT                   VARRPLA"
FT                   /protein_id="YP_003635198.1"
FT   misc_feature    101510..101839
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cd02440"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Cfla_0079"
FT   misc_feature    order(101522..101542,101600..101605,101684..101692,
FT                   101759..101761)
FT                   /note="S-adenosylmethionine binding site; other site"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Cfla_0079"
FT   gene            102611..103786
FT                   /db_xref="GeneID:9143945"
FT                   /locus_tag="Cfla_0080"
FT   CDS_pept        102611..103786
FT                   /locus_tag="Cfla_0080"
FT                   /gene_family="HOG000223049" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /codon_start="1"
FT                   /product="aminotransferase class I and II"
FT                   /transl_table="11"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   aminotransferase class I and II"
FT                   /db_xref="GI:296127949"
FT                   /db_xref="InterPro:IPR001176"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="GeneID:9143945"
FT                   /translation="MKVAARAHVPPFAVMEILAAANARRAAGEHVLNLCAGEPSTGASD
FT                   VVRQRAVELLTSGDLGYTESLGAPGLRAAIAAHYGDTYGVDVDPARVAVTTGSSGGFML
FT                   AFLAAFDVGDRVALARPGYPAYANILTALGCEVVDLACGPEQRYQPTVAQLEALDEPVE
FT                   GLVVASPANPTGTMIEPAELAALAAWCGEHGVRLVSDEIYHGITYADAGGTAPETATAA
FT                   RYLATGAVVVNSFSKYWAMTGWRLGWLVLPDDLVGPVDALAGNVALCPPALAQHAGVAA
FT                   FSPDGMAAARANVERYADSRRLLLDRLPDLGWDPVAPADGAFYLYGDVSATGLDAVTYC
FT                   ARLLDEAGVAITPGTDFDPVGGGSWVRLSFASSAAVVAEAAERIVAWQRGL"
FT                   /protein_id="YP_003635199.1"
FT   misc_feature    102695..103771
FT                   /note="aspartate aminotransferase; Provisional; Region:
FT                   PRK06108"
FT                   /db_xref="CDD:168398"
FT                   /locus_tag="Cfla_0080"
FT   misc_feature    102704..103720
FT                   /note="Aspartate aminotransferase family. This family
FT                   belongs to pyridoxal phosphate (PLP)-dependent aspartate
FT                   aminotransferase superfamily (fold I). Pyridoxal phosphate
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine...; Region: AAT_like; cd00609"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Cfla_0080"
FT   misc_feature    order(102899..102907,102977..102979,103124..103126,
FT                   103217..103219,103310..103312,103316..103321,
FT                   103343..103345)
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Cfla_0080"
FT   misc_feature    order(102908..102910,103007..103009,103196..103198,
FT                   103337..103345,103430..103432,103439..103441)
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Cfla_0080"
FT   misc_feature    103319..103321
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Cfla_0080"
FT   gene            complement(103803..105173)
FT                   /db_xref="GeneID:9143946"
FT                   /locus_tag="Cfla_0081"
FT   CDS_pept        complement(103803..105173)
FT                   /locus_tag="Cfla_0081"
FT                   /gene_family="HOG000046191" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00871"
FT                   /codon_start="1"
FT                   /EC_number="1.1.1.49"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: glucose-6-phosphate 1-dehydrogenase; KEGG:
FT                   stp:Strop_1668 glucose-6-phosphate 1- dehydrogenase; PFAM:
FT                   glucose-6-phosphate dehydrogenase"
FT                   /db_xref="GI:296127950"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9143946"
FT                   /translation="MSAGLVVLGATGDLSARYVLPGLARIEALVDGGLRVVGVANDDLD
FT                   DDGFRRLVHEKVARHAGGEPAAEVTALVDRVTWVRGDVTEPATLQRALGACEVGDADPL
FT                   VLYLALPHVLFLPVVRALRDVDLPDGLRVVVEKPFGEDLAGAAELNAALGDLLPEEQIF
FT                   RVDHFLAKQTVLNLLGLRFANRILEPLWSSTHVASVDIVFDETVDAQGRASYYDRSGAL
FT                   RDMVQNHLLQLLTYVAMEPPTTVAPADLAARKADVLRAVRPLDREGVARWTRRGRYTAG
FT                   EVAGRHVDAYADAPGVDPARATETYAEVTLHVDTWRWSGVPFRLRTGKALAADRREIVV
FT                   RFRDVPLRVFDGPAPVRNELRLQLDPDRMSLDLNVNGIDDPFRLETVTLDTELARQDPT
FT                   PYGQLLLAVIDGDTRLSARAAEAEEGWRIVEPVLAAWADGAVPLEEYAAGSDGPRRR"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /protein_id="YP_003635200.1"
FT   misc_feature    complement(103815..105161)
FT                   /note="glucose-6-phosphate 1-dehydrogenase; Provisional;
FT                   Region: PRK12853"
FT                   /db_xref="CDD:171772"
FT                   /locus_tag="Cfla_0081"
FT   misc_feature    complement(104646..105158)
FT                   /note="Glucose-6-phosphate dehydrogenase, NAD binding
FT                   domain; Region: G6PD_N; pfam00479"
FT                   /db_xref="CDD:144172"
FT                   /locus_tag="Cfla_0081"
FT   misc_feature    complement(103815..104642)
FT                   /note="Glucose-6-phosphate dehydrogenase, C-terminal
FT                   domain; Region: G6PD_C; pfam02781"
FT                   /db_xref="CDD:145765"
FT                   /locus_tag="Cfla_0081"
FT   gene            complement(105290..105655)
FT                   /db_xref="GeneID:9143947"
FT                   /locus_tag="Cfla_0082"
FT   CDS_pept        complement(105290..105655)
FT                   /locus_tag="Cfla_0082"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: vha:VIBHAR_01760 hypothetical protein"
FT                   /db_xref="GI:296127951"
FT                   /db_xref="GeneID:9143947"
FT                   /translation="MRARTRRARVVAVVVVAGLVGSTLLGAIAALGGGGVSIDIPAQGP
FT                   WTVGVAGDLGRVPECVRDPAVAESYMSADMPSSGGSLVLDVDADAADVERVVRCLARVI
FT                   DPARIGVMTTPTPRDAA"
FT                   /protein_id="YP_003635201.1"
FT   gene            complement(105688..106722)
FT                   /db_xref="GeneID:9143948"
FT                   /locus_tag="Cfla_0083"
FT   CDS_pept        complement(105688..106722)
FT                   /locus_tag="Cfla_0083"
FT                   /gene_family="HOG000230190" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03741"
FT                   /codon_start="1"
FT                   /product="Integral membrane protein TerC"
FT                   /transl_table="11"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   art:Arth_3613 integral membrane protein TerC"
FT                   /db_xref="GI:296127952"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="GeneID:9143948"
FT                   /translation="MDVPVWVWLAVLAAILVMLTIDLVAHRRAHVIDVREAAVWSGVWV
FT                   ALGVGFGALVWQVYGSTAGQQYFAGYLIEKSLAVDNVFVWAIIFTYFAVPRELQHRVLF
FT                   LGVLGALVFRGAFIAGGAALIESFGWVLYLFAAFLLWTGYRMLRQRDEHLDPTRSRAWL
FT                   LFRRHVPMTDAFHGQRLLVRRDGALLATPLLAVLVLVEVTDVVFAVDSIPAIFAVTDDV
FT                   FLVFTANAFAILGLRAMYFLLADLMHRFVYLKTGLALVLVWVGIKMLLKIDVLYIPTTL
FT                   SLAVVVTILAVSVAASLHATRGQGRRAVTAPTDPPFRVADEAETRALEPLLRRRPAGAG
FT                   GRRP"
FT                   /protein_id="YP_003635202.1"
FT   misc_feature    complement(105814..106671)
FT                   /note="Integral membrane protein TerC family; Region: TerC;
FT                   cl10468"
FT                   /db_xref="CDD:175219"
FT                   /locus_tag="Cfla_0083"
FT   gene            107101..107451
FT                   /db_xref="GeneID:9143949"
FT                   /locus_tag="Cfla_0084"
FT   CDS_pept        107101..107451
FT                   /locus_tag="Cfla_0084"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rsa:RSal33209_2336 hypothetical protein"
FT                   /db_xref="GI:296127953"
FT                   /db_xref="GeneID:9143949"
FT                   /translation="MWSWNPNSWVLGFPRRQSLPLKFDNMRERGSLRSARLSLEVACGA
FT                   FCLLSLASVIASLNHLNTARNFADAGYVPEAMDSMSVAWLWIIVTGALVMAALAALVFS
FT                   RRWRTPAGEEMS"
FT                   /protein_id="YP_003635203.1"
FT   gene            107448..108083
FT                   /db_xref="GeneID:9143950"
FT                   /locus_tag="Cfla_0085"
FT   CDS_pept        107448..108083
FT                   /locus_tag="Cfla_0085"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mbn:Mboo_1440 PKD domain-containing protein"
FT                   /db_xref="GI:296127954"
FT                   /db_xref="GeneID:9143950"
FT                   /translation="MKNHGAGIIASAAAVVAISVLAIPAAANPSLPGGSDAPQASVTEA
FT                   DGSVLVTGGRTQSKDPTAWNYVEPTRSFGTAGSVPMDASGVGYTSPFQYEFHGLMLGIP
FT                   TGIIGHQVYGSGLTVTSESANWGPTLTGTPAQICNYQWQFQNRYGSRHYSTLIQPLQEG
FT                   CWTTLGFKGNFDARYTASHKRTMKTGLLCARLYVNGTFRGEQCHNVYP"
FT                   /protein_id="YP_003635204.1"
FT   gene            108278..109168
FT                   /db_xref="GeneID:9143951"
FT                   /locus_tag="Cfla_0086"
FT   CDS_pept        108278..109168
FT                   /locus_tag="Cfla_0086"
FT                   /gene_family="HOG000068666" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01904"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF72"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF72; KEGG:
FT                   sen:SACE_3121 hypothetical protein"
FT                   /db_xref="GI:296127955"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="GeneID:9143951"
FT                   /translation="MTGVGAVRIGISGWRYAPWRGVFYPPGLPQRRELEHAAQLLGSIE
FT                   INGSFYSLQRPDSYRAWRDATPEGFVFAVKRPRFVTHMKKLAGVETPLANFFASGVLAL
FT                   EDRTGPVLWQLPPNLGFDPERLARFFDLLPRSTGAAAELAGRHDDKVPEGRALTSVEVD
FT                   RPLRHVLEVRHASFVDPAFPELLRAHDVGLVVADTAGRWPHLEDLTSDVVYVRLHGDSE
FT                   LYVSGYDDDALDAWAAKVRAWSTGAPPPDGPRVAAPADDHPRDVHVYFDNDVKVRAPFD
FT                   AMALAARVNAGVPLT"
FT                   /protein_id="YP_003635205.1"
FT   misc_feature    108344..109144
FT                   /note="Protein of unknown function DUF72; Region: DUF72;
FT                   cl00777"
FT                   /db_xref="CDD:174384"
FT                   /locus_tag="Cfla_0086"
FT   gene            109201..109575
FT                   /db_xref="GeneID:9143952"
FT                   /locus_tag="Cfla_0087"
FT   CDS_pept        109201..109575
FT                   /locus_tag="Cfla_0087"
FT                   /gene_family="HOG000098333" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:AAur_4143"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aau:AAur_4143 hypothetical protein"
FT                   /db_xref="GI:296127956"
FT                   /db_xref="GeneID:9143952"
FT                   /translation="MQCPVDQNQLVMTERQGVEIDYCPSCRGIWLDRGELDKIIDRAGA
FT                   TVAGERPAPAAPGVPAYGTPDPRGYEVRDDRPRYVERDDRGYERGYDDRRRDDHRGYER
FT                   GYDGRKRKKRESWLEDLFDF"
FT                   /protein_id="YP_003635206.1"
FT   misc_feature    109201..109569
FT                   /note="Uncharacterized protein conserved in bacteria
FT                   [Function unknown]; Region: COG3809"
FT                   /db_xref="CDD:33603"
FT                   /locus_tag="Cfla_0087"
FT   gene            109768..110391
FT                   /db_xref="GeneID:9143953"
FT                   /locus_tag="Cfla_0088"
FT   CDS_pept        109768..110391
FT                   /locus_tag="Cfla_0088"
FT                   /gene_family="HOG000264381" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, TetR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG: bcv:Bcav_2565
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="GI:296127957"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="GeneID:9143953"
FT                   /translation="MVEHTLPKGRRTREAVLARGVELACRVGLGGLTIGGLADEVGMSK
FT                   SGMYAHFGSKVALQLAVLDAAAEDFATTVVLPALRAPRGEPRVRALAERWIACGIERRP
FT                   GGCLFVKASTELDEQDGPVRDRLRDQHRQLADSIARIVAGGVTEGQFRADTDTAQFATD
FT                   LHGVMLGLYHGHRLLEDPAAEQHARTAIDRLLAAVRSSPRAGAP"
FT                   /protein_id="YP_003635207.1"
FT   misc_feature    109768..110373
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   AcrR; COG1309"
FT                   /db_xref="CDD:31500"
FT                   /locus_tag="Cfla_0088"
FT   misc_feature    109813..109932
FT                   /note="Bacterial regulatory proteins, tetR family; Region:
FT                   TetR_N; pfam00440"
FT                   /db_xref="CDD:144144"
FT                   /locus_tag="Cfla_0088"
FT   gene            110474..111409
FT                   /db_xref="GeneID:9143954"
FT                   /locus_tag="Cfla_0089"
FT   CDS_pept        110474..111409
FT                   /locus_tag="Cfla_0089"
FT                   /gene_family="HOG000050744" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /codon_start="1"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /transl_table="11"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bcv:Bcav_2566
FT                   hypothetical protein"
FT                   /db_xref="GI:296127958"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="GeneID:9143954"
FT                   /translation="MSAVDTSTTRTVAATQPPAPRRLPISQRVRLAVVRGRLRVLGVVA
FT                   PRAAGAAAFRIWCTLPGGPGRRKDHRPHPGEVTTLTAPRGGRVVVETWGEGPVVYLVHG
FT                   WGGWRGQLGAFVAPLVAAGHRVVAFDAPGHGDSDPGVLGPGRGTLVEAMEALEVVAAHH
FT                   GDAAAVVAHSMGSTVASMAVHEGAVRTGRLVLVAPNPDFADLRADFARTFRLTPRVRRL
FT                   LHAALEDFVQRPLSDFDLGPLGAAGGMPDTLVVHDLRDKETAFEVGRRVAEAWPTATLV
FT                   TTDGLGHQRILRDPATVELVVRDVTAPRPV"
FT                   /protein_id="YP_003635208.1"
FT   misc_feature    110705..>110887
FT                   /note="short chain dehydrogenase; Validated; Region:
FT                   PRK05855"
FT                   /db_xref="CDD:168274"
FT                   /locus_tag="Cfla_0089"
FT   misc_feature    110843..>111310
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176620"
FT                   /locus_tag="Cfla_0089"
FT   gene            complement(111419..112567)
FT                   /db_xref="GeneID:9143955"
FT                   /locus_tag="Cfla_0090"
FT   CDS_pept        complement(111419..112567)
FT                   /locus_tag="Cfla_0090"
FT                   /gene_family="HOG000268822" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ami:Amir_1841 hypothetical protein"
FT                   /db_xref="GI:296127959"
FT                   /db_xref="GeneID:9143955"
FT                   /translation="MHRTRPVIPLPVRPAAAGALVAALLALAGPAAAAAPVATAAAEGT
FT                   TTWTVQPATADGPDDRISLRHVLDPGESVAEHVTVTNFSTAPATFDVYAADGVVGDSGH
FT                   FDVPGAGATKDGGGWVTLGDAPGAERTETGLRLTIDPGAAVTVPLTIEVPGDATPGDHP
FT                   AGVVAELVTDDAVRLAARVGTRLHLRVTGDYVAALEPQDVVARWEPSWNPFAPGTVHVS
FT                   YRVANTGDVRLAAHAATELAGPFGAGGAEHRTELREVLPGQSGTVEAELRVWPLVRATG
FT                   QVATRPWVVGEDVVDAALRTGTAPVTVWTVPWAQLALVALVAGGVLGVRWQRRRAARVL
FT                   QERVDAALAAAGAAPTSDDAPTSGDGGDPSASDPATERATLP"
FT                   /protein_id="YP_003635209.1"
FT   misc_feature    complement(111749..>112189)
FT                   /note="Predicted membrane protein [Function unknown];
FT                   Region: COG1470"
FT                   /db_xref="CDD:31659"
FT                   /locus_tag="Cfla_0090"
FT   gene            complement(112639..115287)
FT                   /db_xref="GeneID:9143956"
FT                   /locus_tag="Cfla_0091"
FT   CDS_pept        complement(112639..115287)
FT                   /locus_tag="Cfla_0091"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00756"
FT                   /codon_start="1"
FT                   /product="putative esterase"
FT                   /transl_table="11"
FT                   /note="PFAM: putative esterase; KEGG: cpi:Cpin_4242
FT                   putative esterase"
FT                   /db_xref="GI:296127960"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="GeneID:9143956"
FT                   /translation="MVTGTALALGTAAVMAPPAAADGVAADPWVSVTPEGYYRFVAPQA
FT                   TVHELVGGQPKVVELQGNIGPAGTWSDLAMDPSGTDYPTQVGILDPGLYYYQYTATFED
FT                   RTKVSFRNPDTPVAIASKPTWNTFFVPGPQVAWMADIPNAGAVEELAHDTASGDEATSL
FT                   VWTPPGYDADRADAYPVLYLLADDDQSVDEWTELGRARQVLDNLAAEGRLADMVVVMAS
FT                   VTGDDARAELLDGILPAVQDAYHVADEAASQAVAGIGTGAAHALELLRTDPGVFSEVGA
FT                   FSVEFPSRPADPDRSQVAAINEGTDRLRIYVGNVLDPSYNATHDLLRTLERTGVEHEFD
FT                   GVDPDTGGTWDTWREGLRDFASRVFQDGAHGPREGHRPLDAKYTAPAPGSITLPHVDEN
FT                   GIVTFETGTQFKDAKDVTVWANWAPNGAWFRVPMTKVGDRWRVQAGPLDGFYYYRYVVD
FT                   GVDVKDPEDKVNTLTGVSPLFVPGETDRLLGDVPAEDRGELTTLTYQSQVANEERKAYV
FT                   WTPKGYDPDRAEEYPVLYLNHGGGQNYGDWVEVGRATQILDHYIKEDAIVPMVVVMGNG
FT                   NSSNYPAELMDNLVPAAEAAYNISSEPGQRAIAGLSMGAMNTLNAWLTRPGQFGWVGSF
FT                   SGGLFWNTPVFDPDAVNAETRLARIYNGDRTDFTYDATMNLLTLLEENGIRHEFAGLTV
FT                   GPHGFDVWSKNLIDFLPRIFRDQDKVTGIDLTAVVPEGQDGVLALSVAGNAVTLDGPQN
FT                   TGTALRFTGALPAVTVTDSRTAAQAGVSGWAVTGQAYSFTNGTRLLDAKHLGWTPRVES
FT                   PRPGLAAGDARATALGGGEGLTVPGRLASATPEGRVGSATIGADLVLDVPVDTAPGEYT
FT                   GTLSLSLFPVD"
FT                   /protein_id="YP_003635210.1"
FT   misc_feature    complement(114190..114891)
FT                   /note="Enterochelin esterase and related enzymes [Inorganic
FT                   ion transport and metabolism]; Region: Fes; COG2382"
FT                   /db_xref="CDD:32528"
FT                   /locus_tag="Cfla_0091"
FT   misc_feature    complement(<113299..113775)
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176620"
FT                   /locus_tag="Cfla_0091"
FT   misc_feature    complement(113149..113772)
FT                   /note="Putative esterase; Region: Esterase; pfam00756"
FT                   /db_xref="CDD:144380"
FT                   /locus_tag="Cfla_0091"
FT   gene            complement(115678..115851)
FT                   /db_xref="GeneID:9143957"
FT                   /locus_tag="Cfla_0092"
FT   CDS_pept        complement(115678..115851)
FT                   /locus_tag="Cfla_0092"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296127961"
FT                   /db_xref="GeneID:9143957"
FT                   /translation="MPGRALRGASAVVACSTLAARTVVEAVLHSLGPSSRRCADPPHVS
FT                   PCGTDPFGGHMR"
FT                   /protein_id="YP_003635211.1"
FT   gene            116415..119417
FT                   /db_xref="GeneID:9143958"
FT                   /locus_tag="Cfla_0093"
FT   CDS_pept        116415..119417
FT                   /locus_tag="Cfla_0093"
FT                   /gene_family="HOG000239369" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00461"
FT                   /codon_start="1"
FT                   /EC_number="1.4.4.2"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: glycine dehydrogenase; KEGG: glycine
FT                   dehydrogenase; PFAM: Glycine cleavage system
FT                   P-protein-like; aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase"
FT                   /db_xref="GI:296127962"
FT                   /db_xref="InterPro:IPR001597"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR020580"
FT                   /db_xref="GeneID:9143958"
FT                   /translation="MSVPAQSEPMPTEPTQSRHAPAAVPVSAPPASRTPAAEGFADRHV
FT                   GPRGDDTDRMLATLGFADLDALVDAAVPATIRSGRPLDLPAARSEERVLADLRAVASRN
FT                   RVLRPMIGQGYYGTTTPAVIRRNVLESPAWYTAYTPYQPEISQGRLEALLNFQTVVSDL
FT                   TGLDVANASLLDEATAVAEAVALMWRASRAATGTVVLDADLFGQSLAVTLGRAQAVGLP
FT                   VVVADLTDGLPDVDGPLVGVVVQQVGASGALRDLRPLVAAAKERGALVTVAADLLALTL
FT                   VTSPGELGADVAVGSAQRLGVPLFGGGPHAAFMAVRQGLERTLPGRLVGVSVDADGAPA
FT                   YRLALQTREQHIRREKATSNICTAQALLAIVASMYAVYHGPDGLRAIAQRVNGAARCLA
FT                   DVLRELGVEVVHADLFDTVRLRVPGRARAVQAAAVARGVNLWAPDDDHVQVACDETTTD
FT                   EDLLAVVLAVADAGATDLAANPDGSYDVGFVAHRRSRVPEHLARTTDYLTHPVFHVNRS
FT                   ETAMLRYLRRLSDKDLALDRTMIPLGSCTMKLNATAEMEPISWPEFADIHPYAPADQTQ
FT                   GYAALVTELQDWLAEITGYAAVSVQPNAGSQGELAGLLAIHAYHEATRAEGAEHRDICL
FT                   IPASAHGTNAASAALAGLKVVVVATAEDGEVDLADLRAKLDQHGPRVAAIMITYPSTHG
FT                   VYEEHVREVCDLVHAAGGQVYIDGANLNALVGLARPAELGGDVSHLNLHKTFCIPHGGG
FT                   GPGVGPVAVAAHLAPYLPGDPTPAGSPGTTAVAPVSAAPWGSAGILPISWAYVALMGPD
FT                   GLRRATETAVLAANYVAARLREHYPVLYTGPAGLVAHECILDLRPLTKATGVTAEDVAK
FT                   RLMDYGFHAPTLSFPVAGTLMVEPTESEDLAELDRFVDAMVAIRAEIEGVAEGRWPLES
FT                   SPLRQAPHTAAAVSADVWEHPYGREQAAFPVASLRTGKYWPPVRRIDGARGDRNLVCSC
FT                   PPVEAYADDVR"
FT                   /product="glycine dehydrogenase"
FT                   /protein_id="YP_003635212.1"
FT   misc_feature    116532..119405
FT                   /note="glycine dehydrogenase; Provisional; Region:
FT                   PRK05367"
FT                   /db_xref="CDD:168007"
FT                   /locus_tag="Cfla_0093"
FT   misc_feature    116682..117791
FT                   /note="Aspartate aminotransferase (AAT) superfamily (fold
FT                   type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine intermediate, which depending on
FT                   the reaction, is the...; Region: AAT_I; cl00321"
FT                   /db_xref="CDD:176816"
FT                   /locus_tag="Cfla_0093"
FT   misc_feature    order(116946..116951,116958..116960,117231..117233,
FT                   117240..117242,117300..117302,117309..117311)
FT                   /note="pyridoxal 5'-phosphate binding pocket; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="Cfla_0093"
FT   misc_feature    117309..117311
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="Cfla_0093"
FT   misc_feature    117966..119147
FT                   /note="Glycine cleavage system P-protein, alpha- and
FT                   beta-subunits. This family consists of Glycine cleavage
FT                   system P-proteins EC:1.4.4.2 from bacterial, mammalian and
FT                   plant sources. The P protein is part of the glycine
FT                   decarboxylase multienzyme complex EC:2...; Region: GDC-P;
FT                   cd00613"
FT                   /db_xref="CDD:99737"
FT                   /locus_tag="Cfla_0093"
FT   misc_feature    order(117966..117971,117981..117989,117996..118010,
FT                   118047..118049,118053..118055,118059..118073,
FT                   118080..118082,118089..118091,118107..118115,
FT                   118119..118127,118131..118133,118140..118148,
FT                   118152..118154,118230..118235,118263..118265,
FT                   118332..118343,118350..118355,118359..118364,
FT                   118395..118397,118500..118502,118641..118643,
FT                   118659..118679,118797..118805,118821..118823,
FT                   118833..118838,118860..118862,118869..118871,
FT                   118884..118886,118890..118892,118914..118916,
FT                   118950..118952,119025..119027,119103..119108,
FT                   119115..119120)
FT                   /note="tetramer interface; other site"
FT                   /db_xref="CDD:99737"
FT                   /locus_tag="Cfla_0093"
FT   misc_feature    order(118044..118046,118227..118232,118239..118241,
FT                   118335..118337,118341..118343,118563..118565,
FT                   118635..118637,118641..118646)
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:99737"
FT                   /locus_tag="Cfla_0093"
FT   misc_feature    118644..118646
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99737"
FT                   /locus_tag="Cfla_0093"
FT   gene            119414..120619
FT                   /db_xref="GeneID:9143959"
FT                   /locus_tag="Cfla_0094"
FT   CDS_pept        119414..120619
FT                   /locus_tag="Cfla_0094"
FT                   /gene_family="HOG000239381" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00528"
FT                   /codon_start="1"
FT                   /product="glycine cleavage system T protein"
FT                   /transl_table="11"
FT                   /note="KEGG: glycine cleavage system T protein; TIGRFAM:
FT                   glycine cleavage system T protein; PFAM: glycine cleavage T
FT                   protein (aminomethyl transferase); Glycine cleavage
FT                   T-protein barrel"
FT                   /db_xref="GI:296127963"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="GeneID:9143959"
FT                   /translation="MTGPTTPTTDPGAPMTELRSPLHDEHVALGASLTEFAGWQMPLRY
FT                   TSDLAEHTAVRNAAGLFDLSHMGEIEVTGPDAGAFLDRALVGNLTALRVLGARYTMIVQ
FT                   PDGGVIDDLVVYRTGDDTYLVVANASNHEVVLAELQERAAATGLGLTVTDRSAATALVA
FT                   VQGPRALAVVEALDLLTADPAGPADVTPATLKYYACLPMRFDGAPVLVARTGYTGEDGF
FT                   EFFLDADGAPALWRALLAAGAEHGLVPAGLSARDSLRLEAGMPLYGNELDRTTTPYDAG
FT                   LGRIVRLDKVDADGVPLPFVGRDALDARAHSAPARVLVGLQGLSRRAARHGYDVLASTQ
FT                   QDAPVVGTVTSGAPSPTLGYPVAMAYVTPEVGAEGAELAVDVRGRREPVRVVPLPFYRR
FT                   PR"
FT                   /protein_id="YP_003635213.1"
FT   misc_feature    119465..120616
FT                   /note="glycine cleavage system aminomethyltransferase T;
FT                   Reviewed; Region: gcvT; PRK00389"
FT                   /db_xref="CDD:166930"
FT                   /locus_tag="Cfla_0094"
FT   misc_feature    120311..120547
FT                   /note="Glycine cleavage T-protein C-terminal barrel domain;
FT                   Region: GCV_T_C; pfam08669"
FT                   /db_xref="CDD:149654"
FT                   /locus_tag="Cfla_0094"
FT   gene            120682..121053
FT                   /db_xref="GeneID:9143960"
FT                   /locus_tag="Cfla_0095"
FT   CDS_pept        120682..121053
FT                   /locus_tag="Cfla_0095"
FT                   /gene_family="HOG000239392" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00527"
FT                   /codon_start="1"
FT                   /product="glycine cleavage system H protein"
FT                   /transl_table="11"
FT                   /note="KEGG: glycine cleavage system H protein; TIGRFAM:
FT                   glycine cleavage system H protein; PFAM: glycine cleavage
FT                   H-protein"
FT                   /db_xref="GI:296127964"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="GeneID:9143960"
FT                   /translation="MAAELPTTLQYTAEHEWVDAASPVTVGITAVAADALGDIVFVELP
FT                   AVGSDVEAGAVVGEIESTKSVSELYSPVSGTVVEVNQAAVDDPSVVNSDPYGDGWLFRV
FT                   EVTTHGPLLSAEEYGALNP"
FT                   /protein_id="YP_003635214.1"
FT   misc_feature    120712..120993
FT                   /note="Glycine cleavage H-protein. Glycine cleavage
FT                   H-proteins are part of the glycine cleavage system (GCS)
FT                   found in bacteria, archea and the mitochondria of
FT                   eukaryotes. GCS is a multienzyme complex consisting of 4
FT                   different components (P-, H-, T- and L-...; Region: GCS_H;
FT                   cd06848"
FT                   /db_xref="CDD:133457"
FT                   /locus_tag="Cfla_0095"
FT   misc_feature    120871..120873
FT                   /note="lipoyl attachment site; other site"
FT                   /db_xref="CDD:133457"
FT                   /locus_tag="Cfla_0095"
FT   gene            121388..121624
FT                   /db_xref="GeneID:9143961"
FT                   /locus_tag="Cfla_0096"
FT   CDS_pept        121388..121624
FT                   /locus_tag="Cfla_0096"
FT                   /gene_family="HOG000097463" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /transl_table="11"
FT                   /note="KEGG: transcriptional regulator, LuxR family; PFAM:
FT                   regulatory protein LuxR; SMART: regulatory protein LuxR"
FT                   /db_xref="GI:296127965"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="GeneID:9143961"
FT                   /translation="MTMLDTSLNPHILGTHSLTRRERVVLAELTEDVTLEEIATRLFVT
FT                   RNTVKSQVRSVYRKIGVSTRAEAVAWAEAHGIR"
FT                   /protein_id="YP_003635215.1"
FT   misc_feature    121439..121606
FT                   /note="C-terminal DNA-binding domain of LuxR-like proteins.
FT                   This domain contains a helix-turn-helix motif and binds
FT                   DNA. Proteins belonging to this group are response
FT                   regulators; some act as transcriptional activators, others
FT                   as transcriptional repressors...; Region: LuxR_C_like;
FT                   cd06170"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="Cfla_0096"
FT   misc_feature    order(121442..121450,121487..121495,121517..121522,
FT                   121526..121531,121535..121549,121580..121582)
FT                   /note="DNA binding residues"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="Cfla_0096"
FT   misc_feature    order(121475..121477,121481..121483,121487..121489,
FT                   121580..121588,121595..121597,121604..121606)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="Cfla_0096"
FT   gene            121787..122242
FT                   /db_xref="GeneID:9143962"
FT                   /locus_tag="Cfla_0097"
FT   CDS_pept        121787..122242
FT                   /locus_tag="Cfla_0097"
FT                   /gene_family="HOG000261967" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /codon_start="1"
FT                   /product="NUDIX hydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: NUDIX hydrolase"
FT                   /db_xref="GI:296127966"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="GeneID:9143962"
FT                   /translation="MTPVLVVAAAVVDDLDDPRLLLAARRATPASLAGRWEFPGGKVEP
FT                   GETPEEALHRELREELGVSVGLGVELLGPDGGAWQLSDRYVMRLWFAEVLEGGPEPLVE
FT                   HDELRWLPAGQWLDVPWLDADVRIVERLTEFVATFSRGERRSVGRSG"
FT                   /protein_id="YP_003635216.1"
FT   misc_feature    121877..122182
FT                   /note="The MutT pyrophosphohydrolase is a prototypical
FT                   Nudix hydrolase that catalyzes the hydrolysis of nucleoside
FT                   and deoxynucleoside triphosphates (NTPs and dNTPs) by
FT                   substitution at a beta-phosphorus to yield a nucleotide
FT                   monophosphate (NMP) and inorganic...; Region:
FT                   MutT_pyrophosphohydrolase; cd03425"
FT                   /db_xref="CDD:72883"
FT                   /locus_tag="Cfla_0097"
FT   misc_feature    order(121907..121912,121916..121918,121952..121954,
FT                   121961..121966,122042..122044,122096..122098,
FT                   122159..122161)
FT                   /note="active site"
FT                   /db_xref="CDD:72883"
FT                   /locus_tag="Cfla_0097"
FT   misc_feature    order(121907..121912,122036..122038,122042..122044,
FT                   122159..122161)
FT                   /note="8-oxo-dGMP binding site; other site"
FT                   /db_xref="CDD:72883"
FT                   /locus_tag="Cfla_0097"
FT   misc_feature    121907..121975
FT                   /note="nudix motif; other site"
FT                   /db_xref="CDD:72883"
FT                   /locus_tag="Cfla_0097"
FT   misc_feature    order(121952..121954,121961..121966)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:72883"
FT                   /locus_tag="Cfla_0097"
FT   gene            122453..122959
FT                   /db_xref="GeneID:9143963"
FT                   /locus_tag="Cfla_0098"
FT   CDS_pept        122453..122959
FT                   /locus_tag="Cfla_0098"
FT                   /gene_family="HOG000251751" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00011"
FT                   /codon_start="1"
FT                   /product="heat shock protein Hsp20"
FT                   /transl_table="11"
FT                   /note="PFAM: heat shock protein Hsp20; KEGG: pac:PPA0737 18
FT                   kDa antigen 2"
FT                   /db_xref="GI:296127967"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="GeneID:9143963"
FT                   /translation="MATRFDPFQEMDRVLAQVLASDRAAATMPMDLYRDGDHYVLHVDL
FT                   PGADPGTIDVSVDDRTLTIRAQRSPRTEHDVQWLAKERPVGTYARQLTVGRGLALDRIS
FT                   ATYDDGVLTLSVPVAEEAKPRRIEIQHGASAPSTITSRDTQTLEQPSADGPSLEQRADE
FT                   PATAG"
FT                   /protein_id="YP_003635217.1"
FT   misc_feature    122453..122842
FT                   /note="Molecular chaperone (small heat shock protein)
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones]; Region: IbpA; COG0071"
FT                   /db_xref="CDD:30420"
FT                   /locus_tag="Cfla_0098"
FT   misc_feature    122543..122803
FT                   /note="Alpha-crystallin domain (ACD) of
FT                   alpha-crystallin-type small(s) heat shock proteins (Hsps).
FT                   sHsps are small stress induced proteins with monomeric
FT                   masses between 12 -43 kDa, whose common feature is the
FT                   Alpha-crystallin domain  (ACD). sHsps are...; Region:
FT                   ACD_sHsps-like; cd06464"
FT                   /db_xref="CDD:107221"
FT                   /locus_tag="Cfla_0098"
FT   misc_feature    order(122543..122557,122576..122578,122582..122584,
FT                   122588..122593,122720..122722,122780..122785)
FT                   /note="putative dimer interface; other site"
FT                   /db_xref="CDD:107221"
FT                   /locus_tag="Cfla_0098"
FT   gene            complement(123159..124313)
FT                   /db_xref="GeneID:9143964"
FT                   /locus_tag="Cfla_0099"
FT   CDS_pept        complement(123159..124313)
FT                   /locus_tag="Cfla_0099"
FT                   /gene_family="HOG000223048" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /codon_start="1"
FT                   /product="aminotransferase class I and II"
FT                   /transl_table="11"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   sco:SCO0731 transferase"
FT                   /db_xref="GI:296127968"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="GeneID:9143964"
FT                   /translation="MGSPFDVTPAELRRRTSLKWHTYPEDVLPAFVAEMDVQPLEAVVT
FT                   AVTKAMRDGDTGYEVGPTSPRGTAYAEAFAQFAARRHGWDVPVERTRMVPDVMLGIVEV
FT                   VALLTRPGDRVVINPPVYPPFRSFLEHAGRRVVTAPLTPTGRLDLDALDRAFAGASVHL
FT                   LCHPHNPTGTLHTADELGAVRDLAARHDVRVVADEIHAPLTLGDEPFVPTTTIIPDAIA
FT                   LHSASKAFNLAGLKAALAVPGPAADELRDMPEIVGHGVSHVASIAHQAAYREGDAWLDD
FT                   VRQTIRAHGDLVAQTLVERLPQARWHRPAATYFAWLDVRETPAVVATGTDPARLLLHEG
FT                   RLAVNAGPTFGDEGAGHVRLNLATPTPILRDALDRLVTTLAAPV"
FT                   /protein_id="YP_003635218.1"
FT   misc_feature    complement(123171..124241)
FT                   /note="aspartate aminotransferase; Provisional; Region:
FT                   PRK06108"
FT                   /db_xref="CDD:168398"
FT                   /locus_tag="Cfla_0099"
FT   misc_feature    complement(123186..124220)
FT                   /note="Aspartate aminotransferase family. This family
FT                   belongs to pyridoxal phosphate (PLP)-dependent aspartate
FT                   aminotransferase superfamily (fold I). Pyridoxal phosphate
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine...; Region: AAT_like; cd00609"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Cfla_0099"
FT   misc_feature    complement(order(123606..123608,123630..123635,
FT                   123639..123641,123714..123716,123807..123809,
FT                   123948..123950,124020..124028))
FT                   /note="pyridoxal 5'-phosphate binding site; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Cfla_0099"
FT   misc_feature    complement(order(123513..123515,123522..123524,
FT                   123606..123614,123735..123737,123918..123920,
FT                   124017..124019))
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Cfla_0099"
FT   misc_feature    complement(123630..123632)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99734"
FT                   /locus_tag="Cfla_0099"
FT   gene            complement(124352..125416)
FT                   /db_xref="GeneID:9143965"
FT                   /locus_tag="Cfla_0100"
FT   CDS_pept        complement(124352..125416)
FT                   /locus_tag="Cfla_0100"
FT                   /gene_family="HOG000101884" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Lxx17710"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: lxx:Lxx17710 hypothetical protein"
FT                   /db_xref="GI:296127969"
FT                   /db_xref="GeneID:9143965"
FT                   /translation="MRWVGGEAARNLLSGTTHALRYALVLALVLGALVAAEVATVDELL
FT                   TRAAAYRASGGSVLTLEAVGQVDGRACEAIGELPGVRAAGALRTRTEPLVSTLLPRGPV
FT                   AAYSVTPGLLEVVGARQVATPGVVLADDVAESLGLSARSTLVTTAGTTTVRGTYAWPDD
FT                   GRRAGFGYAALVPDDTGVPYDQCWVEAWPVPTDLANVLRSTLLPAPDGMSEVRSSRLNT
FT                   SLGAHFDGEALYTGRVTRYAAVAGLVAGLLVGLASALGRRLELASARHVGVTRRAQHAQ
FT                   VLVESSVWVLAGGVLAGAAAAATIARAGGHDDGALVLAAAHVVVPGLLGALLGPQLAVA
FT                   VTQESHLFRYFKSR"
FT                   /protein_id="YP_003635219.1"
FT   gene            complement(125413..126045)
FT                   /db_xref="GeneID:9143966"
FT                   /locus_tag="Cfla_0101"
FT   CDS_pept        complement(125413..126045)
FT                   /locus_tag="Cfla_0101"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bln:Blon_0514 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="GI:296127970"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9143966"
FT                   /translation="MRVVVQDLGHRFPGQPFLFRHLDVVLEPDGVYALTGPSGSGKSTL
FT                   MSLLAGWHEPTEGQVRRTGVERTGWVFQNPHGVARRTAVDHVVLPLLTQGMTRADATAR
FT                   AHRLLADFELAAVARRDFAALSGGEAQRLMLARGVAARPDLLLVDEPTAQLDPATAAAV
FT                   NATLRTLADRGTIVVVATHDPATRAACTTTVDLTAWADHGTADGRAS"
FT                   /protein_id="YP_003635220.1"
FT   misc_feature    complement(125494..126039)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Cfla_0101"
FT   misc_feature    complement(125497..126012)
FT                   /note="cobalt transport protein ATP-binding subunit;
FT                   Region: cbiO; TIGR01166"
FT                   /db_xref="CDD:130234"
FT                   /locus_tag="Cfla_0101"
FT   misc_feature    complement(125917..125940)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0101"
FT   misc_feature    complement(order(125500..125502,125596..125601,
FT                   125827..125829,125914..125922,125926..125931))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0101"
FT   misc_feature    complement(125827..125838)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0101"
FT   misc_feature    complement(125644..125673)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0101"
FT   misc_feature    complement(125596..125613)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0101"
FT   misc_feature    complement(125578..125589)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0101"
FT   misc_feature    complement(125494..125514)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0101"
FT   gene            complement(126049..127098)
FT                   /db_xref="GeneID:9143967"
FT                   /locus_tag="Cfla_0102"
FT   CDS_pept        complement(126049..127098)
FT                   /locus_tag="Cfla_0102"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:BAD_0485"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bad:BAD_0485 hypothetical protein"
FT                   /db_xref="GI:296127971"
FT                   /db_xref="GeneID:9143967"
FT                   /translation="MARSGPVAAASLAVLVALGAGLGVGVWLARPPVPTALENGGTLSV
FT                   SPVGERAWDDARTVTLTVTSQAEQSLTSLLSGRVTSSSCSPGAAVTSGTSVMGVDGAGL
FT                   LALATSVPLWRDLTTGDKGADAAALNAELTRLGHAAPHSDRVTRATVAAYRALAAAAGT
FT                   AAPTDGVVRAASVMWLPAPSITVATCPVRTGDVVAQGDPLVTLHAGQVATIGALPADAL
FT                   AGDRVLVVDGERVPVGTDGQVTETEALAAVLASSAYAGATPDDQGTRQLSLTWALRDPA
FT                   SVRVVPPSAVAGAGAGSTCLVATDGTPLPVQVVGSELGQTFVLPAGDGDPPVLPAQVQA
FT                   APAATTTCG"
FT                   /protein_id="YP_003635221.1"
FT   gene            complement(127123..127740)
FT                   /db_xref="GeneID:9143968"
FT                   /locus_tag="Cfla_0103"
FT   CDS_pept        complement(127123..127740)
FT                   /locus_tag="Cfla_0103"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Lxx17750"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: lxx:Lxx17750 hypothetical protein"
FT                   /db_xref="GI:296127972"
FT                   /db_xref="GeneID:9143968"
FT                   /translation="MTNLHHWCRVVGAAALGLVSAAALTACAGPASSDDEPAPTGRFTG
FT                   PWAAEFAAMNERFPSEFADAALADSVITEQEMLEGRGLVESCYTAAGYTVTFDEYGRAA
FT                   VTDPDGAGDSAPQAMGGCSSADGGVMILYYMVAANPENEDEMAIRAECLVEAGVVEQGF
FT                   TGEDLQKAYDSAELPWPTGDEVAQRCLLDPKGMISTTGTDEQ"
FT                   /protein_id="YP_003635222.1"
FT   gene            complement(127742..128152)
FT                   /db_xref="GeneID:9143969"
FT                   /locus_tag="Cfla_0104"
FT   CDS_pept        complement(127742..128152)
FT                   /locus_tag="Cfla_0104"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: lfe:LAF_0149 hypothetical protein"
FT                   /db_xref="GI:296127973"
FT                   /db_xref="GeneID:9143969"
FT                   /translation="MPDSSTTLCEAANPPVTGPHMRLISASTDVDASAGGEEVSTAARS
FT                   WKHATVSRIAVLALALAALGTAVQAQPAEAAGCTYSNLTSTRVYNKTCALGAYAYRSGN
FT                   TWYQAGDWVGTGKYSYNWSTVCYQYPGMLGIV"
FT                   /protein_id="YP_003635223.1"
FT   gene            complement(128341..130692)
FT                   /db_xref="GeneID:9143970"
FT                   /locus_tag="Cfla_0105"
FT   CDS_pept        complement(128341..130692)
FT                   /locus_tag="Cfla_0105"
FT                   /gene_family="HOG000246221" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01371"
FT                   /codon_start="1"
FT                   /EC_number="2.1.1.14"
FT                   /transl_table="11"
FT                   /note="TIGRFAM:5-
FT                   methyltetrahydropteroyltriglutamate/homocy
FT                   steineS-methyltransferase; KEGG: bcv:Bcav_0239 5-
FT                   methyltetrahydropteroyltriglutamate/homocystei neS-
FT                   methyltransferase; PFAM: Methionine synthase vitamin-B12
FT                   independent; Cobalamin-independent synthase MetE domain
FT                   protein"
FT                   /db_xref="GI:296127974"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="GeneID:9143970"
FT                   /translation="MTDTTPAAPATPAFPAGSVLGYPRIGPRRELKKALEAFWAGRTSA
FT                   DEVEAVAADLRRRTRTRLAELGLATDAAAIPSAFSFYDQVLDATALVGAVPERFADLQD
FT                   ADGRLDLAGYSTVARGRGDDLPLEMTKWFDTNYHYLVPEIGPGTTFRYASDRPVAEFTE
FT                   ALADGVLTRPVVVGPVTYLALAKPTEDAPAGFSPLDRLDDILPVYVRLLTELAAAGATW
FT                   VQLDEPALVADTVGVPAEVLAEATARAYRVLATELARPSRPAILLAAPYGDLGAALPVV
FT                   AATDVEGVALDLVRGDVPSVPVAGLAGKTVVGGVIDGHNIWRADLEQKLALLEQLGALG
FT                   AAAVAVGTSTSLFHVPHTLEDEPALDRTLVDWLAFADEKVREVATLAEGLTAGRDAISE
FT                   QLAAASQAVASRATAPGVVRPEVRERVAALTDEQFRRGPFAERKAAQAARLGLPALPTT
FT                   TIGSFPQTPEIRKARAAFGKGELTAEQYEDEMKAEVRRVVELQEQIGLDVLVHGEPERN
FT                   DMVQYFAENLDGFSVTQNGWVQSYGSRCTRPSILWGDVSRPAPITVAWAQYAQSLTSKP
FT                   MKGMLTGPVTILAWSFVRDDQPLGDTANQVALALRDEIADLEAAGIGIVQVDEPAIREL
FT                   LPLREKDHAAYLDWSVRSFRLSTAGVRPETQIHTHLCYSEFGEIMEAIDGLDADVTSIE
FT                   AARSKMEILGDIAAAGYPRAVGPGVYDIHSPRVPSQDEVTELLTEAVRTIDVDQLWVNP
FT                   DCGLKTRRYEEVTPSLEHLVTATRTVRATL"
FT                   /product="5-methyltetrahydropteroyltriglutamate/homocystei
FT                   neS-methyltransferase"
FT                   /protein_id="YP_003635224.1"
FT   misc_feature    complement(128344..130641)
FT                   /note="5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   S-methyltransferase; Provisional; Region: PRK05222"
FT                   /db_xref="CDD:167931"
FT                   /locus_tag="Cfla_0105"
FT   misc_feature    complement(129526..130641)
FT                   /note="N-terminal domain_like. Many members have been
FT                   characterized as
FT                   5-methyltetrahydropteroyltriglutamate-homocysteine
FT                   methyltransferases, EC:2.1.1.14, mostly from bacteria and
FT                   plants. This enzyme catalyses the last step in the
FT                   production of methionine by...; Region:
FT                   CIMS_N_terminal_like; cd03312"
FT                   /db_xref="CDD:48147"
FT                   /locus_tag="Cfla_0105"
FT   misc_feature    complement(order(130279..130281,130285..130287,
FT                   130300..130302,130597..130599,130606..130608))
FT                   /note="THF binding site; other site"
FT                   /db_xref="CDD:48147"
FT                   /locus_tag="Cfla_0105"
FT   misc_feature    complement(128362..129327)
FT                   /note="C-terminal domain_like. Many members have been
FT                   characterized as
FT                   5-methyltetrahydropteroyltriglutamate-homocysteine
FT                   methyltransferases, EC:2.1.1.14, mostly from bacteria and
FT                   plants. This enzyme catalyses the last step in the
FT                   production of methionine by...; Region:
FT                   CIMS_C_terminal_like; cd03311"
FT                   /db_xref="CDD:48146"
FT                   /locus_tag="Cfla_0105"
FT   misc_feature    complement(order(128425..128430,128677..128679,
FT                   128683..128685,128809..128811,128815..128817,
FT                   129136..129138,129154..129156,129307..129315))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:48146"
FT                   /locus_tag="Cfla_0105"
FT   misc_feature    complement(order(128803..128805,128923..128925,
FT                   129055..129063))
FT                   /note="THF binding site; other site"
FT                   /db_xref="CDD:48146"
FT                   /locus_tag="Cfla_0105"
FT   misc_feature    complement(order(128428..128430,128611..128613,
FT                   128677..128679,128683..128685))
FT                   /note="zinc-binding site; other site"
FT                   /db_xref="CDD:48146"
FT                   /locus_tag="Cfla_0105"
FT   gene            complement(130689..131768)
FT                   /db_xref="GeneID:9143971"
FT                   /locus_tag="Cfla_0106"
FT   CDS_pept        complement(130689..131768)
FT                   /locus_tag="Cfla_0106"
FT                   /gene_family="HOG000246233" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.5.1.20"
FT                   /codon_start="1"
FT                   /EC_number="1.5.1.20"
FT                   /transl_table="11"
FT                   /note="KEGG: methylenetetrahydrofolate reductase (NAD(P)H);
FT                   PFAM: methylenetetrahydrofolate reductase"
FT                   /db_xref="GI:296127975"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="GeneID:9143971"
FT                   /translation="MSVVAETGTVPAAPSAPGRARAARRRAEQAGALDRPTVSFEFFPP
FT                   RNPDAAPRLWETVRAVETVEPDFVSVTYGASGKTRETTRAFVRRLLRETSLNPIAHLTC
FT                   VGTSRTEVSTIVEEFLDEGVRSFLALRGDPPVGQPDWRPHPEGVHTAAELVELLRDLEQ
FT                   RRCGRSPAQAVRARVRPLSVAVAAFPRGNHATGGTRAQDVQALLAKQEAGADFAISQLF
FT                   YDAEAYLGLVAEARQAGVTIPIVPGIIPTTDPARLLRVQELSGVPVPRHLLDLLGSTDD
FT                   PVERHRRGTQAGVDLVNAVLDGGAPGVHVYTFNKHEAALDLLDGADLLDGRRCAVTPHD
FT                   PSGGTPAGATATTPRGNLS"
FT                   /product="Methylenetetrahydrofolate reductase (NAD(P)H)"
FT                   /protein_id="YP_003635225.1"
FT   misc_feature    complement(130818..131657)
FT                   /note="Methylenetetrahydrofolate reductase (MTHFR).
FT                   5,10-Methylenetetrahydrofolate is reduced to
FT                   5-methyltetrahydrofolate by methylenetetrahydrofolate
FT                   reductase, a cytoplasmic, NAD(P)-dependent enzyme.
FT                   5-methyltetrahydrofolate is utilized by methionine...;
FT                   Region: MTHFR; cd00537"
FT                   /db_xref="CDD:29637"
FT                   /locus_tag="Cfla_0106"
FT   misc_feature    complement(order(130836..130838,131109..131111,
FT                   131115..131117,131142..131147,131154..131156,
FT                   131163..131165,131184..131186,131190..131192,
FT                   131205..131207,131211..131213,131316..131321,
FT                   131373..131381,131466..131468,131550..131552))
FT                   /note="FAD binding site; other site"
FT                   /db_xref="CDD:29637"
FT                   /locus_tag="Cfla_0106"
FT   gene            complement(132057..132275)
FT                   /db_xref="GeneID:9143972"
FT                   /locus_tag="Cfla_0107"
FT   CDS_pept        complement(132057..132275)
FT                   /locus_tag="Cfla_0107"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bja:blr3303 putative racemase"
FT                   /db_xref="GI:296127976"
FT                   /db_xref="GeneID:9143972"
FT                   /translation="MTNHVEHDGRRDAVRAAHAAWLSPGESDPYVLEAVQDGLLAVPVA
FT                   APTTSWFGLPHQRTSRESTPTLQRRRR"
FT                   /protein_id="YP_003635226.1"
FT   gene            complement(132327..132920)
FT                   /db_xref="GeneID:9143973"
FT                   /locus_tag="Cfla_0108"
FT   CDS_pept        complement(132327..132920)
FT                   /locus_tag="Cfla_0108"
FT                   /gene_family="HOG000220753" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00624"
FT                   /codon_start="1"
FT                   /EC_number="3.2.2.20"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: DNA-3-methyladenine glycosylase I; KEGG:
FT                   kra:Krad_0999 DNA-3-methyladenine glycosylase I; PFAM:
FT                   methyladenine glycosylase"
FT                   /db_xref="GI:296127977"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="GeneID:9143973"
FT                   /translation="MTTTPPPFRCFGGTDPLYAAYHDDEWAVPVHDEHALYERISLEAF
FT                   QSGLSWITILRKRPAFRAAFAGFDPEAVAEYGEDDVARLLADEGIVRNRAKIEATVANA
FT                   RALLDLHATGRTLDEVLWSYAPEPRPRPRTWAEVPGRTAQSAALAKELKRLGFRFVGPT
FT                   TAYAAMQACGVVDDHLADCLVALGSPTARATPAE"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /protein_id="YP_003635227.1"
FT   misc_feature    complement(132375..132890)
FT                   /note="Methyladenine glycosylase; Region: Adenine_glyco;
FT                   cl01059"
FT                   /db_xref="CDD:174509"
FT                   /locus_tag="Cfla_0108"
FT   gene            133347..134537
FT                   /db_xref="GeneID:9143974"
FT                   /locus_tag="Cfla_0109"
FT   CDS_pept        133347..134537
FT                   /locus_tag="Cfla_0109"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02557"
FT                   /codon_start="1"
FT                   /product="peptidase M15B and M15C DD-carboxypeptidase
FT                   VanY/endolysin"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase M15B and M15C DD-carboxypeptidase
FT                   VanY/endolysin; KEGG: peptidase M15B and M15C
FT                   dd-carboxypeptidase VanY/endolysin"
FT                   /db_xref="GI:296127978"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="GeneID:9143974"
FT                   /translation="MTSITWASGHRLQPAAAERFEALNQAYRARFGTNISVTDSYRSYA
FT                   AQVALKEAKGKWAATPGCSNHGWGRAVDLGGGINRFGTDQYRWMLANASAYGWVAPRWA
FT                   RQDGSLPEPWHWEFPGSGVTSQPDAAPETPTYAARISALTSSSSLAVKEGPVNAVWLTV
FT                   LDGMELATTVTTPTRIAALSTSGELYVKAGAVNAPWALVARDVADFDVTDDRVVVALRS
FT                   GAAQLKEGPLSAQWVTIVAGGATDVEVAGTRIGALVNGAALVKEGAWDAPWVTLSGSVE
FT                   ELELDGSRVAIRKAGAVHVKEGALNAVWSTVFTGQPVDVELGGNRVAVRTADTLVVKEG
FT                   SLDAMWVTVATGGITDVAVTQDRVAMVSGGALAVKEGGLGAPWTTVSDKAKAVDLS"
FT                   /protein_id="YP_003635228.1"
FT   misc_feature    133371..133706
FT                   /note="D-alanyl-D-alanine carboxypeptidase; Region: VanY;
FT                   cl00813"
FT                   /db_xref="CDD:174403"
FT                   /locus_tag="Cfla_0109"
FT   gene            complement(134691..135479)
FT                   /db_xref="GeneID:9143975"
FT                   /locus_tag="Cfla_0110"
FT   CDS_pept        complement(134691..135479)
FT                   /locus_tag="Cfla_0110"
FT                   /gene_family="HOG000244339" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Mlut_16030"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mlu:Mlut_16030 hypothetical protein"
FT                   /db_xref="GI:296127979"
FT                   /db_xref="GeneID:9143975"
FT                   /translation="MTAPGGAAAAQDPDDGGLRIVGRLTAASNATFVGTLGDVAVVYKP
FT                   VAGERPLWDFPDGTLASREVATYLVSQALGWDVVPRTWWGDGPLGPGMLQLWQEPDTGQ
FT                   DPVDVVPAAAVPAPGWRTVLEGTDEHGSPVAVVHEDSAALRRMAVLDVLVNNADRKGGH
FT                   VLPVAGGHRYGVDHGVTFHTEPKLRTVLWGWVGEALDADETAGVRRVRVAVDGDLGAAL
FT                   SALLAADEVEAFAERCDRLLTTAVFPGPTGGAPPVPWPLF"
FT                   /protein_id="YP_003635229.1"
FT   misc_feature    complement(134694..135428)
FT                   /note="Phosphoinositide 3-kinase (PI3K)-like family,
FT                   catalytic domain; The PI3K-like catalytic domain family is
FT                   part of a larger superfamily that includes the catalytic
FT                   domains of other kinases such as the typical
FT                   serine/threonine/tyrosine protein kinases (...; Region:
FT                   PI3Kc_like; cl00119"
FT                   /db_xref="CDD:163723"
FT                   /locus_tag="Cfla_0110"
FT   gene            complement(135476..136015)
FT                   /db_xref="GeneID:9143976"
FT                   /locus_tag="Cfla_0111"
FT   CDS_pept        complement(135476..136015)
FT                   /locus_tag="Cfla_0111"
FT                   /gene_family="HOG000244350" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Mlut_16020"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mlu:Mlut_16020 hypothetical protein"
FT                   /db_xref="GI:296127980"
FT                   /db_xref="GeneID:9143976"
FT                   /translation="MTVHEFDWPDRVVVGTVGRPGERTFYLQVRTGGRATSVVLEKQQS
FT                   AALADLLEELLDDLSTDADHPVNVPLDTPLELVDEDPLDPPVDPLFRTGAMRLGWDPRT
FT                   LQVVVEAFPLEEAEDERLGEPDEPGQVLRVRMPVGTARAFVQRTRGVVTAGRPECPRCG
FT                   LPVDPDGHVCGPPDEA"
FT                   /protein_id="YP_003635230.1"
FT   misc_feature    complement(135497..136006)
FT                   /note="Protein of unknown function (DUF3090); Region:
FT                   DUF3090; cl12832"
FT                   /db_xref="CDD:164345"
FT                   /locus_tag="Cfla_0111"
FT   gene            complement(136035..136739)
FT                   /db_xref="GeneID:9143977"
FT                   /locus_tag="Cfla_0112"
FT   CDS_pept        complement(136035..136739)
FT                   /locus_tag="Cfla_0112"
FT                   /gene_family="HOG000221683" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /codon_start="1"
FT                   /product="Phosphoglycerate mutase"
FT                   /transl_table="11"
FT                   /note="KEGG: cmi:CMM_2218 hypothetical protein; PFAM:
FT                   Phosphoglycerate mutase; SMART: Phosphoglycerate mutase"
FT                   /db_xref="GI:296127981"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="GeneID:9143977"
FT                   /translation="MATVLLVRHGRTDANVRGVLAGRLPGVHLDDVGREQAGRTAERLA
FT                   AVPLVAVVTSPLERCRETTDLLLDRQGGSPGLTVDEALTECGYGDWQGRPLTELAAEPL
FT                   WATVQAHPAAVTFPGGESLPAMQARAVAAVRRCDAEVEAAHGPAAVWAAVSHGDVIKSV
FT                   LADALGMHLDLFQRLEVGPASVSVVRYGARRPHVVATNTDAGDLGWLATARPADDEPVG
FT                   GGAGHGSTAVRD"
FT                   /protein_id="YP_003635231.1"
FT   misc_feature    complement(136137..136733)
FT                   /note="Histidine phosphatase domain found in
FT                   phosphoglycerate mutases and related proteins, mostly
FT                   phosphatases; contains a His residue which is
FT                   phosphorylated during the reaction; Region: HP_PGM_like;
FT                   cd07067"
FT                   /db_xref="CDD:132718"
FT                   /locus_tag="Cfla_0112"
FT   misc_feature    complement(order(136269..136274,136563..136565,
FT                   136713..136718))
FT                   /note="catalytic core; other site"
FT                   /db_xref="CDD:132718"
FT                   /locus_tag="Cfla_0112"
FT   gene            complement(136777..141459)
FT                   /db_xref="GeneID:9143978"
FT                   /locus_tag="Cfla_0113"
FT   CDS_pept        complement(136777..141459)
FT                   /locus_tag="Cfla_0113"
FT                   /gene_family="HOG000247272" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01967"
FT                   /codon_start="1"
FT                   /product="ATP-dependent helicase HrpA"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: ATP-dependent helicase HrpA; PFAM:
FT                   helicase-associated domain protein; helicase domain
FT                   protein; protein of unknown function DUF1605; KEGG:
FT                   ATP-dependent helicase HrpA; SMART: DEAD-like helicase ;
FT                   AAA ATPase; helicase domain protein"
FT                   /db_xref="GI:296127982"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010222"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="GeneID:9143978"
FT                   /translation="MSTSDPTPAAAEGSRRADAASQPGTGSPRAGAAGGDGPRGRRRGG
FT                   RGRGPGRSGGARRDEGTADDTRRTKGADDTRRTEGADDTRRAGGAADDAGQRPRRDDRR
FT                   RRDDRTRPDRTRADARLARAAEARAQVVLPAIVYPEQLPVSARRQEIADAIRDHQVVVV
FT                   AGETGSGKTTQLPKIALELGRGRAGQIGHTQPRRIAARTVAERIADELGVPLGGVVGYQ
FT                   VRFTDESSDSTLVKVMTDGILLAQIQRDPMLRMYDTLIIDEAHERSLNIDFILGYLTRL
FT                   LPQRPDLKLVITSATIDSDRFARHFGSPATAAAEDRTPAPVVEVSGRTYPVEIRYQPLS
FT                   PDDGPDRDLVTGITEAVDELMAAGPGDVLVFLSGEREIRDAEDALRGSLGPRVTDPRHP
FT                   DGVEIVPLYARLSAAEQRRVFEAHTTRRVILATNVAETSLTVPGVRYVVDPGTARISRY
FT                   SKATKVQRLPIEPVSQASANQRSGRSGRVAPGIAIRLYSEEDFESRPEYTEPEILRTSL
FT                   ASVILQMIAVGVVTSPDEVVDFPFVDPPDVRAVRDGVALLTELHALEVQGGRTRLTETG
FT                   RALAQLPIDPRLARMVVEAGRRGVAREVLVIAAALSIQDPRERPAESRETADALHRRFA
FT                   DPSSDLLTYLNLWTYLRDRQRELSGSAFRRLCKAEHLHFLRVREWQDVVTQLRQMAKDL
FT                   GFEAKGAPTPASDEVPAAAGHGRDGRRDGGRHTPTGAPTQDAGSVERPDALQTRWTWDG
FT                   DAIHRALLPGLLSQIGMQVVTDVAAGAPAKGRDGKPRRPDSRARNEYLGARGARFAIFP
FT                   GSGLSRRPPSWVMAAELVETSRLWARDVAKVDPAWVEEAAAHLVKRTYADPAWSTRQGA
FT                   AMVNEKVLLYGVPVVAQRRVLLARIDPEHARELFVRHALVQGEWTTHHTFFHENRRLLA
FT                   EAEALAARARRRDLVVDDDALFDFYDARVPPEVVSARHFDRWWKDARRADPDLLSFTRE
FT                   LLVGDDAAEIDEGAFPSRWPQGELSFPLTYQFEPGTEADGVTVHVPISQLPRVRPEGFD
FT                   WMVPGMRAELLTATIRALPKPVRVQLVPAPDVARAVDAWLTEHAASWVDTVRAADAAPS
FT                   FREMFARAVRALRDVDVPADAVDEERLPAHLRMTFRVVGDRGGVVDEGKDLLALQRRNA
FT                   DRAQDAVASAVRTAVRAAMQEAAAQAGVTAPGTSSAARSASASSTPGTPTPDAPTPPGA
FT                   TTPPGARRHSSPTPATPGTPTPGASRRSSPEDVPDLERTGLTTWPDLPGALPDVVEARS
FT                   AAGGVVRAYPTLVEEGTTVALRVLADAGTADAGARRGLRRLLLLDVGLATARITTRWTG
FT                   AQALALAASPYRSTDALVTDVQLAAIDRIVSRHLGGRSPREVRDADAYATVRTHVRTHL
FT                   EDDVHRVVGDLVGVLGAWRELDADVRGVSSLALLATAQDVREQAAALVHDGFVRRVGAD
FT                   RLPQLVRYLRAARHRLAKAAENPTRDADLAWQVHDVEQQLDAARERAASAAPDPARDAA
FT                   LDDVRWLVEELRVSLFAQQLGTPVPVSPTRIRKALAAIGA"
FT                   /protein_id="YP_003635232.1"
FT   misc_feature    complement(140569..140985)
FT                   /note="DEAD-like helicases superfamily. A diverse family of
FT                   proteins involved in ATP-dependent RNA or DNA unwinding.
FT                   This domain contains the ATP-binding region; Region: DEXDc;
FT                   cd00046"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Cfla_0113"
FT   misc_feature    complement(140944..140958)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Cfla_0113"
FT   misc_feature    complement(140665..140676)
FT                   /note="putative Mg++ binding site; other site"
FT                   /db_xref="CDD:28927"
FT                   /locus_tag="Cfla_0113"
FT   misc_feature    complement(139975..140463)
FT                   /note="Helicase superfamily c-terminal domain; associated
FT                   with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation
FT                   factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this
FT                   domain is found in a wide variety of helicases and helicase
FT                   related proteins; may...; Region: HELICc; cd00079"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Cfla_0113"
FT   misc_feature    complement(order(140158..140166,140233..140238,
FT                   140332..140343))
FT                   /note="nucleotide binding region; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Cfla_0113"
FT   misc_feature    complement(order(140002..140004,140011..140013,
FT                   140023..140025,140140..140142))
FT                   /note="ATP-binding site; other site"
FT                   /db_xref="CDD:28960"
FT                   /locus_tag="Cfla_0113"
FT   misc_feature    complement(139525..139806)
FT                   /note="Helicase associated domain (HA2); Region: HA2;
FT                   cl04503"
FT                   /db_xref="CDD:156105"
FT                   /locus_tag="Cfla_0113"
FT   misc_feature    complement(138895..139260)
FT                   /note="Domain of unknown function (DUF1605); Region:
FT                   DUF1605; pfam07717"
FT                   /db_xref="CDD:149014"
FT                   /locus_tag="Cfla_0113"
FT   misc_feature    complement(<137950..138858)
FT                   /note="Domain of unknown function (DUF3418); Region:
FT                   DUF3418; pfam11898"
FT                   /db_xref="CDD:152334"
FT                   /locus_tag="Cfla_0113"
FT   misc_feature    complement(136786..>137685)
FT                   /note="Domain of unknown function (DUF3418); Region:
FT                   DUF3418; pfam11898"
FT                   /db_xref="CDD:152334"
FT                   /locus_tag="Cfla_0113"
FT   gene            141786..142013
FT                   /db_xref="GeneID:9143979"
FT                   /locus_tag="Cfla_0114"
FT   CDS_pept        141786..142013
FT                   /locus_tag="Cfla_0114"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:AAur_1577"
FT                   /codon_start="1"
FT                   /product="molybdopterin oxidoreductase domain-containing
FT                   protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aau:AAur_1577 molybdopterin oxidoreductase
FT                   domain-containing protein"
FT                   /db_xref="GI:296127983"
FT                   /db_xref="GeneID:9143979"
FT                   /translation="MTLLVVSIAVAAGVLTALAVVAARRRGSRGLVSAAVLGVPAAAFA
FT                   LSLVDRGTALTAFTAAAVVYVVTFVVCDVT"
FT                   /protein_id="YP_003635233.1"
FT   gene            142210..142521
FT                   /db_xref="GeneID:9143980"
FT                   /locus_tag="Cfla_0115"
FT   CDS_pept        142210..142521
FT                   /locus_tag="Cfla_0115"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rhi:NGR_b01090 putative ribose ABC
FT                   transporter"
FT                   /db_xref="GI:296127984"
FT                   /db_xref="GeneID:9143980"
FT                   /translation="MELLVLGAAMAAGLLTALAAAAARRRGSRAHALTVLAVVVALGYG
FT                   LSAVGRVTSLLVLTLATATYGLTYVLGDIRWGVRPAPADEVERELEAAFVDGGGASQA"
FT                   /protein_id="YP_003635234.1"
FT   gene            complement(142632..143630)
FT                   /db_xref="GeneID:9143981"
FT                   /locus_tag="Cfla_0116"
FT   CDS_pept        complement(142632..143630)
FT                   /locus_tag="Cfla_0116"
FT                   /gene_family="HOG000221623" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /codon_start="1"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /transl_table="11"
FT                   /note="KEGG: aau:AAur_3137 putative cobalt-zinc-cadmium
FT                   efflux permease; TIGRFAM: cation diffusion facilitator
FT                   family transporter; PFAM: cation efflux protein"
FT                   /db_xref="GI:296127985"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="GeneID:9143981"
FT                   /translation="MTQGAVEQSFRFGNTELPPEASEATRKAKRLAWLTIAFLVTAVTL
FT                   VYLVMGSSQAMKAAWAEDLLSFIPPIAFLVAMRVTGRVPSEQHPYGYHRSVGIGHLVAA
FT                   TALLTMGAFLVFDSVSGLVAGEHPPVGLIVVLGWEVWSGWLMIAVLAYTCVPAVLLGRA
FT                   KMPLAETLHDRVLHADADMNKADWMTAVGGIVGVLGIGVGLWWADSAAALFISASILRD
FT                   GLTNLRVAVTALMDARATTVDGSAPHPLDDRIDEVLRGLPWVREAGSRVRDEGHVFHVE
FT                   SFVVARDGMPTPEQLQEAWTVVTDLDWKVEDLVVVPVDELPEELLPGLRGR"
FT                   /protein_id="YP_003635235.1"
FT   misc_feature    complement(142749..143573)
FT                   /note="Cation efflux family; Region: Cation_efflux;
FT                   cl00316"
FT                   /db_xref="CDD:174105"
FT                   /locus_tag="Cfla_0116"
FT   gene            complement(143627..144118)
FT                   /db_xref="GeneID:9143982"
FT                   /locus_tag="Cfla_0117"
FT   CDS_pept        complement(143627..144118)
FT                   /locus_tag="Cfla_0117"
FT                   /gene_family="HOG000221624" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: aau:AAur_3138 putative lipoprotein"
FT                   /db_xref="GI:296127986"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="GeneID:9143982"
FT                   /translation="MTTTRRRPAHAALPLVVLILAACGVTVPTDPDGTLDTVRGGELRA
FT                   GVSPHEPWTQIGPDGAPTGLEVDLVEAFARTLDAEVVWTDGGEEELVADMERGDLDLVV
FT                   GGFSASTPWTSKAAVTVAYVTVTDPDGKPEGHVMLTPMGENAFLVELERFLLEQEVEAP
FT                   "
FT                   /protein_id="YP_003635236.1"
FT   misc_feature    complement(<143789..143965)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Cfla_0117"
FT   gene            complement(144155..144871)
FT                   /db_xref="GeneID:9143983"
FT                   /locus_tag="Cfla_0118"
FT   CDS_pept        complement(144155..144871)
FT                   /locus_tag="Cfla_0118"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bcav_1392"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcv:Bcav_1392 hypothetical protein"
FT                   /db_xref="GI:296127987"
FT                   /db_xref="GeneID:9143983"
FT                   /translation="MLNSLIVGVVLLNVLAAALVVARAPVYRTRLYRPMLLNLVLSAAP
FT                   LVVLGLAVVVLLPLLVVGTPRPVVWGIAGALGLVWLLLLPNSGYLITELNLNHRRAGER
FT                   VPEWYDVLLVLSLAMAGVATTVLNVFLVVLLGLLATGDDSAAALAQPWARAVETVLLVL
FT                   VAFGIYLGRHVRLNSWDVRHPRHLVRKVVGHLRSRGAMGNALGFTLVGALFLGLMYLVM
FT                   IGPVVTGLVEVERLRG"
FT                   /protein_id="YP_003635237.1"
FT   misc_feature    complement(144296..>144619)
FT                   /note="Protein of unknown function (DUF1361); Region:
FT                   DUF1361; cl01784"
FT                   /db_xref="CDD:154586"
FT                   /locus_tag="Cfla_0118"
FT   gene            complement(145032..145679)
FT                   /db_xref="GeneID:9143984"
FT                   /locus_tag="Cfla_0119"
FT   CDS_pept        complement(145032..145679)
FT                   /locus_tag="Cfla_0119"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:nfa31360"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: nfa:nfa31360 hypothetical protein"
FT                   /db_xref="GI:296127988"
FT                   /db_xref="GeneID:9143984"
FT                   /translation="MLPGGLAAGAMFLPDEVVGRGWALVAPDVELAGVAALAPASNPSA
FT                   LLAHLPDVSVGALFGAYLAEGYAATYDDERLADAVRPGARVVVQEMAQRCLAERGVVVS
FT                   VLTALLLDQPVWAQADPYTGAFGARLDENVPSGPIGAPLLVAQGSADSIVVASAQDEYV
FT                   AARCAAGYAVDHREYPGLDHVALVEADSPLVPELLAWTAEPLAGAEARNSCA"
FT                   /protein_id="YP_003635238.1"
FT   gene            146644..147156
FT                   /db_xref="GeneID:9143985"
FT                   /locus_tag="Cfla_0120"
FT   CDS_pept        146644..147156
FT                   /locus_tag="Cfla_0120"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gbr:Gbro_4818 hypothetical protein"
FT                   /db_xref="GI:296127989"
FT                   /db_xref="GeneID:9143985"
FT                   /translation="MLDELWPPPFPGPHQPRDAHAAHWGNDVRRRFGGTSAGAVSDDDL
FT                   WADLLRHEHAERRRATDDAWTADAADGHPHDVPEVRGTGSRPDRGARRGLPASWVPQEE
FT                   WIPDPVPPPEQRWTPEQDWLTAFADRPAGVLLLDPPAPRRWGRWVGLALAVVLPLAAVV
FT                   ALVVVLR"
FT                   /protein_id="YP_003635239.1"
FT   gene            147207..147725
FT                   /db_xref="GeneID:9143986"
FT                   /locus_tag="Cfla_0121"
FT   CDS_pept        147207..147725
FT                   /locus_tag="Cfla_0121"
FT                   /gene_family="HOG000262090" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04073"
FT                   /codon_start="1"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /transl_table="11"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: bcv:Bcav_1027 YbaK/prolyl-tRNA synthetase associated
FT                   region"
FT                   /db_xref="GI:296127990"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="GeneID:9143986"
FT                   /translation="MSDTPAGPTAVPDAELRTDGERRTVEALDAAGVAYVRTRHGRVGS
FT                   LAEAAAARGIEPADLVKTIVVRRGDDDFLLVLLPGDRTISWPKLRALLGVSRLSMPDAA
FT                   VAKDVTGFERGTITPFGTTRAWPVVVDERAAGRRVSIGGGGHGVGVELATDDLVRALGA
FT                   TVADVSEPG"
FT                   /protein_id="YP_003635240.1"
FT   misc_feature    147366..>147602
FT                   /note="YbaK-like.  The YbaK family of deacylase domains
FT                   includes the INS amino acid-editing domain of  the
FT                   bacterial class II prolyl tRNA synthetase (ProRS), and it's
FT                   trans-acting homologs, YbaK, ProX, and PrdX.  The primary
FT                   function of INS is to hydrolyze...; Region: YbaK_like;
FT                   cd04332"
FT                   /db_xref="CDD:88583"
FT                   /locus_tag="Cfla_0121"
FT   misc_feature    order(147390..147392,147549..147554)
FT                   /note="putative deacylase active site; other site"
FT                   /db_xref="CDD:88583"
FT                   /locus_tag="Cfla_0121"
FT   gene            147944..148294
FT                   /db_xref="GeneID:9143987"
FT                   /locus_tag="Cfla_0122"
FT   CDS_pept        147944..148294
FT                   /locus_tag="Cfla_0122"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01740"
FT                   /codon_start="1"
FT                   /product="anti-sigma-factor antagonist"
FT                   /transl_table="11"
FT                   /note="PFAM: Sulfate transporter/antisigma-factor
FT                   antagonist STAS; KEGG: anti-sigma-factor antagonist"
FT                   /db_xref="GI:296127991"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="GeneID:9143987"
FT                   /translation="MTELTAAIERTPEPADHEIRIEHRAGRAVVCLVGEIDASLRESAS
FT                   ASMGIALMSGLPLVVDASEATFVDSSGVAFVLQLHLAATEAGVPLTLQDPNRVLRDLLD
FT                   MVGLGAVIPDDV"
FT                   /protein_id="YP_003635241.1"
FT   misc_feature    147998..148282
FT                   /note="Sulphate Transporter and Anti-Sigma factor
FT                   antagonist) domain of anti-anti-sigma factors, key
FT                   regulators of anti-sigma factors by phosphorylation;
FT                   Region: STAS_anti-anti-sigma_factors; cd07043"
FT                   /db_xref="CDD:132914"
FT                   /locus_tag="Cfla_0122"
FT   misc_feature    order(148046..148048,148052..148060,148064..148066,
FT                   148142..148144,148148..148156,148160..148168,
FT                   148175..148180,148244..148246,148256..148261,
FT                   148265..148267)
FT                   /note="anti sigma factor interaction site; other site"
FT                   /db_xref="CDD:132914"
FT                   /locus_tag="Cfla_0122"
FT   misc_feature    148151..148153
FT                   /note="regulatory phosphorylation site; other site"
FT                   /db_xref="CDD:132914"
FT                   /locus_tag="Cfla_0122"
FT   gene            148366..149535
FT                   /db_xref="GeneID:9143988"
FT                   /locus_tag="Cfla_0123"
FT   CDS_pept        148366..149535
FT                   /locus_tag="Cfla_0123"
FT                   /gene_family="HOG000026260" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00619"
FT                   /codon_start="1"
FT                   /product="nuclease SbcCD, D subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: cmi:CMM_0677 putative dsDNA exonuclease
FT                   subunit; TIGRFAM: nuclease SbcCD, D subunit; PFAM:
FT                   metallophosphoesterase"
FT                   /db_xref="GI:296127992"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="GeneID:9143988"
FT                   /translation="MRLLHTSDWHLGRTLHGVDLLDHQASFLDHLVDVVRSERVAAVVV
FT                   AGDVYDRAIPPVEAVTLLSDTLARLAEHTTVVVTSGNHDSATRLGFGSALMRERVRLRT
FT                   RVASLGEPVEVAGALVYGLPYLDPDVCRAELAPVAGDGARTLLPRSHEAVTRAALARVQ
FT                   ADVATRRGGTRPRVVVAAHAFVVGGRASESERDIRVGGVDHVPADVFAGADYVALGHLH
FT                   GPQVVDGPAGTVLRYSGSPLAYSFSEQHHAKSSVLVDLSGDAPVTTLVAAPVPRRLADV
FT                   TGTLDDLLGAAGEPHVDDWVRVTVTDTARPADLFRRVRQRFPHALVVQHRPEHPDAGRE
FT                   RTVLVNAAADPVVVAADFVAHVTGARPTAAELAVLRAAHEHVAAAERSA"
FT                   /protein_id="YP_003635242.1"
FT   misc_feature    148369..149106
FT                   /note="Mre11 nuclease, N-terminal metallophosphatase
FT                   domain; Region: MPP_Mre11_N; cd00840"
FT                   /db_xref="CDD:163616"
FT                   /locus_tag="Cfla_0123"
FT   misc_feature    order(148387..148389,148393..148395,148507..148509,
FT                   148609..148614,148816..148818,149023..149031)
FT                   /note="active site"
FT                   /db_xref="CDD:163616"
FT                   /locus_tag="Cfla_0123"
FT   misc_feature    order(148387..148389,148393..148395,148507..148509,
FT                   148609..148611,148816..148818,149023..149025,
FT                   149029..149031)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:163616"
FT                   /locus_tag="Cfla_0123"
FT   misc_feature    order(148399..148419,148516..148518,148618..148620,
FT                   148624..148629,148741..148746)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:163616"
FT                   /locus_tag="Cfla_0123"
FT   misc_feature    149071..>149343
FT                   /note="Type 5 capsule protein repressor C terminal; Region:
FT                   SbcD_C; pfam12320"
FT                   /db_xref="CDD:152755"
FT                   /locus_tag="Cfla_0123"
FT   gene            149535..152675
FT                   /db_xref="GeneID:9143989"
FT                   /locus_tag="Cfla_0124"
FT   CDS_pept        149535..152675
FT                   /locus_tag="Cfla_0124"
FT                   /gene_family="HOG000026149" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:CMM_0676"
FT                   /codon_start="1"
FT                   /product="putative exonuclease"
FT                   /transl_table="11"
FT                   /note="KEGG: cmi:CMM_0676 putative exonuclease"
FT                   /db_xref="GI:296127993"
FT                   /db_xref="GeneID:9143989"
FT                   /translation="MRLRSLTVQAIGPFAGRHTVDLDALGQSGLFLLEGPTGSGKSTLI
FT                   DAVVFALYGKVAGTDASDERLRSAYAADDVESVVDLVFEVPSGVYRVRRTPAYRRAKRR
FT                   GEGTTTAQASVKAWRLPADVELGEDPEELDGVGVLLGTRLDEVGHELQRIVGLDRTQFV
FT                   QTVVLPQGEFARFLRATGEERRVLLQKIFGTQVYEQLQQRLAALRAEAARTVEAARAGL
FT                   GEAVAHLLGACALGPEEHAAARVALDEAVAGGPGVAVRVAGVVVATTRALDAAAGTLAQ
FT                   EAASARTSWDAARAAHEAARATAALAARRDALRAERRALDAAAGQHEDDVQRLARARAA
FT                   AAVRPLLTGWQDARTAHEAGTKSLVAACDTAPADLLPPGGAAVLVVGGRDGGPGPDAGG
FT                   TERLDGVLDAWRPHLRAERDAAADAAAALRRTVEVEAGLTERRRAVRELAAVLEELRSE
FT                   VDAATTWLAGRPGSRAALEQERDAARALAGRSDAAEQARTAARALVADVAALTAARADL
FT                   AAAQDAVAGGADAARAAVAAEASLRAARVAGLAGELAAGLVAGDPCPVCGACEHPAPAS
FT                   VGADHVTAEQVRAAEEARAAAESQLAALGARRAALAERVAGLAARVGEHDAGAAAALLR
FT                   AAEDDVAAAAAAHARVATLEADLTAHDAATRDRAQVREEVLGQVRAAELTLETERDALG
FT                   RAEAEVADARADHPTVAARHAALDARARQAVALLDALDTERAAAADEQRRHAELDAALA
FT                   EHGFADVADARGAWCPATELADLERRVVARTADEARVDAGLADPALVALPEDVAPDLAG
FT                   TEGAERAARRSADDLEGRARVAAARAEAAADAAARVRAAAEALDAAAAAAAPVTRMANL
FT                   ASGTGADNPHALSLATYVLGRRFEDVVAAANERLAVMSDGRFELVRSDEKEDVRTRAVG
FT                   LAMRVVDHRTERARDPRTLSGGETFYVSLCLALGMADVVTAEAGGVELGTLFVDEGFGA
FT                   LDPHVLDQVLAELGRLRHGGRVVGIVSHVETLKQAVADRIEVRPTPAGPSTLTVLAG"
FT                   /protein_id="YP_003635243.1"
FT   misc_feature    149535..>150068
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Cfla_0124"
FT   misc_feature    149637..149660
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0124"
FT   misc_feature    order(149646..149651,149655..149663,150042..150044)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0124"
FT   misc_feature    150033..150044
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0124"
FT   misc_feature    <152361..152645
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Cfla_0124"
FT   misc_feature    152379..152408
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0124"
FT   misc_feature    152472..152489
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0124"
FT   misc_feature    152496..152507
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0124"
FT   misc_feature    152571..152591
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0124"
FT   gene            complement(152682..153098)
FT                   /db_xref="GeneID:9143990"
FT                   /locus_tag="Cfla_0125"
FT   CDS_pept        complement(152682..153098)
FT                   /locus_tag="Cfla_0125"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="GI:296127994"
FT                   /db_xref="GeneID:9143990"
FT                   /translation="MTWALLGAMSVIPTLLLCALWSLIPSDDETPPWRVALAQRLEHAA
FT                   QHLRRHHPKPYDPFLTLRVQQRLGAVANHVQRLEADDRTFARAERIIASQLAYDQLLAE
FT                   ACRLAGVEVRPAARGDAQERFREEVELAARGWTW"
FT                   /protein_id="YP_003635244.1"
FT   gene            153255..153938
FT                   /db_xref="GeneID:9143991"
FT                   /locus_tag="Cfla_0126"
FT   CDS_pept        153255..153938
FT                   /locus_tag="Cfla_0126"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bcav_3946"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcv:Bcav_3946 hypothetical protein"
FT                   /db_xref="GI:296127995"
FT                   /db_xref="GeneID:9143991"
FT                   /translation="MGVKAVVTGVVALGLVAVGAVVADGFARSSAEDDAAALLAQQLDV
FT                   EGTPQVRIDGFPFLTQLAARSLDDVHATATRVTLEGLAVTDVVVDATDVTLDPPHRAGT
FT                   ARLQATVPASSVQQVVEARADLEVAVDGDVLRAAGDLFGIPLTVALVPRVADGRMLVDV
FT                   QEVTLGAGTLRLEELPGDVAERLVGIEVPLDGLPDGVRLEDAVVVPDGVRFTATGTDVA
FT                   LEVVP"
FT                   /protein_id="YP_003635245.1"
FT   gene            154070..155704
FT                   /db_xref="GeneID:9143992"
FT                   /locus_tag="Cfla_0127"
FT   CDS_pept        154070..155704
FT                   /locus_tag="Cfla_0127"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01614"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, IclR family"
FT                   /transl_table="11"
FT                   /note="KEGG: hypothetical protein; PFAM: Transcriptional
FT                   regulator IclR ; regulatory protein IclR; SMART: regulatory
FT                   protein IclR"
FT                   /db_xref="GI:296127996"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="GeneID:9143992"
FT                   /translation="MLVVGAVVLAALMLPGVWHLLRHGLTIVHEAAHAGVAVLVGRRLS
FT                   GIRVHSDTSGLTVSRGRARGPGMVATVAAGYPGPALLGAAAAWLLSRGYALGVLWLLLL
FT                   VVVLVLLQIRNWYGLWAVLVSGVALVAVTLWAPAQVQTVVAAGLTWFFLLGAPRAVVEM
FT                   QVQRRRVRRRGGRDESDAGLLAGLTHVPAIVWVGAFLAVCGVLLAAGGAWLLAAWPVTG
FT                   ITYPPWADVPTCDPMCPSAASATAPGLPFSVCDSEAVSTPPEIEPHSGRNESLSLRRAL
FT                   ALLDVCARETDPTGLTAAEIGRRLGVHKSTVLRLAAPLLESELLRRDTTSGRFRLGPGA
FT                   LRLGHAYLSTLDVESVAAPSLDELARTTGCLTVLTVPDGLQSRIAGHRPAPGTAGRAVP
FT                   RLPSVVPLHCTAPGKAILSVAGTALLERAVAGGLRPVTPRSITDPGELRAEVLRTRRRG
FT                   FAVDDREFDPDVRAVAAPVLDHTGDVVAALAVVGPAARMSAAAVQEHARSVVLAARTVT
FT                   RRLGGAGLGPSAAAGGAAEDLRARRGA"
FT                   /protein_id="YP_003635246.1"
FT   misc_feature    154946..155611
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   IclR; COG1414"
FT                   /db_xref="CDD:31604"
FT                   /locus_tag="Cfla_0127"
FT   misc_feature    154946..155167
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Cfla_0127"
FT   misc_feature    155255..155611
FT                   /note="Bacterial transcriptional regulator; Region: IclR;
FT                   pfam01614"
FT                   /db_xref="CDD:144993"
FT                   /locus_tag="Cfla_0127"
FT   gene            complement(155708..156583)
FT                   /db_xref="GeneID:9143993"
FT                   /locus_tag="Cfla_0128"
FT   CDS_pept        complement(155708..156583)
FT                   /locus_tag="Cfla_0128"
FT                   /gene_family="HOG000240322" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09352"
FT                   /codon_start="1"
FT                   /product="Domain of unknown function DUF1994"
FT                   /transl_table="11"
FT                   /note="PFAM: Domain of unknown function DUF1994; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="GI:296127997"
FT                   /db_xref="InterPro:IPR018532"
FT                   /db_xref="GeneID:9143993"
FT                   /translation="MLPPVADLLTAERTTHPAGRGGDGGRRRGGLPPLRRRSRWHWVLV
FT                   LMLAVAAGLGVPVVAEAQAAARYPVTVEDLAAGRAALAALDVKGRAPRTGYDREAFGQA
FT                   WADVDRNGCDTRNDVLRRDLVDVVVDPATRDCVVLRGTLADPYTGSTIAFERGPRSAEV
FT                   QIDHVVALADAWQKGAHRWSRTKRAQFANDPANLLAVDGSTNQSKGAGDAATWLPPNKG
FT                   YRCAYALRQATVKAAYGLWVTPAEHDALTRAVGRCVVVGSEPTAWWPSEWLPAQWSPSD
FT                   WLPATWLRAG"
FT                   /protein_id="YP_003635247.1"
FT   misc_feature    complement(155840..156328)
FT                   /note="Domain of unknown function (DUF1994); Region:
FT                   DUF1994; pfam09352"
FT                   /db_xref="CDD:150128"
FT                   /locus_tag="Cfla_0128"
FT   gene            complement(156671..157153)
FT                   /db_xref="GeneID:9143994"
FT                   /locus_tag="Cfla_0129"
FT   CDS_pept        complement(156671..157153)
FT                   /locus_tag="Cfla_0129"
FT                   /gene_family="HOG000076673" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Noca_2686"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: nca:Noca_2686 hypothetical protein"
FT                   /db_xref="GI:296127998"
FT                   /db_xref="GeneID:9143994"
FT                   /translation="MDDATPRPTQRTADDGPDDRHVPPAGVDDATIAAVGGVTAAFEVV
FT                   EHARGMLYAFHRLVGRADLELQEALDDLEKAGHAELADRVRADVVGRNVLAGRWTFQVV
FT                   EDFDSGYHRAFAEAEQRVRDELTAGRRHVYEAQLKERERTHGRPGHEALPVDVPDA"
FT                   /protein_id="YP_003635248.1"
FT   gene            157293..158840
FT                   /db_xref="GeneID:9143995"
FT                   /locus_tag="Cfla_0130"
FT   CDS_pept        157293..158840
FT                   /locus_tag="Cfla_0130"
FT                   /gene_family="HOG000250622" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /codon_start="1"
FT                   /product="amino acid permease-associated region"
FT                   /transl_table="11"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   bcv:Bcav_2714 amino acid permease-associated region"
FT                   /db_xref="GI:296127999"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="GeneID:9143995"
FT                   /translation="MTATDAHQPGPRSILRRRSVETAMRAVDDPDRRLRRTLGAWDLAV
FT                   MGVAVAVGAGIFSVGATAAARYAGPSVIVSFLIAAVVCSLAIMCYAEFASTMPVAGSAY
FT                   TYSYTTMGEFIAWIIGWDLILEMLLAGAVIAKFWGVYLADALGLFGFDVPPTVVVAGAD
FT                   VSWGPVVIVALFTTLLAVGTRLSARVNSVFTIIKVGITLFVIVVGFFYVKAENWSPFVP
FT                   PSQPAEPGTSALEQPLTGFLLGLEPSTYGIMGILSGAALVFFAFIGFDVVATTAEETKD
FT                   PQRAVPRGILGGLALVTVLYVLVTVVVTGMVSYTELAASDAPSLTTAFVLVGADWAGRV
FT                   ISVGILVGLTSVLMVLLLGLTRVVFAMSRDGLLPRGVSRTSPRFGTPLRLQVGVGVVVA
FT                   LIAGLSEVELLEEMINIGTLSAFVLVCFGIPLLRRSRPDLPRGFRVPFSPVLPVVAGLA
FT                   CIWLMLNLTTLTWLRFLVWVVVGAVIYFSYSYRRSLLGRGVAATTDDEAAGEPTVTH"
FT                   /protein_id="YP_003635249.1"
FT   misc_feature    157392..158756
FT                   /note="Transmembrane amino acid transporter protein;
FT                   Region: Aa_trans; cl00524"
FT                   /db_xref="CDD:176584"
FT                   /locus_tag="Cfla_0130"
FT   misc_feature    157476..158822
FT                   /note="Amino acid transporters [Amino acid transport and
FT                   metabolism]; Region: PotE; COG0531"
FT                   /db_xref="CDD:30877"
FT                   /locus_tag="Cfla_0130"
FT   gene            158965..159432
FT                   /db_xref="GeneID:9143996"
FT                   /locus_tag="Cfla_0131"
FT   CDS_pept        158965..159432
FT                   /locus_tag="Cfla_0131"
FT                   /gene_family="HOG000273433" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:CMM_2104"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cmi:CMM_2104 hypothetical protein"
FT                   /db_xref="GI:296128000"
FT                   /db_xref="GeneID:9143996"
FT                   /translation="MTVFLVIGGIGLVVLLASLVFGDVFESFDIGEGGFSGIAAGVGAV
FT                   VFGSSGVIALAQDLDLVWAYVIGVAFAVVAFLVAQQLVKRLSDTEDAPPPPLDGAFGMT
FT                   TSTTGPGGGEVRLEGVRDLEARLAWAEEEIPAGTRVVVVGVSGSRVQVTRA"
FT                   /protein_id="YP_003635250.1"
FT   gene            159550..161025
FT                   /db_xref="GeneID:9143997"
FT                   /locus_tag="Cfla_0132"
FT   CDS_pept        159550..161025
FT                   /locus_tag="Cfla_0132"
FT                   /gene_family="HOG000240804" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /codon_start="1"
FT                   /product="band 7 protein"
FT                   /transl_table="11"
FT                   /note="KEGG: jde:Jden_2346 band 7 protein; PFAM: band 7
FT                   protein; SMART: band 7 protein"
FT                   /db_xref="GI:296128001"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="GeneID:9143997"
FT                   /translation="MFNVVEDGATILAVAALIIAFVAVIALITKRIRRVPPNEALIIVG
FT                   RGAGRGAAADAGQRVVVGGRVFVWPVLQQGFPISLEQRQIGITVEGVDKNRIKLAIKAS
FT                   INFKVRGDEEGVRRAAQRFLSQQATLTDVIKESLEGSLRSIIGDMTIEQIISDRKSLQD
FT                   AVVNSTKTDLAEQGLQVDLLNISDISTPGSDYLANLGRAEAARARQVAEVKEAEAQQVS
FT                   EFAKIVAMEAIAERQRDLALKQAAIKAETDRANAEANASGQLARAEQDKLVAAQEREAL
FT                   VEKARVTEEQLDIDVRKPAEARAYAAVQQATAERDAANAAAEADAYRRMKVAEANKIAT
FT                   VQDAEAAAEATIRAGNAERDRQLAEAKALEALGLARAAAAKAEGLAQAEATRAQAEALR
FT                   EQGEAVLAQQVIALLPEIVRAAAEPIGAIDQLTVVSTDGASGLTRTVGQVLGEGQEVIK
FT                   SLTGLDLNTLVASIADKAVAGRPVAGNGTPPQG"
FT                   /protein_id="YP_003635251.1"
FT   misc_feature    159640..>160422
FT                   /note="Uncharacterized protein conserved in bacteria
FT                   [Function unknown]; Region: COG2268"
FT                   /db_xref="CDD:32449"
FT                   /locus_tag="Cfla_0132"
FT   misc_feature    159781..160149
FT                   /note="Band_7_flotillin: a subgroup of the band 7 domain of
FT                   flotillin (reggie) like proteins. This subgroup contains
FT                   proteins similar to stomatin, prohibitin, flotillin, HlfK/C
FT                   and podicin.  These two proteins are lipid raft-associated.
FT                   Individual proteins...; Region: Band_7_flotillin; cd03399"
FT                   /db_xref="CDD:48211"
FT                   /locus_tag="Cfla_0132"
FT   gene            161576..163972
FT                   /db_xref="GeneID:9143998"
FT                   /locus_tag="Cfla_0133"
FT   CDS_pept        161576..163972
FT                   /locus_tag="Cfla_0133"
FT                   /gene_family="HOG000115568" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01055"
FT                   /codon_start="1"
FT                   /product="glycoside hydrolase family 31"
FT                   /transl_table="11"
FT                   /note="PFAM: glycoside hydrolase family 31; KEGG:
FT                   nml:Namu_4758 glycoside hydrolase family 31"
FT                   /db_xref="GI:296128002"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="GeneID:9143998"
FT                   /translation="MALPTLPTRPVADPAAVVQGDRYRITVLTEGLLRLEHSPDGTFED
FT                   RPSTFALHRQQPVPEFRVVDQGTHLEVVTRRMRLTYDKGPFTTSGLSVAVLGAVTTWHS
FT                   VWRYGQDDDGRNLGGTARTLDEADGAVPLEPGVVGRNGYAVIDDSSSLLLTDDGWVAPR
FT                   DDGRTDLYVFAYGHDHAEAVRALYAVSGAQPVLPRWALGNWWSRYHRYAADEYLALLTR
FT                   FRAAGLPFSVAVLDMDWHVTDVDPAISSGWTGYSWDREVFPDPRAFLAEVHRRGLRVTL
FT                   NVHPADGVGPHEDAYVAMCAALGLDPTDRDPVAFDVTDEAFLTAYLDVLHRGLEDDGVD
FT                   FWWIDWQQGSHSRVAGIDPLWMLNHFHFLDNARGGRRPLTFSRYAGPGSHRYPVGFSGD
FT                   AVVSWASLAFQPHFTAAAANIGYGWWSHDVGGHMFGAKDDELATRWVQLGVFSPILRLH
FT                   SSNNPFLTKEPWSFGPEHEAAQTAALRLRHRLVPYLHTMNHRAAREGVPLVTPMYHRWP
FT                   RHPEAYEVPGQVAFGSQLLVAPVTGPRDRESATAAVRAWLPDGVWVDVLTGLVYDGGRE
FT                   LVLHRDLTSVPVLAPAGALVPLDAADVPADDPVEPDALEVLVVVGADGGLTLVEDDGTG
FT                   DGLDEARVVRTPLTWDQAAGVLTVGPAAGATGVLPAVRTWTATFVSVAGGVAPVATIEG
FT                   GAVEPGVVRTADGHLRVTVADVPVGAVLRVGLGEAPELRPNDVAGRLHRLLDAAQVGFE
FT                   LKRRVLEVLTSDRPLHVRLAHLAALDVPASLRAAVEEVVLARASA"
FT                   /protein_id="YP_003635252.1"
FT   misc_feature    161618..163555
FT                   /note="Alpha-glucosidases, family 31 of glycosyl hydrolases
FT                   [Carbohydrate transport and metabolism]; Region: COG1501"
FT                   /db_xref="CDD:31690"
FT                   /locus_tag="Cfla_0133"
FT   misc_feature    162143..163018
FT                   /note="This family represents an uncharacterized glycosyl
FT                   hydrolase family 31 (GH31) enzyme found in bacteria and
FT                   eukaryotes that is related to the XylS xylosidase of
FT                   Sulfolobus solfataricus. Alpha-xylosidases catalyze the
FT                   release of an alpha-xylose residue...; Region:
FT                   GH31_xylosidase_XylS-like; cd06595"
FT                   /db_xref="CDD:133126"
FT                   /locus_tag="Cfla_0133"
FT   misc_feature    order(162281..162283,162608..162610,162722..162724,
FT                   162761..162763,162770..162772,162869..162871,
FT                   162947..162949)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:133126"
FT                   /locus_tag="Cfla_0133"
FT   misc_feature    order(162608..162610,162770..162772)
FT                   /note="putative catalytic site; other site"
FT                   /db_xref="CDD:133126"
FT                   /locus_tag="Cfla_0133"
FT   gene            164015..165277
FT                   /db_xref="GeneID:9143999"
FT                   /locus_tag="Cfla_0134"
FT   CDS_pept        164015..165277
FT                   /locus_tag="Cfla_0134"
FT                   /gene_family="HOG000244862" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /codon_start="1"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /transl_table="11"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: cmi:CMM_0804
FT                   putative prolyl aminopeptidase"
FT                   /db_xref="GI:296128003"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="GeneID:9143999"
FT                   /translation="MTGFRVREHRVEVPVDWSDPTRFGSIEVFAREVVDPQRAADDLPL
FT                   LLFLQGGPGGMSPRPAPGGWLATALRTHRVVLLDQRGTGRSSRVDGTDVAALGDAAGDH
FT                   LACFRADAVVADAEHLRRTVYGGRRWTTLGQSYGGFLTLTYLSRHPEALDACWVTGGLP
FT                   PVGATAEDVYAATYPRQAARNRALARAFPDDVDLLGRLADRVAAGDVVLPNRDVLTVER
FT                   LQTLGMDLGMSTGADGLHWLLDTALDRRGEPAPGFLAQVAARTGFDTNPLYLVLQEAIY
FT                   HSGPREPGWAAATEHARHPAFAAAARPLQLTGEAAYPWMFSQVSALRPFAAAAEALASR
FT                   TSWPELYDVDRLAANEVPVAAVQYYDDPYVDLDLALATDLGNSQVWVTNEFLHDGLRVA
FT                   GDTILPRLADLTAGRWTVTSR"
FT                   /protein_id="YP_003635253.1"
FT   misc_feature    164231..>164737
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176620"
FT                   /locus_tag="Cfla_0134"
FT   gene            complement(165304..165420)
FT                   /db_xref="GeneID:9144000"
FT                   /locus_tag="Cfla_0135"
FT   CDS_pept        complement(165304..165420)
FT                   /locus_tag="Cfla_0135"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296128004"
FT                   /db_xref="GeneID:9144000"
FT                   /translation="MDDERRTRRTARLLVWTGVVIALGAVVGLVYAIHPLVT"
FT                   /protein_id="YP_003635254.1"
FT   gene            complement(165628..165753)
FT                   /db_xref="GeneID:9144001"
FT                   /locus_tag="Cfla_0136"
FT   CDS_pept        complement(165628..165753)
FT                   /locus_tag="Cfla_0136"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="GI:296128005"
FT                   /db_xref="GeneID:9144001"
FT                   /translation="MNARSEAWNGRLRAMLALVALCAGLVVVATAGAATALLVAG"
FT                   /protein_id="YP_003635255.1"
FT   gene            166074..167756
FT                   /db_xref="GeneID:9144002"
FT                   /locus_tag="Cfla_0137"
FT   CDS_pept        166074..167756
FT                   /locus_tag="Cfla_0137"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00691"
FT                   /codon_start="1"
FT                   /product="OmpA/MotB domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: kra:Krad_2839
FT                   OmpA/MotB domain protein"
FT                   /db_xref="GI:296128006"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="GeneID:9144002"
FT                   /translation="MRPSRTRPAKHLTTLVVASALGLAACTGGSTDPDATPTPTVDPGP
FT                   QPEDVVATAVIPEAGMDLEVRVHPLVRAGEHVVLTVDVVPPEAPEDLVHLRGFGVTSFI
FT                   ASSWPPVNVRLMDLARDVVLHVGADSDGEPVVAPEDWSRFRTERGTRLQMPFAAPADDV
FT                   DALSLFFPGAPLFAQVPIIDGELPSAVHPDDVAAAEAAAATAAARASASPSATPDVEET
FT                   APPEELDLDAVVEAPVFPLESTTAELDGAVQTIESTEKVEVTLGSDVLFAFDSADLTPE
FT                   SADAVALVAQRLAEREAGSVEVVGHTDDQADDTYNLDLSRRRAQAVADALEAQVAGSGH
FT                   RMRVAGRGESEPVVPNDSEENRALNRRVTVSLTSKVVTRTDVTTTGELPPFGGVVGTAG
FT                   TPVRVESGSRVWEADATARRVHGHVVVDLTVHGADEEDGNHTAIGFMRGFGTHRLGDTI
FT                   APHENTARATVLQGATRLFPLDYRVGENEAYPDGEWFTASDLHAGHWVDGGQTRTYSFV
FT                   YPRLDVDTLAFQIGTGIAFDTDVRLLDVPVAPGDEVATPGPRD"
FT                   /protein_id="YP_003635256.1"
FT   misc_feature    166875..167189
FT                   /note="Peptidoglycan binding domains similar to the
FT                   C-terminal domain of outer-membrane protein OmpA; Region:
FT                   OmpA_C-like; cd07185"
FT                   /db_xref="CDD:143586"
FT                   /locus_tag="Cfla_0137"
FT   misc_feature    order(166890..166895,166992..166997,167004..167006,
FT                   167016..167021,167028..167030,167157..167159,
FT                   167169..167171)
FT                   /note="ligand binding site; other site"
FT                   /db_xref="CDD:143586"
FT                   /locus_tag="Cfla_0137"
FT   gene            167831..168601
FT                   /db_xref="GeneID:9144003"
FT                   /locus_tag="Cfla_0138"
FT                   /pseudo
FT   gene            168919..171483
FT                   /db_xref="GeneID:9144004"
FT                   /locus_tag="Cfla_0139"
FT   CDS_pept        168919..171483
FT                   /locus_tag="Cfla_0139"
FT                   /gene_family="HOG000021032" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00759"
FT                   /codon_start="1"
FT                   /product="glycoside hydrolase family 9"
FT                   /transl_table="11"
FT                   /note="KEGG: hut:Huta_2399 glycoside hydrolase family 9;
FT                   PFAM: glycoside hydrolase family 9; type 3a
FT                   cellulose-binding domain protein; cellulose-binding family
FT                   II; SMART: cellulose-binding family II"
FT                   /db_xref="GI:296128007"
FT                   /db_xref="InterPro:IPR001701"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR001956"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="GeneID:9144004"
FT                   /translation="MVAGLAAALCAGAVAQPAVAAAPTLTDEPYGNLAQALQTSLYFYD
FT                   AEMSGPSRSQGVQRLPWRGDSELADARIPLTSGGTGTDDLADEGTNLTPAMIEAYRDIL
FT                   DPDGDGTVDLSGGYHDAGDHVKFGLPQTYAAATLAWGLYEFPDAYEKAGAAEAIETHLR
FT                   WFADYFLRSTFRDADGDVVAFSYMVGRGGVDHTYWGPPELQDPAKFPRSATFAYEGAPA
FT                   SDQAAGAAAALTAVSLVTAEDDPQYAAECLDAAQALYDFARAHRGTGNGDGFYPSSFDD
FT                   DELAWAAVWLYDATGDETYLDHIVAKDSAGRYTGYLRKIINSAEDTWQNIWVHSWDTVW
FT                   GGVFARLAPLSKGVVPDSENQKYWYYFRWNAEYWTGGAVKHREAGDGTYVATSPSGWSV
FT                   ISTWGSARYNTAAQLQALTYRKYSHLDWGDPEVNEREGVALSQWALSQMNYLMGDNPLH
FT                   RSYVVGFTANDDDHHARFPHHRAAHGSDTNSMLVPAEHRHVLWGALVGGPDLADEHKDE
FT                   TTDYVYNEVAIDYNAGFVGALAGLVEYFGDGQPVETWEPAPEAEVDAYVVRAELEQENT
FT                   SRTQVTLEISNRSVHPPAEVDDLSLRYFFDISELQADAQTIDDVRVDVYYDEAKTLSGK
FT                   AVSIGEPVHVGDGLYYVEVSWDGIPFYGTREVQIGLIAGQNAQWTTTWDPTNDPSRQGI
FT                   GDDLALTTAVPVYRDGVLVFGEEPDGTTGPTPTPTPTVTPTPTATPTTTPTATPTPTPT
FT                   STTAAGCTARLEVRSTWPGGYEAQVHVTADRDLTRWTATTTLPAAVTVMQAWNGTVEAT
FT                   GTTLTVAPAAWNGAIAAGDTVSVGLIGSGTAPEAGALTCTAR"
FT                   /protein_id="YP_003635257.1"
FT   misc_feature    169012..170541
FT                   /note="hydrolase, hydrolyzing O-glycosyl compounds; Region:
FT                   PLN00119"
FT                   /db_xref="CDD:165688"
FT                   /locus_tag="Cfla_0139"
FT   misc_feature    169012..170535
FT                   /note="Glycosyl hydrolase family 9; Region: Glyco_hydro_9;
FT                   cl02959"
FT                   /db_xref="CDD:174742"
FT                   /locus_tag="Cfla_0139"
FT   misc_feature    171214..171474
FT                   /note="Cellulose binding domain; Region: CBM_2; cl02709"
FT                   /db_xref="CDD:155069"
FT                   /locus_tag="Cfla_0139"
FT   gene            complement(171583..172008)
FT                   /db_xref="GeneID:9144005"
FT                   /locus_tag="Cfla_0140"
FT   CDS_pept        complement(171583..172008)
FT                   /locus_tag="Cfla_0140"
FT                   /gene_family="HOG000246177" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00333"
FT                   /codon_start="1"
FT                   /product="NrdI protein"
FT                   /transl_table="11"
FT                   /note="KEGG: jde:Jden_0021 NrdI protein; TIGRFAM: NrdI
FT                   protein; PFAM: NrdI family protein"
FT                   /db_xref="GI:296128008"
FT                   /db_xref="InterPro:IPR004465"
FT                   /db_xref="GeneID:9144005"
FT                   /translation="MRPTPVYYYSSTSGLVRTFAERLDRPVFNLAEREHRRSEVDGPWV
FT                   LLTPSYKTGNDANDTVPEAVRRFLRSAHNRRLLVGVMGSGNRNFGRYYQKAAREIAQRS
FT                   GRPVLFEFELAGTPWDVEECERILRDLDTELARRHSA"
FT                   /protein_id="YP_003635258.1"
FT   misc_feature    complement(171607..171987)
FT                   /note="NADPH-dependent FMN reductase; Region: FMN_red;
FT                   cl00438"
FT                   /db_xref="CDD:174204"
FT                   /locus_tag="Cfla_0140"
FT   gene            172225..173799
FT                   /db_xref="GeneID:9144006"
FT                   /locus_tag="Cfla_0141"
FT   CDS_pept        172225..173799
FT                   /locus_tag="Cfla_0141"
FT                   /gene_family="HOG000051000" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04389"
FT                   /codon_start="1"
FT                   /product="peptidase M28"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase M28; protease-associated PA domain
FT                   protein; KEGG: ami:Amir_0141 aminopeptidase Y"
FT                   /db_xref="GI:296128009"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="GeneID:9144006"
FT                   /translation="MAARRTTVLAGTLATLVLGTSALLAPPALAHGPGGRPGPGHGPGH
FT                   AVDAERFARQVTTRGVWRHLEELQRIADRHDGNRAALTEGYEASARYVERTLKRAGYEV
FT                   TRDPFTFGFEVIDAEALTLGTGETFAVDQMQYAPSTAEGGVTAPGSVPNDVTGCTADSW
FT                   AGVEATGTIAVISRGACSFAEKAIAAQAAGAIGAVVYNNVEEMLFGTLGEEGLVDIPVA
FT                   GAGQADGAAIVAAVAAGTPLTLEVRYHVEEEESFNVIAETKAGRDDNVVVLGAHLDGVE
FT                   DGPGLNDNGSGSAVLLEVAVQLAKQKKLNNTVRFAWWGAEELGLIGSTAYVEELAGQEG
FT                   ELDRIATYLNFDMVGSPNYVIGVYDADQSTYEAPVDVPPGSAETEAVFTGYFDSRDQAW
FT                   VDTEFSGRSDYQAFILNGVPASGLFTGADDIKTDEEVALFGGTAGIRHDPNYHTPADDL
FT                   SNVSREAIGIMAPAVAFATASLATDTSAINGVSGPGDQGHHHGPSHHGKGRAPHHGHEH
FT                   GGLLKAS"
FT                   /protein_id="YP_003635259.1"
FT   misc_feature    172609..>172869
FT                   /note="PA_SaNapH_like: Protease-associated domain
FT                   containing proteins like Streptomyces anulatus
FT                   N-acetylpuromycin N-acetylhydrolase (SaNapH).This group
FT                   contains various PA domain-containing proteins similar
FT                   SaNapH.  Proteins in this group belong to the...; Region:
FT                   PA_SaNapH_like; cd04816"
FT                   /db_xref="CDD:80359"
FT                   /locus_tag="Cfla_0141"
FT   misc_feature    172840..172845
FT                   /note="PA/protease or protease-like domain interface; other
FT                   site"
FT                   /db_xref="CDD:80359"
FT                   /locus_tag="Cfla_0141"
FT   misc_feature    173029..173622
FT                   /note="Peptidase dimerization domain; Region: M20_dimer;
FT                   cl09126"
FT                   /db_xref="CDD:175013"
FT                   /locus_tag="Cfla_0141"
FT   gene            complement(174206..174481)
FT                   /db_xref="GeneID:9144007"
FT                   /locus_tag="Cfla_0142"
FT   CDS_pept        complement(174206..174481)
FT                   /locus_tag="Cfla_0142"
FT                   /gene_family="HOG000225389" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, XRE family"
FT                   /transl_table="11"
FT                   /note="KEGG: stp:Strop_3164 helix-turn-helix domain-
FT                   containing protein; PFAM: helix-turn-helix domain protein;
FT                   SMART: helix-turn-helix domain protein"
FT                   /db_xref="GI:296128010"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="GeneID:9144007"
FT                   /translation="MAEATQDERRRAPGADAVHNRISVLRAERGVSRRQLADALGVHYQ
FT                   TVGYLERGEYSPSLHLALRIAAFFDVPVEVLFSLDPFPRIGGGPTS"
FT                   /protein_id="YP_003635260.1"
FT   misc_feature    complement(174254..174424)
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cd00093"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Cfla_0142"
FT   misc_feature    complement(order(174326..174328,174401..174403,
FT                   174413..174415))
FT                   /note="non-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Cfla_0142"
FT   misc_feature    complement(order(174329..174331,174404..174406))
FT                   /note="salt bridge; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Cfla_0142"
FT   misc_feature    complement(order(174323..174328,174338..174340,
FT                   174347..174349,174380..174385))
FT                   /note="sequence-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Cfla_0142"
FT   gene            complement(174474..175331)
FT                   /db_xref="GeneID:9144008"
FT                   /locus_tag="Cfla_0143"
FT   CDS_pept        complement(174474..175331)
FT                   /locus_tag="Cfla_0143"
FT                   /gene_family="HOG000244954" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /codon_start="1"
FT                   /product="ABC-2 type transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: nfa:nfa55030
FT                   putative transporter"
FT                   /db_xref="GI:296128011"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="GeneID:9144008"
FT                   /translation="MSTSAPTRWAVRLGVRRGLTEFRHMLRNPEDVGWNAVVGVAIVVY
FT                   LVTQRDVVVPGSGGLTLPDVALPGLLAATIVFGMVMGPAFTLAADVEDGTVLRMRAVPR
FT                   GTTTYTAGTVVAQSLGALPMLAILLVPWPFLLGDPMHQGAGGWVAVVGWLLLGTLATLP
FT                   VGIVGGALAGRPTRVMLCVMAPVVALAFVSGVLGPQTVPPWASGVVQAFPLYWLAHGLR
FT                   STTLPAPAEALELGGAWHPGVAAAVLMTWAAVGLVAAPLVLRRANARQAAGALARRVES
FT                   VLHG"
FT                   /protein_id="YP_003635261.1"
FT   gene            complement(175328..176230)
FT                   /db_xref="GeneID:9144009"
FT                   /locus_tag="Cfla_0144"
FT   CDS_pept        complement(175328..176230)
FT                   /locus_tag="Cfla_0144"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: saq:Sare_3387 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="GI:296128012"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017440"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9144009"
FT                   /translation="MDISGTAVVSMRGLRMAYGGRTVLDGIDLEVHHGEVVALLGPNGA
FT                   GKTTTVEIVEGFRRRAAGDVRVLGTDPERGDDAWRARIGVVLQSWRDHRRWRVRELLGQ
FT                   LADGYRPYARVGHAGAHDPDELLARVGLGEAAGQRMDKLSGGQRRRLDLAVGLVGRPDL
FT                   LILDEPTAGLDPVARRAFHELVHDVVDTDGTTVLMTTHDLAEAETVADRILLLVGGRVV
FT                   ADGSPAAVARQVAGAAEVRWRAHGERHVHSTHDPVAFTRELLAAGDVDDLEVVHASLED
FT                   AYLEIVRHHESPVALEVTR"
FT                   /protein_id="YP_003635262.1"
FT   misc_feature    complement(175367..176209)
FT                   /note="ABC-type multidrug transport system, ATPase
FT                   component [Defense mechanisms]; Region: CcmA; COG1131"
FT                   /db_xref="CDD:31326"
FT                   /locus_tag="Cfla_0144"
FT   misc_feature    complement(175568..176206)
FT                   /note="This family of ATP-binding proteins belongs to a
FT                   multisubunit transporter involved in drug resistance (BcrA
FT                   and DrrA), nodulation, lipid transport, and lantibiotic
FT                   immunity.  In bacteria and archaea, these transporters
FT                   usually include an ATP-binding...; Region:
FT                   ABC_DR_subfamily_A; cd03230"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="Cfla_0144"
FT   misc_feature    complement(176087..176110)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="Cfla_0144"
FT   misc_feature    complement(order(175628..175630,175727..175732,
FT                   175967..175969,176084..176092,176096..176101))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="Cfla_0144"
FT   misc_feature    complement(175967..175978)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="Cfla_0144"
FT   misc_feature    complement(175775..175804)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="Cfla_0144"
FT   misc_feature    complement(175727..175744)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="Cfla_0144"
FT   misc_feature    complement(175709..175720)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="Cfla_0144"
FT   misc_feature    complement(175622..175642)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="Cfla_0144"
FT   gene            176396..178510
FT                   /db_xref="GeneID:9144010"
FT                   /locus_tag="Cfla_0145"
FT   CDS_pept        176396..178510
FT                   /locus_tag="Cfla_0145"
FT                   /gene_family="HOG000236591" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00326"
FT                   /codon_start="1"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; KEGG: bcv:Bcav_3949 peptidase S9 prolyl
FT                   oligopeptidase active site domain protein"
FT                   /db_xref="GI:296128013"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="GeneID:9144010"
FT                   /translation="MTTPPGGDTPAATPFHDLDAYVALPRLSGLVLSPDGSRLVTAVQT
FT                   LDRKRTAYVTALWEVDPSGERPARRLTRSAKSESSAAFTPAGDLLFTSARPDPDATEPD
FT                   DEPPAALWLLPADGAEARVVADRRAGIGGVRTAKDAPTVLVVSDVLPSASDPSDDDRRR
FT                   KERKEAKVAAILHTGYPVRYWDHDLGPGAPHAFVATVSDNIAAPLAGERDPRLDLSDVT
FT                   PGARHELHQQSPALSPDGRTVVTPWNRAVARGEVRTHLVAIDVATGDRRVLVEDADGDL
FT                   SRPVVSPDGQQVVYLRESISTPHRAPALELWVVPLAGGEPRRVAGHWDRWAVDPVWLPT
FT                   SDALLVVADDDGRSPVFHVELATDTVTRVTSDDAAFTDVRVSPDGRTAYALRSSYAAPA
FT                   APVRIDLAAALAGGPVAAEPLRSPAPEVALPGRLDEVVTTAEDGTRVRAWLALPDGAGP
FT                   DAKAPLLLWIHGGPLGSWNAWSWRWNPWLLVAQGYAVLLPDPALSTGYGQEFVQRGWGA
FT                   WGAAPYTDLMAATDAALERDDVDPERTAAMGGSFGGYMANWVAGHTDRFRAIVTHASLW
FT                   ALDQFGPTTDASYYWQREMTPEMALSNSPHRFVGDIVTPMLVVHGDKDYRVPIGEGLRL
FT                   WYELLSASGLPADEHGRSPHRFLYYPDENHWVLKPQHAKVWYGTVAAFLAEHVLGRTGD
FT                   DAVPYPELLG"
FT                   /protein_id="YP_003635263.1"
FT   misc_feature    <177098..178468
FT                   /note="Dipeptidyl aminopeptidases/acylaminoacyl-peptidases
FT                   [Amino acid transport and metabolism]; Region: DAP2;
FT                   COG1506"
FT                   /db_xref="CDD:31695"
FT                   /locus_tag="Cfla_0145"
FT   misc_feature    177830..178468
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176620"
FT                   /locus_tag="Cfla_0145"
FT   gene            complement(178584..179723)
FT                   /db_xref="GeneID:9144011"
FT                   /locus_tag="Cfla_0146"
FT   CDS_pept        complement(178584..179723)
FT                   /locus_tag="Cfla_0146"
FT                   /gene_family="HOG000101847" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Xcel_3188"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="GI:296128014"
FT                   /db_xref="GeneID:9144011"
FT                   /translation="MTYPPLVVDDPTLADRHLLALPEGVEPDEIEVLAASRFRGVRWED
FT                   APETQTRTGVLPAVTAAFGIRSVGRQAPRPARVLRLARLSTIAGPYAVDTQDAIALGLP
FT                   ASTVMVWVLDAPRERGERPWPGGDRDGLKRAFPDGLPVREEERVLTWLVAAARRLGGAV
FT                   RTQTGAILTPDPDAATDLTVLTDRWIEPEEVLAIVQAVQPRAYLSVATPGSWTGPTGLA
FT                   GRTSQGAVGGAPESGGSGLRTALELHGVQDPDERRRLMAEADAYDRLMLAEPPPAEAFG
FT                   VLVDLGVDGMLAAEVAACEQLPPLMDDLPWTKAGVVAYRVRWEPFEIEQIELEKPSFEH
FT                   RVARSRSAPLIAQVAKALHAVVGGEVADEADFLVDPADL"
FT                   /protein_id="YP_003635264.1"
FT   gene            complement(179723..180307)
FT                   /db_xref="GeneID:9144012"
FT                   /locus_tag="Cfla_0147"
FT   CDS_pept        complement(179723..180307)
FT                   /locus_tag="Cfla_0147"
FT                   /gene_family="HOG000228601" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02274"
FT                   /codon_start="1"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /transl_table="11"
FT                   /note="KEGG: ace:Acel_2112 deoxycytidine triphosphate
FT                   deaminase; TIGRFAM: deoxycytidine triphosphate deaminase;
FT                   PFAM: deoxyUTP pyrophosphatase"
FT                   /db_xref="GI:296128015"
FT                   /db_xref="InterPro:IPR008180"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="GeneID:9144012"
FT                   /translation="MSCVLLSDRDIRAELGSGRVALDPYEPAMVQPSSVDVRLDRYFRL
FT                   FDNHKYPVIDPAAEQPDLTRLVEVEGGEPFVLHPGEFVLGSTYENVTLPDDIAARLEGK
FT                   SSLGRLGLLTHSTAGFIDPGFTGHVTLELSNVATLPILLWPGMKIGQLCFFRLTSPTEH
FT                   PYGSSQYGSRYQGQRGPTASRSWQGFHRTEV"
FT                   /protein_id="YP_003635265.1"
FT   misc_feature    complement(179846..180124)
FT                   /note="Trimeric dUTP diphosphatases; Region:
FT                   trimeric_dUTPase; cd07557"
FT                   /db_xref="CDD:143638"
FT                   /locus_tag="Cfla_0147"
FT   misc_feature    complement(order(179855..179857,179867..179869,
FT                   179876..179890,179900..179902,179906..179908,
FT                   179912..179914,179918..179920,179939..179941,
FT                   179948..179950,179966..179974,179987..180004,
FT                   180008..180010,180056..180058,180062..180067,
FT                   180080..180082))
FT                   /note="trimer interface; other site"
FT                   /db_xref="CDD:143638"
FT                   /locus_tag="Cfla_0147"
FT   misc_feature    complement(order(179918..179923,179933..179935,
FT                   179942..179950,179990..179998))
FT                   /note="active site"
FT                   /db_xref="CDD:143638"
FT                   /locus_tag="Cfla_0147"
FT   gene            180667..183135
FT                   /db_xref="GeneID:9144013"
FT                   /locus_tag="Cfla_0148"
FT   CDS_pept        180667..183135
FT                   /locus_tag="Cfla_0148"
FT                   /gene_family="HOG000218307" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06165"
FT                   /codon_start="1"
FT                   /product="glycosyltransferase 36"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyltransferase 36; glycosyltransferase 36
FT                   associated; putative carbohydrate binding; KEGG:
FT                   glycosyltransferase 36"
FT                   /db_xref="GI:296128016"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR009342"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR010403"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="GeneID:9144013"
FT                   /translation="MRFGHFDDEAREYVVTTPHTPYPWINYLGSEQFFSLLSHQAGGYS
FT                   FYRDAKMRRLTRYRYNNIPADAGGRYLYVNDGGDVWTPSWLPVKADLDHFEARHGLGYS
FT                   RITGERGGLRVATTFFVPLGENAEVQRVAVTNTSDAEKTVTLFSFVEFCLWNAQDDQTN
FT                   YQRNLSIGEVEVEQDGPHGSAIYHKTEYRERRDHYAVFGVNTHADGFDTDRDTFVGAYN
FT                   SLGEAAVPRAGQSADSVASGWYPIGSHSVRVTLAPGETRDLVYVLGYLENADDEKWADD
FT                   AHQVVNKEKAHGLLGRFATAEQADAAVEALQVYWTELLSTYSVRSDDEKLDRMVNIWNQ
FT                   YQCMVTFNMSRSASFFETGIGRGMGFRDSNQDLLGFVHLVPDRARERIIDIASTQFEDG
FT                   SAYHQYQPLTKRGNNDIGSGFNDDPLWLIAGVAGYVKETGDFSILDEPVPFDNEPGSEV
FT                   PLFEHLTRSFDFTVNHRGPHGLPLIGRADWNDCLNLNCFSTTPGESFQTTENQAGGHAE
FT                   SVFIAAQFVLYGEQYAELAERRGLTEVASQARKVVGEVREAVLEHAWDGRWFLRAYDFY
FT                   GNPVGTDAKPEGKIWIEPQGFAVMAGIGVGEGPDDTEAPAIQALDAVEEMLGTPHGLVL
FT                   QYPAYTTYQLELGEVSTYPPGYKENGGIFCHNNPWVIIAETVVGRGDKAFDYYKRITPA
FT                   YREEISDVHKLEPYVYAQMIAGKEAPRAGEAKNSWLTGTAAWNFVAVSQYLLGVRPDWD
FT                   GLVVDPQIGPDVPSFTVTRVARGATYEISVTNSGARGSRASIVVDGTPVEGNLVPYAPA
FT                   GSTVRVEVTL"
FT                   /protein_id="YP_003635266.1"
FT   misc_feature    <180667..183126
FT                   /note="Cellobiose phosphorylase [Carbohydrate transport and
FT                   metabolism]; Region: COG3459"
FT                   /db_xref="CDD:33262"
FT                   /locus_tag="Cfla_0148"
FT   misc_feature    180667..180855
FT                   /note="Putative carbohydrate binding domain; Region: CBM_X;
FT                   pfam06204"
FT                   /db_xref="CDD:148044"
FT                   /locus_tag="Cfla_0148"
FT   misc_feature    180862..181185
FT                   /note="Glycosyltransferase family 36; Region:
FT                   Glyco_transf_36; pfam06165"
FT                   /db_xref="CDD:148020"
FT                   /locus_tag="Cfla_0148"
FT   misc_feature    181225..181491
FT                   /note="Glycosyltransferase 36 associated family; Region:
FT                   GT36_AF; pfam06205"
FT                   /db_xref="CDD:148045"
FT                   /locus_tag="Cfla_0148"
FT   gene            183182..184192
FT                   /db_xref="GeneID:9144014"
FT                   /locus_tag="Cfla_0149"
FT   CDS_pept        183182..184192
FT                   /locus_tag="Cfla_0149"
FT                   /gene_family="HOG000256089" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01263"
FT                   /codon_start="1"
FT                   /product="Aldose 1-epimerase"
FT                   /transl_table="11"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: ddr:Deide_04840
FT                   putative aldose 1-epimerase (aldose mutarotase)"
FT                   /db_xref="GI:296128017"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="GeneID:9144014"
FT                   /translation="MTITAPLTHPAPAAPVTPAVAAPPGAVTLRTDLWEVDVLPGTGAS
FT                   LGAGRIRTSDGVWRDLLRPTRRTSSGDPEKCASFPMVPWSNRIRDGVLPFEGRRWQLQR
FT                   NAADGTAIHGAVRYAHWDVVEQTPTAVTLAVDTAEQIGINFPWQFGATVRYAVEGQNLV
FT                   VTTSVRNTDVEPFPAGFGHHPYLSRALLPVGAPIREYPPTAGPLLQVPARSGYRLDAAL
FT                   ADGPAGAVPPRADFRQMRPLGSAFVDDVLTDLDPCEPVRIEYPDEGVRVDLTVDPVYRH
FT                   LVLYAPRRRCYFAVEPATNVNDGFTLHDQGVPGTGVFVLEPGEERTGAFRLAVTV"
FT                   /protein_id="YP_003635267.1"
FT   misc_feature    183284..184189
FT                   /note="Galactose mutarotase and related enzymes
FT                   [Carbohydrate transport and metabolism]; Region: GalM;
FT                   COG2017"
FT                   /db_xref="CDD:32200"
FT                   /locus_tag="Cfla_0149"
FT   misc_feature    183416..184177
FT                   /note="Aldose 1-epimerase; Region: Aldose_epim; cl00476"
FT                   /db_xref="CDD:176583"
FT                   /locus_tag="Cfla_0149"
FT   gene            184301..185437
FT                   /db_xref="GeneID:9144015"
FT                   /locus_tag="Cfla_0150"
FT   CDS_pept        184301..185437
FT                   /locus_tag="Cfla_0150"
FT                   /gene_family="HOG000248815" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   GCN5-related N-acetyltransferase"
FT                   /db_xref="GI:296128018"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="GeneID:9144015"
FT                   /translation="MTTSTLWSVRAAPALPASPDDPDAWAYAGLSEIDRLVELERWGWS
FT                   DLWAPVHVRLALLRPQPHVRHHVWVAVEGDGGDPQDVVGYALLSEPLTSNQHTASVTVA
FT                   VRPPHRGRGIGTRLAATACGQAAADGRGTLQAATAHSPEPPAGPGALESPVGTGRVPAD
FT                   DPHVQFALRHGFRLEQVARYSVLELGDAHGAGTPEHVAHLAAAREAAGATYRTHTWRYE
FT                   PPADRLDDIAELYTRMSTDIPLGGLDLQEDPWDADRVREMVAHAAGAGLRLLVTAAEHV
FT                   ATGRLVAFSVLEVPDGDVPFAFQEDTLVLREHRGHRLGMLVKAVNLEELAVWRPAVRRI
FT                   HTWNAQENAHMLAINVDLGFRQAGVSAVWQRADAPTGT"
FT                   /protein_id="YP_003635268.1"
FT   misc_feature    184544..>184654
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:176420"
FT                   /locus_tag="Cfla_0150"
FT   gene            complement(185444..186760)
FT                   /db_xref="GeneID:9144016"
FT                   /locus_tag="Cfla_0151"
FT   CDS_pept        complement(185444..186760)
FT                   /locus_tag="Cfla_0151"
FT                   /gene_family="HOG000242060" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07907"
FT                   /codon_start="1"
FT                   /product="YibE/F family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: YibE/F family protein; KEGG: kra:Krad_0292
FT                   YibE/F family protein"
FT                   /db_xref="GI:296128019"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="GeneID:9144016"
FT                   /translation="MSSNEPTPSPQPDSPSAQPDSPSAQPASPSVPPTSALGPGARREP
FT                   TRLVLAVVVVVAAVAAAVGMVLTWPSGDGPETGLVDPGVHYVGAQVVDSRMRSCDGTIE
FT                   DVLPDGTVPPTVDCLEVTARTTGGREVDVLATSGVTSTDVPPGTRVLLERYPAQDGEPE
FT                   VWAWHDMDRTLPLGTFALAFALVTTLVAGLRGLRALVGLALAFLVLGAYVLPALVAGHD
FT                   GLGVALSGSTVIVVVVLYLAHGVSVRTTTALVGTLLGLAMVTGLGLLGAHAARLQPVTS
FT                   EDTFALARALGADGVDVLRGVFLCGVVLAGIGVLNDVTITQASAVWELRAADPSASWRT
FT                   LTARGMRIGRDHIASTVYTIAFAYAGASLPLLLLLELYDQPLLVTLTSGAFAEEIVRTL
FT                   AGATGLVLAIPLTTVVAAVAAVGAPPNRSGHGHGHGHAH"
FT                   /protein_id="YP_003635269.1"
FT   misc_feature    complement(185549..186118)
FT                   /note="YibE/F-like protein; Region: YibE_F; cl02259"
FT                   /db_xref="CDD:154825"
FT                   /locus_tag="Cfla_0151"
FT   gene            complement(186911..188200)
FT                   /db_xref="GeneID:9144017"
FT                   /locus_tag="Cfla_0152"
FT   CDS_pept        complement(186911..188200)
FT                   /locus_tag="Cfla_0152"
FT                   /gene_family="HOG000253156" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bcav_0090"
FT                   /codon_start="1"
FT                   /product="pyrrolo-quinoline quinone"
FT                   /transl_table="11"
FT                   /note="KEGG: bcv:Bcav_0090 pyrrolo-quinoline quinone"
FT                   /db_xref="GI:296128020"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="GeneID:9144017"
FT                   /translation="MTTAPLPRARRAAATATLALTTTLLAACAGTADGAPAGATPTAQA
FT                   TTPAAQERATAVPRLAVSYDGGVQVLDATTLEVVADLPLDGYLRLNPAGDGRHVVVSTA
FT                   EGFRLLDAGTWSDEHGDHAHHFTVDPLLTDVTYPAVTPGHVVVHDGRTVLFDDGTGTVT
FT                   ALDAGDVAHGPDDAAGARTHTTPHAHHGVAVELHDGTLVVSDGTEDARTGARALDADGR
FT                   EIAASDECPGVHGESVAADDVVAIGCENGVLLYRDGTFTHVTSPDPYGRIGNQAGSDAS
FT                   PVVLGDYKSDPDADLERPTRVSLVDTRTATLRLVDLPASYTFRPLARGDAGEALVLGTD
FT                   GALHVIDPETGALVRSVPVVAPWEEPAEWQTPRPAVRVHDGTAYVTEPATRSIHAVDVL
FT                   TGEVYRSARLDVVPDELTVAPGGTAPTHSH"
FT                   /protein_id="YP_003635270.1"
FT   gene            complement(188321..188992)
FT                   /db_xref="GeneID:9144018"
FT                   /locus_tag="Cfla_0153"
FT   CDS_pept        complement(188321..188992)
FT                   /locus_tag="Cfla_0153"
FT                   /gene_family="HOG000253280" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ddr:Deide_09361 putative GCN5-related N- acetyltransferase"
FT                   /db_xref="GI:296128021"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="GeneID:9144018"
FT                   /translation="MCSFNPDAPGRAVPRVPGSGRVVRVTATLRPFHPSDLPGMYRVCL
FT                   LTGAAGRDASSLYRDPDLLAHVYCGPYPTADPGLTWVVVDGRGVGGYVVATADTSAFDE
FT                   WCERAWWPVLRERYAQRADPGDGTEDHVLVGRVHDPRPSRPPDTAPAHLHIDLLPRLQG
FT                   QGWGRRLIETLAGELRARGVPGVHLGVDVRNRRAIAFYEHLGFVTDASYPWGHRMVLDL
FT                   R"
FT                   /protein_id="YP_003635271.1"
FT   misc_feature    complement(188372..188608)
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:176420"
FT                   /locus_tag="Cfla_0153"
FT   gene            189037..189110
FT                   /note="tRNA-Gly1"
FT                   /db_xref="GeneID:9144019"
FT                   /locus_tag="Cfla_R0004"
FT   tRNA            189037..189110
FT                   /db_xref="GeneID:9144019"
FT                   /locus_tag="Cfla_R0004"
FT                   /product="tRNA-Gly"
FT   gene            complement(189150..190331)
FT                   /db_xref="GeneID:9144020"
FT                   /locus_tag="Cfla_0154"
FT   CDS_pept        complement(189150..190331)
FT                   /locus_tag="Cfla_0154"
FT                   /gene_family="HOG000076414" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02661"
FT                   /codon_start="1"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /transl_table="11"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: mmi:MMAR_0586 hypothetical protein"
FT                   /db_xref="GI:296128022"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="GeneID:9144020"
FT                   /translation="MTDAETTRTFPVHTRETLPWVPASGRRAEIPTYDAAIPPLIADLR
FT                   VTVGGDTIEHARAAAVEVAVLERNHAGQVTTLEPFLLRTEAIASSRIEEELTTVDQLAR
FT                   AQLGIRAPRTARTVKGAIDGLTLMIDRSGDGVDLADILAAHRPLMADDPEEKWHAGELR
FT                   TVQNWIGGSHRSPRGAVHVPPTPARVPGLMDDLVRFMRRTDLDPIVQAAVAHAQFESIH
FT                   PFTDGNGRVGRSLINALWRYRSLTRQMAVPVASAIVAERERYFGLVNDYRDGHVEPFVL
FT                   FLADATRRSAREATVSAERLRELPDVWQERVHARAGSAVETLLRLLPQHPVVDAGDVAR
FT                   LTGVSTARAYAAIGRLEEAGVLRRITESRRDMAWAAGDVLDEADLMMDRLRFA"
FT                   /protein_id="YP_003635272.1"
FT   misc_feature    complement(189222..190094)
FT                   /note="Fic family protein [Function unknown]; Region:
FT                   COG3177"
FT                   /db_xref="CDD:32990"
FT                   /locus_tag="Cfla_0154"
FT   misc_feature    complement(189615..189926)
FT                   /note="Fic/DOC family; Region: Fic; cl00960"
FT                   /db_xref="CDD:174482"
FT                   /locus_tag="Cfla_0154"
FT   gene            190622..192124
FT                   /db_xref="GeneID:9144021"
FT                   /locus_tag="Cfla_0155"
FT   CDS_pept        190622..192124
FT                   /locus_tag="Cfla_0155"
FT                   /gene_family="HOG000295651" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00092"
FT                   /codon_start="1"
FT                   /product="von Willebrand factor type A"
FT                   /transl_table="11"
FT                   /note="KEGG: sco:SCO2721 lipoprotein; PFAM: von Willebrand
FT                   factor type A; SMART: von Willebrand factor type A"
FT                   /db_xref="GI:296128023"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="GeneID:9144021"
FT                   /translation="MGEHGRVTGLVAMVCGVAVALGACSAGGSADGTADWEGSGAYQPG
FT                   PYQEDLPYPEPGPTGPTAAGMTDPARDALSTFALDVDTGAYTRFRDAVRQGFSVDPFGV
FT                   RTEEFVNYFAQDYEPPAEGLGVSIDATALPFRPDHRLVRVGISSAPASAVSRADADLVL
FT                   VVDCSGSMDEAGKMETTKYALRTLVSSLRRTDRVAMVCYSTEADVYLEPTPVAEREGVL
FT                   AAIDRLAPRDSTNAAAGLALGYDLAMSMRTEGRLTRVVLVSDGVANVGETDPEGILARI
FT                   SSQAKAGISLISVGVGITTYNDHLLEQLADQGDGWHVYVDGEAEAERVFATGLTGSLVV
FT                   AGTDARAQVEFDPAQVAGYRLLGYENRAVADEDFRNDAVDGGEVFAGRSTTALYEVAMR
FT                   EGAGDGAFVRATVRYLDDDGRPVERDASLSRDDCAASPREASPRLRQDLVVALLTDHLT
FT                   DGPWSQEIAPADVRAEARTLLGVLDGDRAVQELVELVDRATT"
FT                   /protein_id="YP_003635273.1"
FT   misc_feature    <190835..191050
FT                   /note="von Willebrand factor; Region: vWF_A; pfam12450"
FT                   /db_xref="CDD:152884"
FT                   /locus_tag="Cfla_0155"
FT   misc_feature    191096..191611
FT                   /note="Von Willebrand factor type A (vWA) domain was
FT                   originally found in the blood coagulation protein von
FT                   Willebrand factor (vWF). Typically, the vWA domain is made
FT                   up of approximately 200 amino acid residues folded into a
FT                   classic a/b para-rossmann type of...; Region: vWFA;
FT                   cl00057"
FT                   /db_xref="CDD:173993"
FT                   /locus_tag="Cfla_0155"
FT   misc_feature    order(191117..191119,191333..191335,191411..191413)
FT                   /note="metal ion-dependent adhesion site (MIDAS); other
FT                   site"
FT                   /db_xref="CDD:29222"
FT                   /locus_tag="Cfla_0155"
FT   misc_feature    191627..192115
FT                   /note="Domain of unknown function (DUF3520); Region:
FT                   DUF3520; pfam12034"
FT                   /db_xref="CDD:152469"
FT                   /locus_tag="Cfla_0155"
FT   gene            192495..193031
FT                   /db_xref="GeneID:9144022"
FT                   /locus_tag="Cfla_0156"
FT   CDS_pept        192495..193031
FT                   /locus_tag="Cfla_0156"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: kse:Ksed_16830 hypothetical protein"
FT                   /db_xref="GI:296128024"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:9144022"
FT                   /translation="MTRSTSVRRTRRTAVVAAAAAAVLLAAGCASTASAGGSDEPAQAA
FT                   TYAGTTTTFGESYTYANGLVVEVKAPAAFVPSEGADVAGAEGEAVRVRVNLINGTSNEF
FT                   VPDKLGVTVVSGGVEATQILDPGSRIELTGPSRPLGRADVVAFDLAFVVEDPEDVTLTL
FT                   TPALGGYDPVVYTIG"
FT                   /protein_id="YP_003635274.1"
FT   gene            193469..194158
FT                   /db_xref="GeneID:9144023"
FT                   /locus_tag="Cfla_0157"
FT   CDS_pept        193469..194158
FT                   /locus_tag="Cfla_0157"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: kse:Ksed_16830 hypothetical protein"
FT                   /db_xref="GI:296128025"
FT                   /db_xref="GeneID:9144023"
FT                   /translation="MTTESPHGKRALAPTLSSVPTPRSGVPTTGFGVSAINTRPELDRP
FT                   VEEPERRSRAVLVAGALVAAAAVVAAVVAFRIMVPSIPSAEAAGASVAREEVRERPGSV
FT                   VMFGQVHTYGDGLEIAVNPPQRYEPSGNATGVEGGVPVKMQVVVTNRTDAAFRPNTVQV
FT                   SATSAGQPGTAIWDPDQGIALTGPDVSIPAGASLHFNLAFTVADPGDVTVELTPALFGY
FT                   GPTVVQR"
FT                   /protein_id="YP_003635275.1"
FT   gene            complement(194227..195321)
FT                   /db_xref="GeneID:9144024"
FT                   /locus_tag="Cfla_0158"
FT   CDS_pept        complement(194227..195321)
FT                   /locus_tag="Cfla_0158"
FT                   /gene_family="HOG000269194" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07683"
FT                   /codon_start="1"
FT                   /product="cobalamin synthesis CobW domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: cobalamin synthesis CobW domain protein; KEGG:
FT                   nml:Namu_3858 cobalamin synthesis CobW domain protein"
FT                   /db_xref="GI:296128026"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="GeneID:9144024"
FT                   /translation="MPRTPVVVLSSVDPVERDATLMSLLLDAPRTVAVRHDIHDDEEGT
FT                   LRRVVADATGVLEDEVLPLEHACLSCAVREDAVPTLHRLADGPWDTVVLALPVSAEPLP
FT                   VVRALGWAMRPGDTLAALRLGTTVTTVDLATLEHDLLGDDLLDERGLALTHDDRRSVGE
FT                   ALAAQVGHADVVLVEGSSSVHAVASDLLDHVRATDGRRVDGRHRVRLPDLTAVDHAPTT
FT                   AERRLDPAHVAPVPGAPTRNGVWTLDLHTDRPFHPERLLHGVERLGSPRVRSRGRFHVP
FT                   SRPDTMCVWEGAGGQLSIGAAGPWGHRTPDTRLVVTGTGDEAPALREAFAELVLSEPEV
FT                   RRGYEPWLGRPDVLAPWLGDRAPA"
FT                   /protein_id="YP_003635276.1"
FT   misc_feature    complement(194317..195150)
FT                   /note="Putative GTPases (G3E family) [General function
FT                   prediction only]; Region: COG0523"
FT                   /db_xref="CDD:30869"
FT                   /locus_tag="Cfla_0158"
FT   misc_feature    complement(194323..194592)
FT                   /note="Cobalamin synthesis protein cobW C-terminal domain;
FT                   Region: CobW_C; cl08458"
FT                   /db_xref="CDD:158345"
FT                   /locus_tag="Cfla_0158"
FT   gene            195395..195631
FT                   /db_xref="GeneID:9144025"
FT                   /locus_tag="Cfla_0159"
FT   CDS_pept        195395..195631
FT                   /locus_tag="Cfla_0159"
FT                   /gene_family="HOG000040462" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00009"
FT                   /codon_start="1"
FT                   /product="ribosomal protein L28"
FT                   /transl_table="11"
FT                   /note="KEGG: cef:CE0943 50S ribosomal protein L28; TIGRFAM:
FT                   ribosomal protein L28; PFAM: ribosomal protein L28"
FT                   /db_xref="GI:296128027"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="GeneID:9144025"
FT                   /translation="MSNHCQVLGKAPTFGRTVSHSGRRTPRRFVPNIQRRRYWVPSLGR
FT                   HVRLRVSTDGIKVIDRRGIDVVVAGILRRGEKV"
FT                   /protein_id="YP_003635277.1"
FT   misc_feature    195395..195622
FT                   /note="Ribosomal L28 family; Region: Ribosomal_L28;
FT                   cl00367"
FT                   /db_xref="CDD:174151"
FT                   /locus_tag="Cfla_0159"
FT   gene            195631..195798
FT                   /db_xref="GeneID:9144026"
FT                   /locus_tag="Cfla_0160"
FT   CDS_pept        195631..195798
FT                   /locus_tag="Cfla_0160"
FT                   /gene_family="HOG000004839" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01023"
FT                   /codon_start="1"
FT                   /product="ribosomal protein L33"
FT                   /transl_table="11"
FT                   /note="KEGG: kra:Krad_0286 ribosomal protein L33; TIGRFAM:
FT                   ribosomal protein L33; PFAM: ribosomal protein L33"
FT                   /db_xref="GI:296128028"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="GeneID:9144026"
FT                   /translation="MAKRLDLRPVIKLRSTGGTGFTYVTRKNRRTTPDRLVLRKYDPQL
FT                   RRHVDFREER"
FT                   /protein_id="YP_003635278.1"
FT   misc_feature    195652..195795
FT                   /note="Ribosomal protein L33; Region: Ribosomal_L33;
FT                   cl00383"
FT                   /db_xref="CDD:174162"
FT                   /locus_tag="Cfla_0160"
FT   gene            195800..196105
FT                   /db_xref="GeneID:9144027"
FT                   /locus_tag="Cfla_0161"
FT   CDS_pept        195800..196105
FT                   /locus_tag="Cfla_0161"
FT                   /gene_family="HOG000039864" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00253"
FT                   /codon_start="1"
FT                   /product="ribosomal protein S14"
FT                   /transl_table="11"
FT                   /note="PFAM: ribosomal protein S14; KEGG: cjk:jk1537 30S
FT                   ribosomal protein S14"
FT                   /db_xref="GI:296128029"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="GeneID:9144027"
FT                   /translation="MAKTSKIARDAQRREVVARYAARRAELRATSVNPHLTEDERIAAR
FT                   AELHAQPRDASPVRLRNRDLADGRPRGHLRRFGLSRVRFRDMALRGELPGVTTSSW"
FT                   /protein_id="YP_003635279.1"
FT   misc_feature    195800..196102
FT                   /note="Ribosomal protein S14p/S29e; Region: Ribosomal_S14;
FT                   cl00355"
FT                   /db_xref="CDD:174140"
FT                   /locus_tag="Cfla_0161"
FT   gene            196215..196337
FT                   /db_xref="GeneID:9144028"
FT                   /locus_tag="Cfla_0162"
FT   CDS_pept        196215..196337
FT                   /locus_tag="Cfla_0162"
FT                   /gene_family="HOG000111585" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00444"
FT                   /codon_start="1"
FT                   /product="ribosomal protein L36"
FT                   /transl_table="11"
FT                   /note="PFAM: ribosomal protein L36; KEGG: kra:Krad_0284 50S
FT                   ribosomal protein L36"
FT                   /db_xref="GI:296128030"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="GeneID:9144028"
FT                   /translation="MKVRASLASLKKKDGSIVVRRHGKTFVINKRNPRWKARQG"
FT                   /protein_id="YP_003635280.1"
FT   misc_feature    196215..196334
FT                   /note="Ribosomal protein L36; Region: Ribosomal_L36;
FT                   cl00380"
FT                   /db_xref="CDD:174159"
FT                   /locus_tag="Cfla_0162"
FT   gene            196337..196522
FT                   /db_xref="GeneID:9144029"
FT                   /locus_tag="Cfla_0163"
FT   CDS_pept        196337..196522
FT                   /locus_tag="Cfla_0163"
FT                   /gene_family="HOG000040268" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01031"
FT                   /codon_start="1"
FT                   /product="ribosomal protein L32"
FT                   /transl_table="11"
FT                   /note="KEGG: stp:Strop_4160 50S ribosomal protein L32;
FT                   TIGRFAM: ribosomal protein L32; PFAM: ribosomal L32p
FT                   protein"
FT                   /db_xref="GI:296128031"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="GeneID:9144029"
FT                   /translation="MAVPKRRTSRSRTRSRRAQWVATPTPLTRVRVDGRDVVVPPRLVP
FT                   ALRRGLIDPQGLPPAP"
FT                   /protein_id="YP_003635281.1"
FT   gene            complement(196488..197738)
FT                   /db_xref="GeneID:9144030"
FT                   /locus_tag="Cfla_0164"
FT   CDS_pept        complement(196488..197738)
FT                   /locus_tag="Cfla_0164"
FT                   /gene_family="HOG000242060" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07907"
FT                   /codon_start="1"
FT                   /product="YibE/F family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: YibE/F family protein; KEGG: bcv:Bcav_1777
FT                   YibE/F family protein"
FT                   /db_xref="GI:296128032"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="GeneID:9144030"
FT                   /translation="MRTADGHAHAHGPLVLRPASARRARTLLALLLVPVAVLTAVGAWW
FT                   LWPDPEARPPQFATDGPGVTYVRGEVVEVHPASPEQDQATVRLADGTEVGLQVPTEYVP
FT                   ELTPGDVVRAARLQVAAIAFDPTADPDAMTTQHVFVDLVRGPPMALLAGLFVLLVVVVA
FT                   RWRGLAALVGMGLGLGVVAGFTLPALLTGRPAVPVALVTSVVIMFAVLYLAHGVSVRTS
FT                   TALAGTLVGLVATAAIAAWAGGAAHLTGLSGEYALDLMSVAPDVRLRSVLVCGMVLAGL
FT                   GVLNDVTITQASAVWELHAASPGRPWRSLFSQGMRIGRDHIASTVYTIVFAYVGAALPL
FT                   VLLVSLSDRDLLGLLTSGEIAEEVVRTLVGSIGLVLAIPVTTALAATFVRLSAAAPDQD
FT                   AATDDRLTAPEAAPAGR"
FT                   /protein_id="YP_003635282.1"
FT   misc_feature    complement(196575..197189)
FT                   /note="YibE/F-like protein; Region: YibE_F; cl02259"
FT                   /db_xref="CDD:154825"
FT                   /locus_tag="Cfla_0164"
FT   gene            197910..200456
FT                   /db_xref="GeneID:9144031"
FT                   /locus_tag="Cfla_0165"
FT   CDS_pept        197910..200456
FT                   /locus_tag="Cfla_0165"
FT                   /gene_family="HOG000171254" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04169"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF404"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF404; protein of
FT                   unknown function DUF403; protein of unknown function
FT                   DUF407; KEGG: bcv:Bcav_3861 protein of unknown function
FT                   DUF404"
FT                   /db_xref="GI:296128033"
FT                   /db_xref="InterPro:IPR007296"
FT                   /db_xref="InterPro:IPR007297"
FT                   /db_xref="InterPro:IPR007302"
FT                   /db_xref="GeneID:9144031"
FT                   /translation="MTDLLSSPRPVGDGTVVHRPDWTWLPPGTAPTEADLARAARQAEQ
FT                   LLAAHGVTYGAEAVDGDHPWRLDPEPVVVDEPEWTRLEAALTQRAELLDAVLHDLYGPR
FT                   RLLDDRILPPTTVLAHPGFLRAVDGLRLPGGRELVLSATDLVRDRAGEWCVVADRTQAP
FT                   SGAGYAMEDRRITAQVLAPVYRQAPIARLGPFFHALRKALREVAPPTAGDEPRAVLLSP
FT                   GPASETAFDQAYLASMLGLPLVEGSDLVVRAGRVYLQGIDGLEHVDVVLRRVDGDWCDP
FT                   LDLRAGSRLGVPGLVHAVRQGTVSVVNPLGTSVLDNPALLAYLPRLARAVLDQDLTLAS
FT                   APTWWCGEERALRHVLGRLDRLVLKPVVHGAESTTVVGERLSAAEREDLAARITAEPWR
FT                   WVGQERVGPEEPGSRAAVLRTFAVAHAGSYTVMSGGLARVADDPVVTSSAPGAVAKDVW
FT                   VLTSRPAATGAVLREDDAAAGGRTLAYGISPRAAENLYWMGRYAERAEDGVRVLRAVAD
FT                   RWDDYHRTPGTAGGQALAVLLQALTPAALPDGGEAAVPAPEHVGPRVPALRDLLLDRRT
FT                   PGSVARAVHRLRTSAATVRDQLSTDTFGPIARIESTLRDERARLRARRQPDAGLAAPAS
FT                   VTAGLRPTLDGVLESLLAISGIAAEGLTRDVGWHLLDAGRRIERAQRLVAMLRATLVEH
FT                   RPAEVEDLLLESVLLATESAITYRRRHQSRTDVARVLDLLVHDRTNPRSLAFALDRLLA
FT                   DLEAVPAPRSATQRDHLLHGVAGLVAELDTVVVGNEVSDDGRRVRLADALDSMLWRLRE
FT                   ASDEIERVHFVRPAPSRALDDVWGAGTDDRTGEEER"
FT                   /protein_id="YP_003635283.1"
FT   misc_feature    198057..198734
FT                   /note="Domain of unknown function (DUF404); Region: DUF404;
FT                   pfam04169"
FT                   /db_xref="CDD:146681"
FT                   /locus_tag="Cfla_0165"
FT   misc_feature    198903..199289
FT                   /note="Domain of unknown function (DUF407); Region: DUF407;
FT                   pfam04174"
FT                   /db_xref="CDD:112964"
FT                   /locus_tag="Cfla_0165"
FT   misc_feature    199377..200375
FT                   /note="Bacterial domain of unknown function (DUF403);
FT                   Region: DUF403; cl00980"
FT                   /db_xref="CDD:154123"
FT                   /locus_tag="Cfla_0165"
FT   gene            200453..201379
FT                   /db_xref="GeneID:9144032"
FT                   /locus_tag="Cfla_0166"
FT   CDS_pept        200453..201379
FT                   /locus_tag="Cfla_0166"
FT                   /gene_family="HOG000171031" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /codon_start="1"
FT                   /product="transglutaminase domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rop:ROP_69130 hypothetical protein; PFAM:
FT                   transglutaminase domain protein; transglutaminase domain
FT                   protein; SMART: transglutaminase domain protein"
FT                   /db_xref="GI:296128034"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR013589"
FT                   /db_xref="GeneID:9144032"
FT                   /translation="MSARSYDLVHRTTYEYAQPVTDSYGRTTMTPRDLPDQRVVATSLT
FT                   IDPEPADTGRHVDWFGNTTTYFGVTRAHTRLVVTSRSTLEVSRVAPPRDALPDVGWRAV
FT                   ARSVTTADLGVLRTDAAGVVELREAVLPSAHVRFVDEVRDWAAPSFTEERPLADVVVDL
FT                   VHRIRTELTYRSGSTTVHTTQAQLLAQGAGVCQDFAHLMIAALRVHGVPARYASGYIET
FT                   RPRPGRPKLRGADASHAWVSVWLPGHGWLDADPTNDQLVDDRYVVLGWGRDYHDVPPLR
FT                   GVIFTEGGGATPRVEVDLVPSGSEPFV"
FT                   /protein_id="YP_003635284.1"
FT   misc_feature    200465..201349
FT                   /note="Transglutaminase-like enzymes, putative cysteine
FT                   proteases [Amino acid transport and metabolism]; Region:
FT                   COG1305"
FT                   /db_xref="CDD:31496"
FT                   /locus_tag="Cfla_0166"
FT   misc_feature    200468..200710
FT                   /note="Bacterial transglutaminase-like N-terminal region;
FT                   Region: Bact_transglu_N; pfam08379"
FT                   /db_xref="CDD:149443"
FT                   /locus_tag="Cfla_0166"
FT   misc_feature    200879..201217
FT                   /note="Transglutaminase-like superfamily; Region:
FT                   Transglut_core; cl10469"
FT                   /db_xref="CDD:176834"
FT                   /locus_tag="Cfla_0166"
FT   gene            complement(201389..202291)
FT                   /db_xref="GeneID:9144033"
FT                   /locus_tag="Cfla_0167"
FT   CDS_pept        complement(201389..202291)
FT                   /locus_tag="Cfla_0167"
FT                   /gene_family="HOG000097773" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Xcel_3192"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="GI:296128035"
FT                   /db_xref="GeneID:9144033"
FT                   /translation="MTGSPAAPVALDGSHVLAVPRGTPVLEYARAWFPAAAWSREPATA
FT                   AQAATAARPTGARFRGIALAAPDPAGVLSLDGVAEVVGPHPVEAAEARALGLPARPSDL
FT                   YGLPTGPVAGATVGPDLVAGWATAVARRAGGGILPAARDRAVVPDPAAAVDLTLWSAVP
FT                   LSPDDALPLVRPSLSGSRLTLDAPPGGAIGFIVTASYEYDGAVEVRCGRSREVPAVLST
FT                   LDWREHGPWSYRVTWRPPDPMELEVPHPSQLHVIARQRVAPGIARVVAALWRAVGGTVV
FT                   DAGGFLVPHAEVEERARPR"
FT                   /protein_id="YP_003635285.1"
FT   gene            complement(202362..202922)
FT                   /db_xref="GeneID:9144034"
FT                   /locus_tag="Cfla_0168"
FT   CDS_pept        complement(202362..202922)
FT                   /locus_tag="Cfla_0168"
FT                   /gene_family="HOG000243210" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Xcel_3194"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="GI:296128036"
FT                   /db_xref="GeneID:9144034"
FT                   /translation="MDTDRHPEPVPAPPPAIEPDAKDWTWVVQQRCPECGFAASDVDPP
FT                   GIGGTVRDLVPRWVAALHRDDARERPAPGVWSPLEYGAHVRDVMRVFDERVRLMTDQDD
FT                   PLFANWDQDATAVTDRYDLQDPVVVADELAAAAAVTADRFDAVAADQWERTGRRSNGSL
FT                   FTVRTLGQYFLHDVVHHLHDVRA"
FT                   /protein_id="YP_003635286.1"
FT   gene            complement(203349..204671)
FT                   /db_xref="GeneID:9144035"
FT                   /locus_tag="Cfla_0169"
FT   CDS_pept        complement(203349..204671)
FT                   /locus_tag="Cfla_0169"
FT                   /gene_family="HOG000239992" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01590"
FT                   /codon_start="1"
FT                   /product="putative phytochrome sensor protein"
FT                   /transl_table="11"
FT                   /note="PFAM: GAF domain protein; transcriptional regulator
FT                   domain protein; KEGG: mmi:MMAR_4913 putative regulatory
FT                   protein"
FT                   /db_xref="GI:296128037"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="GeneID:9144035"
FT                   /translation="MSRHAHPAQDGPFTGSAPAGGVPAPIPATRPGDWQADDAVTRPTA
FT                   LVRAAHERFVTTGDDPGRLVRPIVADSWRRSRRVGVDPELPTPPVDINGPALAELRSSH
FT                   PLSGAVPIVQRLLVDPEAGWVTALSDEAGRLLWVDGDHALRRPLDDVGFVEGAAWREDA
FT                   VGTNALGTALATRRALQVVGTEHWARVVHPWNCAAVPVHDPHGRLLGVLDVTGRDDAAS
FT                   WMALALVRATVAAIEASLATSAATAPGARLSVLGAHGGTLHLPSGRRRLTCRHAEILLL
FT                   LAEHPAGLRGDELAVLLSESELSEVTVRAEISRLRRLVGPLLSESRPYRLTAPLETDVD
FT                   TVRTSLAVGDVAGALSAYGGSVLPRSAAPGVARLRATVRDEVRAATLASGDPELVGRWT
FT                   ASEQGADDWQAWQTLARVAPIGSAAHLRAHTRLAQLDRALR"
FT                   /protein_id="YP_003635287.1"
FT   misc_feature    complement(<203973..204518)
FT                   /note="Transcriptional activator of acetoin/glycerol
FT                   metabolism [Secondary metabolites biosynthesis, transport,
FT                   and catabolism / Transcription]; Region: AcoR; COG3284"
FT                   /db_xref="CDD:33094"
FT                   /locus_tag="Cfla_0169"
FT   gene            204824..205429
FT                   /db_xref="GeneID:9144036"
FT                   /locus_tag="Cfla_0170"
FT   CDS_pept        204824..205429
FT                   /locus_tag="Cfla_0170"
FT                   /gene_family="HOG000238397" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, TetR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG: transcriptional
FT                   regulator, TetR family"
FT                   /db_xref="GI:296128038"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="GeneID:9144036"
FT                   /translation="MPKIIGASLHEHREQTRRRLFGALSTLMSERGFDAITLADIAAAA
FT                   GVGRTAVYNHFPDKESLLLGFITHETEQYAAGLQASLDDIDDPVEQLRAYVRAQASLTR
FT                   VYHVAPGPELRSVLSRGAQQRVREHVGVVEQILRRILAAGIASGELPEQDLATTVPLVN
FT                   ACLTGRNLPDGADEREQAIAQTEAFVLRAVGARVPVTA"
FT                   /protein_id="YP_003635288.1"
FT   misc_feature    204854..205327
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   AcrR; COG1309"
FT                   /db_xref="CDD:31500"
FT                   /locus_tag="Cfla_0170"
FT   gene            205456..206784
FT                   /db_xref="GeneID:9144037"
FT                   /locus_tag="Cfla_0171"
FT   CDS_pept        205456..206784
FT                   /locus_tag="Cfla_0171"
FT                   /gene_family="HOG000287302" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01170"
FT                   /codon_start="1"
FT                   /product="putative RNA methylase"
FT                   /transl_table="11"
FT                   /note="PFAM: putative RNA methylase; KEGG: dra:DR_1669
FT                   hypothetical protein"
FT                   /db_xref="GI:296128039"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="GeneID:9144037"
FT                   /translation="MPRGEDRRGSTGGGRGASSSGRGERGATDGRPAGGRAGATSGHRS
FT                   GSTGTGRPVATPGGRRDRHGRAGTSRERGPAPASTRVELTYLPGLRDVLAAEVAEVLPA
FT                   ARGVRDVPGRDDAVVLTLAGALADVARLRTAVAAWVLVHLDVPRPKSFASPEHLRRVVD
FT                   AVYASLRVAGSSTFRFEAAGADSAVFARLAGLLHDATGLIHDPAAGDLVVRVRRGARPP
FT                   AGAGRAAEDRDPGWDVLVRVGPRPLSARTWRVADFPGAANATIAAAVARLAGVRAEDRV
FT                   LNLMAGSGTLLVERLLAGPAAAAVAVDLDVAAHDAARLNLEAAGLLTRRPRPALLTCDA
FT                   TDPVALQAAVTEPLGGTADVVLADPPWGTLHGSHADAPRLHAGLLRAAHAVSAPGARLV
FT                   VLTHEVKVMERVVRDTADLWVPRSVTRVYAKGHHPRIHVLDRR"
FT                   /protein_id="YP_003635289.1"
FT   misc_feature    206203..206760
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:176836"
FT                   /locus_tag="Cfla_0171"
FT   gene            206996..208084
FT                   /db_xref="GeneID:9144038"
FT                   /locus_tag="Cfla_0172"
FT   CDS_pept        206996..208084
FT                   /locus_tag="Cfla_0172"
FT                   /gene_family="HOG000092011" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03067"
FT                   /codon_start="1"
FT                   /product="chitin-binding domain 3 protein"
FT                   /transl_table="11"
FT                   /note="KEGG: chitin-binding domain 3 protein; PFAM:
FT                   chitin-binding domain 3 protein; PT repeat- containing
FT                   protein; cellulose-binding family II; SMART:
FT                   cellulose-binding family II"
FT                   /db_xref="GI:296128040"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR004302"
FT                   /db_xref="InterPro:IPR006970"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="GeneID:9144038"
FT                   /translation="MFIPTRSRFGRLARLALAVPLALAATGIVATSASAHGSVTDPPSR
FT                   NYGCWEREGGTHMDPAMAQRDPMCWQAFQANPNTMWNWNGNFREGVGGRHEQVIPDDQL
FT                   CSAGKTQNGLYASLDTPGPWIMKTVPHNFTLTLTDGAMHGADYMRIYVSKAGYDPTTDP
FT                   LGWDDIELIKETGRYGTTGLYQADVSIPSNRTGRAVLFTIWQASHLDQPYYICSDININ
FT                   GTAPTQQPTQQPTQQPTQQPTQQPTQQPTQQPTQQPTQQPTQQPTQNPGTGACTATVKA
FT                   ASTWGNGWQGEVTVTAGSSAINGWKVTVGGASITQAWSGSYSGGTFSNAEWNGKLAAGA
FT                   STTAGFIASGTPGTLTATCTAA"
FT                   /protein_id="YP_003635290.1"
FT   misc_feature    207101..207655
FT                   /note="Chitin binding domain; Region: Chitin_bind_3;
FT                   pfam03067"
FT                   /db_xref="CDD:145950"
FT                   /locus_tag="Cfla_0172"
FT   misc_feature    207842..208075
FT                   /note="Cellulose binding domain; Region: CBM_2; cl02709"
FT                   /db_xref="CDD:155069"
FT                   /locus_tag="Cfla_0172"
FT   gene            208321..210240
FT                   /db_xref="GeneID:9144039"
FT                   /locus_tag="Cfla_0173"
FT   CDS_pept        208321..210240
FT                   /locus_tag="Cfla_0173"
FT                   /gene_family="HOG000229147" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /codon_start="1"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /transl_table="11"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; NHL repeat containing protein;
FT                   KEGG: bcv:Bcav_3901 alkyl hydroperoxide reductase/thiol
FT                   specific antioxidant/Mal allergen"
FT                   /db_xref="GI:296128041"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR001258"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="GeneID:9144039"
FT                   /translation="MTSTSAPRLPRVRASELVGRGWLNTGGKDVTLADLRGKVVVLDFW
FT                   TFCCINCLHVLDELREIEERHRDVLVIVGVHSPKFVHEADPVALAAAVERYEVHHPVLD
FT                   DPDLVTWQAFTARAWPTLVVIDPEGYVVAQMAGEGHAHAVETLVRDLVAEHEAKGTLHR
FT                   GDGPYVAPTPQPTTLRFPAKAVELPGGTFLVADAGHHTLTEVAADGETLVRRIGSGERG
FT                   LVDGGPDDARFSEPNGLGLVPDELRGRVGYDVLVADTVNHALRGVRLSDGHVTTLAGTG
FT                   EQYMVGAVDNVRPADGDTANPAGSGVGDRWAARQVKLSSPWDVAWSTELAAFVVAMAGN
FT                   HTLWAFDPVGGTVTHLAGTMNEGLVDGTPQEAWFAQPSGLSVDAAGRLWLADAETSALR
FT                   WVDPADASVHSVVGTGLFDFGHRDGAADQALFQHPLGVAALPDGSVLVADTYNGALRRW
FT                   QPGEGDAPGTVTTLATDLAEPSGLVLPSGDTDHVLVVESAAHRLTRVPLPAGAGEQVDG
FT                   GAHRTQRPVTEIGTDVALEVVFHPAAGQKLDDRWGPSTSLQVSATPPELLLGGGGNDVT
FT                   LTRTLRLDPTVGEGVLHVTARAASCDADPAIEHPACHLAAQDWGVPVRVATGGDATLVL
FT                   PLHG"
FT                   /protein_id="YP_003635291.1"
FT   misc_feature    208381..208737
FT                   /note="Protein Disulfide Oxidoreductases and Other Proteins
FT                   with a Thioredoxin fold; Region: Thioredoxin_like; cl00388"
FT                   /db_xref="CDD:176818"
FT                   /locus_tag="Cfla_0173"
FT   misc_feature    <208384..209772
FT                   /note="haloacid dehalogenase-like hydrolase family protein;
FT                   Region: PLN02919"
FT                   /db_xref="CDD:166560"
FT                   /locus_tag="Cfla_0173"
FT   gene            complement(210293..211735)
FT                   /db_xref="GeneID:9144040"
FT                   /locus_tag="Cfla_0174"
FT   CDS_pept        complement(210293..211735)
FT                   /locus_tag="Cfla_0174"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /codon_start="1"
FT                   /product="diguanylate cyclase with GAF sensor"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; GAF domain protein; KEGG: sco:SCO4931
FT                   hypothetical protein; SMART: GGDEF domain containing
FT                   protein; GAF domain protein"
FT                   /db_xref="GI:296128042"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="GeneID:9144040"
FT                   /translation="MMGCVTRRGSTAKGAHRGGLSAADLGGVRGLAVAAHRFDACRHVD
FT                   EVVEAAAQAAMDVLGADACTVARITQETCRVVHLESPENDPRWHQFLSSTYRADERPAL
FT                   RALLRNRESWVAHAFDAQGRSVRPGDTSAGDRVEVEMLREVGAASALTSPVVVNDAVWG
FT                   QLTVVRDFDAPLFHVDEVATAEVLAALAAGAIARVDLEQQMRHMIADDPLTGLANRRTA
FT                   DQAAEAALASGRETCVVMCDVDGLKRVNDELGHDAGDDLLRAVADVLRRAADAIPGATA
FT                   ARIGGDEFCLVTVDQPRETVATAMSTTVAKFPLPHGAAISYGIASTAVMGSVEARHLFR
FT                   RADQAQYQAKRRRARARARTTPPIADPVQAVERLTSSSAVAIGAAAPAVVPRLCAFAAA
FT                   ATETLGGDSWAVRERMPGSQTFTTVARGGSAADSPETRTLSIERDEWVVEIAVSVNAST
FT                   GRQVQTALNALVAIAVLDVTPV"
FT                   /protein_id="YP_003635292.1"
FT   misc_feature    complement(210758..211105)
FT                   /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
FT                   GGDEF; cd01949"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Cfla_0174"
FT   misc_feature    complement(order(210875..210877,211010..211012))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Cfla_0174"
FT   misc_feature    complement(order(210872..210883,210887..210889,
FT                   210959..210961,210971..210973,210983..210988,
FT                   210995..210997))
FT                   /note="active site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Cfla_0174"
FT   misc_feature    complement(order(210824..210826,210899..210901))
FT                   /note="I-site; other site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Cfla_0174"
FT   gene            211961..213163
FT                   /db_xref="GeneID:9144041"
FT                   /locus_tag="Cfla_0175"
FT   CDS_pept        211961..213163
FT                   /locus_tag="Cfla_0175"
FT                   /gene_family="HOG000092011" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03067"
FT                   /codon_start="1"
FT                   /product="chitin-binding domain 3 protein"
FT                   /transl_table="11"
FT                   /note="KEGG: jde:Jden_2447 chitin-binding domain 3 protein;
FT                   PFAM: chitin-binding domain 3 protein; cellulose- binding
FT                   family II; SMART: cellulose-binding family II"
FT                   /db_xref="GI:296128043"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR004302"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:9144041"
FT                   /translation="MPRHRSTRRALAGLAATAVVTTALVTVPTVAQAHGGLTNPPTRTY
FT                   ACYQDGLAGGAAAGEAGNIRPRNAACVNAFDNEGNYSFYNWYGNLLGTIAGRHETIADG
FT                   KVCGPDARFASYNTPSSAWPTTKVTPGQTMTFQYAAVARHPGWFTTWITKDGWNQNEPI
FT                   GWDDLEPAPFDRVLDPPLREGGPAGPEYWWNVKLPSNKSGKHVLFNIWERTDSPESFYN
FT                   CVDVDFGGGGTVTPSPTPSVTPTRTPTPSPTPSVTPSPTPSVTPTPTPTPTPTPSPTPT
FT                   LTVTPTPTPTSVPGDSVCELEVDTSSAWPGGFQGTVTVFNATMEPVNGWQVSWKFTNGE
FT                   TIAQSWSGVTSQSGSTVTVKNADWNSTIAHHNAVNFGFIGSGTPKAVTDATLNGKPCIV
FT                   R"
FT                   /protein_id="YP_003635293.1"
FT   misc_feature    212060..212641
FT                   /note="Chitin binding domain; Region: Chitin_bind_3;
FT                   pfam03067"
FT                   /db_xref="CDD:145950"
FT                   /locus_tag="Cfla_0175"
FT   misc_feature    212855..213151
FT                   /note="Cellulose binding domain; Region: CBM_2; cl02709"
FT                   /db_xref="CDD:155069"
FT                   /locus_tag="Cfla_0175"
FT   gene            complement(213247..213486)
FT                   /db_xref="GeneID:9144042"
FT                   /locus_tag="Cfla_0176"
FT   CDS_pept        complement(213247..213486)
FT                   /locus_tag="Cfla_0176"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bcav_3935"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcv:Bcav_3935 hypothetical protein"
FT                   /db_xref="GI:296128044"
FT                   /db_xref="GeneID:9144042"
FT                   /translation="MADLDEARRAKDELKRTLAGRPDVAGIGIAPEAGGYGVLVRVREP
FT                   EKGSGVRPRFADVPTSVRGVSVHVRMSGPVTAGG"
FT                   /protein_id="YP_003635294.1"
FT   gene            complement(213534..214571)
FT                   /db_xref="GeneID:9144043"
FT                   /locus_tag="Cfla_0177"
FT   CDS_pept        complement(213534..214571)
FT                   /locus_tag="Cfla_0177"
FT                   /gene_family="HOG000000076" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Xcel_3215"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="GI:296128045"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="GeneID:9144043"
FT                   /translation="MDHDEARKAKAHAVAVARTLVEGVVRPSTTEGEVAAPLAVGLAPA
FT                   PDGGFGIALRYRLGAPDVRSIAHQVAAEIGEVGKVVDLRRTGEIRALTGATGAGTEVGS
FT                   AAVPGPRPPVVTAQALGETGRVRPLRPGVSIAHVDVTAGTLGAFVLVDGVVHALSNHHV
FT                   LAGSPSARPGDLIVQPGPADGGGAPADRVGTLAAFAPLVAGTTAMVDAAIALLDDPEVD
FT                   PTYPVGRITTTARALGGEPVVKIGRTTSVTRGRVTAIELDDIVVGYGDELGDLRFDDQI
FT                   EVEGLGTGPFSRGGDSGSLVYREDGVALGLLFAGSEYGGDNGRGLTYVNPIDAVLTALD
FT                   ATLLA"
FT                   /protein_id="YP_003635295.1"
FT   gene            complement(214766..214990)
FT                   /db_xref="GeneID:9144044"
FT                   /locus_tag="Cfla_0178"
FT   CDS_pept        complement(214766..214990)
FT                   /locus_tag="Cfla_0178"
FT                   /gene_family="HOG000237272" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cmi:CMM_1103 hypothetical protein"
FT                   /db_xref="GI:296128046"
FT                   /db_xref="GeneID:9144044"
FT                   /translation="MGIGTGIALLVIGAILSFGVSDRIEGVDLTVIGYICMGAGALALI
FT                   LAIAMTNQRANTSHREVIERHDNPPVPPA"
FT                   /protein_id="YP_003635296.1"
FT   gene            215198..216994
FT                   /db_xref="GeneID:9144045"
FT                   /locus_tag="Cfla_0179"
FT   CDS_pept        215198..216994
FT                   /locus_tag="Cfla_0179"
FT                   /gene_family="HOG000101896" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00553"
FT                   /codon_start="1"
FT                   /product="cellulose-binding family II"
FT                   /transl_table="11"
FT                   /note="KEGG: jde:Jden_0516 arabinan endo-1,5-alpha-L-
FT                   arabinosidase; PFAM: cellulose-binding family II; glycoside
FT                   hydrolase family 43; SMART: cellulose-binding family II"
FT                   /db_xref="GI:296128047"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR018366"
FT                   /db_xref="GeneID:9144045"
FT                   /translation="MVVTGRAVARALSRRTRARRPATLPVAVAASLAFVVGLLAPVTAT
FT                   AGAPPGVPLPDGALAAVGDLTPVHDPALVVEGDTWHVLGTGRVDRENGGTIQHWVSRDA
FT                   GVTWNYARTIWPSVPTWLDQRISGLENLWAPEVVEHDGTYYLYYSASRFGTNTSVTALA
FT                   TNTTLDPADPAYRWVDQGEVISSPQSGLPGGMAFNAIDAGVVDVDGRPWMAIGSFWHGI
FT                   FLVELSWPSGKPVPSWRTTARHLAAGRPDGNAVEAPYLYARDGWYYLFVSEGACCRGTD
FT                   STYRISVGRSRDVTGPYVDRNGRDLVAGGGSVLLERHGVQAGPGGQSVSQDVLAYHYYA
FT                   TNDGGTPTLGLQKLRWVEGWPVADTRAAAATVTAQPADGSVGLGGTTTLTLGASGSPAP
FT                   VAVWQTSADGGRTWQYAGNQRVVDGRSTHVLRDVRVETQVRAYLVNATGTVLTRAARVR
FT                   PSPTSMPSPTPSPTSSVTPSPTPSPTVEPSPTLPAAATCAVAYAATSWGDGFTASVRLT
FT                   NTGSAPLTWTLTFDLADGQRVAQGWSATWAQTGTTVRASGASWNATLAPGATADIGFNG
FT                   THTGSTPAPTSFTVAGTPCTSA"
FT                   /protein_id="YP_003635297.1"
FT   misc_feature    215483..216277
FT                   /note="Glycosyl hydrolases family 43; Region:
FT                   Glyco_hydro_43; cl09152"
FT                   /db_xref="CDD:158437"
FT                   /locus_tag="Cfla_0179"
FT   misc_feature    216710..216982
FT                   /note="Cellulose binding domain; Region: CBM_2; cl02709"
FT                   /db_xref="CDD:155069"
FT                   /locus_tag="Cfla_0179"
FT   gene            217029..217580
FT                   /db_xref="GeneID:9144046"
FT                   /locus_tag="Cfla_0180"
FT   CDS_pept        217029..217580
FT                   /locus_tag="Cfla_0180"
FT                   /gene_family="HOG000045854" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /codon_start="1"
FT                   /product="NUDIX hydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: bcv:Bcav_2192 NUDIX
FT                   hydrolase"
FT                   /db_xref="GI:296128048"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="GeneID:9144046"
FT                   /translation="MGWRTVSSRVVYENPWIRVREDDALAPDGRPARYGVVELRPSVFV
FT                   VALTDDDEVVLVTTDRYTTGPHSIEVPAGGTDGQEPLVAAQRELAEETGLVAREWTRVG
FT                   TVDALNGIARAVEHVFVARGLSPAVDTATTRHEQAAEGITDVRTVPFAEVLQMMRTGRI
FT                   RDGETVAAMALAALHLGRLA"
FT                   /protein_id="YP_003635298.1"
FT   misc_feature    217209..217565
FT                   /note="ADP-ribose pyrophosphatase (ADPRase) catalyzes the
FT                   hydrolysis of ADP-ribose and a variety of additional
FT                   ADP-sugar conjugates to AMP and ribose-5-phosphate. Like
FT                   other members of the Nudix hydrolase superfamily, it
FT                   requires a divalent cation, such as...; Region:
FT                   ADPRase_NUDT5; cd03424"
FT                   /db_xref="CDD:72882"
FT                   /locus_tag="Cfla_0180"
FT   misc_feature    order(217209..217211,217245..217253,217290..217292,
FT                   217302..217304,217371..217373,217437..217439)
FT                   /note="active site"
FT                   /db_xref="CDD:72882"
FT                   /locus_tag="Cfla_0180"
FT   misc_feature    order(217209..217211,217251..217253,217290..217292,
FT                   217302..217304,217371..217373)
FT                   /note="ADP-ribose binding site; other site"
FT                   /db_xref="CDD:72882"
FT                   /locus_tag="Cfla_0180"
FT   misc_feature    order(217212..217214,217227..217229,217341..217352,
FT                   217356..217358,217362..217376,217437..217439,
FT                   217455..217457,217461..217463,217500..217505,
FT                   217527..217529,217539..217541,217548..217550,
FT                   217560..217565)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:72882"
FT                   /locus_tag="Cfla_0180"
FT   misc_feature    order(217248..217259,217260..217313)
FT                   /note="nudix motif; other site"
FT                   /db_xref="CDD:72882"
FT                   /locus_tag="Cfla_0180"
FT   misc_feature    order(217290..217292,217302..217304,217437..217439)
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:72882"
FT                   /locus_tag="Cfla_0180"
FT   gene            complement(217651..218676)
FT                   /db_xref="GeneID:9144047"
FT                   /locus_tag="Cfla_0181"
FT   CDS_pept        complement(217651..218676)
FT                   /locus_tag="Cfla_0181"
FT                   /gene_family="HOG000220179" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LacI family"
FT                   /transl_table="11"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; regulatory protein LacI; KEGG:
FT                   svi:Svir_23440 transcriptional regulator, LacI family"
FT                   /db_xref="GI:296128049"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="GeneID:9144047"
FT                   /translation="MPAPERRPTLTAVAELAGVSIATASKVLNRHDVAPATRERVEAAV
FT                   AQLGYRAPGERRPEVRRTVEFLVDKLDSPYAMEVLRGVTLAAEDADADVAVSRLSRGGG
FT                   ARPTPPATWTRRLVAARRTGAIVVTAQVTETTYAAIARARLPVVVIDPLHLTTPELVSV
FT                   GSTNWSGGRTATEHLLGLGHTRIAMIGGPEVSISAVARVDGYRSACQRAGVPVDPALVR
FT                   HVAFDHDAARQTADELLRLPDPPTAVVASSDAQALGVLEAARLLGLAVPRDLSVVGYDD
FT                   TYVAAWTNPPLTCVHQPLDDIGRVALRTVLAMASGREPDSHHIELATSLVVRDSTAPPS
FT                   R"
FT                   /protein_id="YP_003635299.1"
FT   misc_feature    complement(217657..218655)
FT                   /note="Transcriptional regulators [Transcription]; Region:
FT                   PurR; COG1609"
FT                   /db_xref="CDD:31797"
FT                   /locus_tag="Cfla_0181"
FT   misc_feature    complement(218524..218640)
FT                   /note="Helix-turn-helix (HTH) DNA binding domain of the
FT                   LacI family of transcriptional regulators; Region:
FT                   HTH_LacI; cd01392"
FT                   /db_xref="CDD:143331"
FT                   /locus_tag="Cfla_0181"
FT   misc_feature    complement(order(218527..218529,218566..218568,
FT                   218575..218580,218590..218592,218599..218604,
FT                   218608..218622))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:143331"
FT                   /locus_tag="Cfla_0181"
FT   misc_feature    complement(217669..218490)
FT                   /note="Type 1 periplasmic binding fold superfamily; Region:
FT                   Periplasmic_Binding_Protein_Type_1; cl10011"
FT                   /db_xref="CDD:175057"
FT                   /locus_tag="Cfla_0181"
FT   gene            218912..219877
FT                   /db_xref="GeneID:9144048"
FT                   /locus_tag="Cfla_0182"
FT   CDS_pept        218912..219877
FT                   /locus_tag="Cfla_0182"
FT                   /gene_family="HOG000240004" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /codon_start="1"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /transl_table="11"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: art:Arth_0883 xylose isomerase domain- containing
FT                   protein"
FT                   /db_xref="GI:296128050"
FT                   /db_xref="InterPro:IPR012307"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="GeneID:9144048"
FT                   /translation="MSTPATRPTSAQWPIAAAMLPFPASQDAPADTWVDHLAEVAYEGF
FT                   TEVDLTDSWVQPGDLAPARLEELRDALVTVGLDPVALSAIRRSVIDPRTGDENLAYSHR
FT                   TIDAAAALGVRVVSVGLHRPLLPAQREAFWFWTEEGPHDPTDPETWDRAVTRLRELGRH
FT                   AAEVGVELSLEMYEDTLLGTAESAVRLVHDIGEANVGLNPDLGNLVRLHRPIEDFQAAV
FT                   AACLPVSNYWHVKSYFRDEDRATGTYVALPAPMEMGAVSYRTAIRTAVESGFTGPFCVE
FT                   HYGGDGLSVSARNARYIRRMLAVATGEARASVLAAAAAQR"
FT                   /protein_id="YP_003635300.1"
FT   misc_feature    219020..219616
FT                   /note="Xylose isomerase-like TIM barrel; Region:
FT                   AP_endonuc_2; pfam01261"
FT                   /db_xref="CDD:144742"
FT                   /locus_tag="Cfla_0182"
FT   gene            219874..220761
FT                   /db_xref="GeneID:9144049"
FT                   /locus_tag="Cfla_0183"
FT   CDS_pept        219874..220761
FT                   /locus_tag="Cfla_0183"
FT                   /gene_family="HOG000219608" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03446"
FT                   /codon_start="1"
FT                   /product="6-phosphogluconate dehydrogenase NAD-binding
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
FT                   KEGG: art:Arth_0273 6-phosphogluconate dehydrogenase,
FT                   NAD-binding"
FT                   /db_xref="GI:296128051"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9144049"
FT                   /translation="MSARVAVLGLGAMGLPMATALARTFDVVAYDIADERVGLAVEAGA
FT                   TGAASVAEACTGTDVVVVGVRDGAQLDALVLGDGGVAASLPAGAVVVVTSTVGEDAVRS
FT                   TAAALAARGILTVDAPVSGGPVRAGTGDLLVMVGADDDALAAARPVLDALSSSLTVVGG
FT                   IGAGQQLKTVNQLLCGIHTAAASEALALAHRLGLDLDACIEVLGQGAAASFMLADRGPR
FT                   IAQQLRGETPPLRSRLDVIGKDMGIVGDLTRRLKVATPVAAAAEQLYRQVSAAGLDAAD
FT                   DSVVATRLLREETW"
FT                   /protein_id="YP_003635301.1"
FT   misc_feature    219880..220740
FT                   /note="3-hydroxyisobutyrate dehydrogenase and related
FT                   beta-hydroxyacid dehydrogenases [Lipid metabolism]; Region:
FT                   MmsB; COG2084"
FT                   /db_xref="CDD:32267"
FT                   /locus_tag="Cfla_0183"
FT   misc_feature    <220207..>220392
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="Cfla_0183"
FT   gene            220755..222593
FT                   /db_xref="GeneID:9144050"
FT                   /locus_tag="Cfla_0184"
FT   CDS_pept        220755..222593
FT                   /locus_tag="Cfla_0184"
FT                   /gene_family="HOG000234158" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.7.1.29"
FT                   /codon_start="1"
FT                   /EC_number="2.7.1.29"
FT                   /transl_table="11"
FT                   /note="KEGG: msm:MSMEG_3271 dihydroxyacetone kinase; PFAM:
FT                   Dak kinase; Dak phosphatase"
FT                   /db_xref="GI:296128052"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="GeneID:9144050"
FT                   /translation="MVRPLADDPARFVDDALDGFVDLYADQVRRVPGGVVRAVAAPRSE
FT                   VAVVVGGGSGHYPAFCGLVGPGYAHGAVVGNVFTSPSTADAVSVGAAAAGDAGVLLLTG
FT                   NYAGDVMNFTLARDELRARGVTAEYLVVTDDVASAPAGDEARRRGIAGDHVVFKVAGAA
FT                   AAEGRSFDDVVAAARHANDRTRTLGVAFDGCTLPGADAPLFTVPEGTVGLGVGIHGEPG
FT                   IGEMPACTASELAAALVEPLLAERPAGAGPRVGVVLNGLGRTKYEELFVLWRAVRPLLD
FT                   AAGLQVVQPDVGELVTSLDMSGCSLTLVWLDDDLERWWCAPAHTPAYRRGVVGVAGSGR
FT                   AGSAGDEGTTVGGSSSPTAAGTPGAATVGTGATADGSSAPAASGAAQAARVVDEADAAE
FT                   ARLVVAALHRVAGTLRDLEPELGRLDAVAGDGDHGRGMVRGSSAAAAAAQAAAAAGHGA
FT                   VACLRDAGRAWADKAGGTSGVLWGAGIGAVAHALAARPVADPSARLAAAVRAGIAAVVA
FT                   LGGAQPGDKTMVDAAEPFAAALEQGAAAGQDPAVVWDAALDAALTAAQATADLRPRLGR
FT                   ARPLAERSVGTPDPGAVSFVAVAGAVRSVVVPGEGS"
FT                   /product="Glycerone kinase"
FT                   /protein_id="YP_003635302.1"
FT   misc_feature    220758..221732
FT                   /note="Dihydroxyacetone kinase [Carbohydrate transport and
FT                   metabolism]; Region: DAK1; COG2376"
FT                   /db_xref="CDD:32523"
FT                   /locus_tag="Cfla_0184"
FT   misc_feature    220776..221735
FT                   /note="dihydroxyacetone kinase subunit DhaK; Provisional;
FT                   Region: PRK14481; cl10557"
FT                   /db_xref="CDD:175227"
FT                   /locus_tag="Cfla_0184"
FT   misc_feature    222033..>222344
FT                   /note="DAK2 domain; Region: Dak2; cl03685"
FT                   /db_xref="CDD:174797"
FT                   /locus_tag="Cfla_0184"
FT   gene            222590..223105
FT                   /db_xref="GeneID:9144051"
FT                   /locus_tag="Cfla_0185"
FT   CDS_pept        222590..223105
FT                   /locus_tag="Cfla_0185"
FT                   /gene_family="HOG000226301" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02133"
FT                   /codon_start="1"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /transl_table="11"
FT                   /note="KEGG: mjl:Mjls_2600 ribose 5-phosphate isomerase;
FT                   TIGRFAM: ribose 5-phosphate isomerase; sugar- phosphate
FT                   isomerase, RpiB/LacA/LacB family; PFAM: Ribose/galactose
FT                   isomerase"
FT                   /db_xref="GI:296128053"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR011860"
FT                   /db_xref="GeneID:9144051"
FT                   /translation="MSVARIVVGADEAGLAYKDALADLLRADPRVEVVEDVGVHADDDT
FT                   AYPHVAVAAARRVAEGGADRALLVCGTGLGMAIAANKVRGVRAVTAHDTFSVQRSVLSN
FT                   DAQVLCLGQRVIGLELAKTLVREWLAHEFDPASASAAKVDAIRGYETAEPGEGSAGIDG
FT                   TARGGGSC"
FT                   /protein_id="YP_003635303.1"
FT   misc_feature    222602..223027
FT                   /note="Ribose/Galactose Isomerase; Region: LacAB_rpiB;
FT                   cl00485"
FT                   /db_xref="CDD:174235"
FT                   /locus_tag="Cfla_0185"
FT   gene            complement(223443..223772)
FT                   /db_xref="GeneID:9144052"
FT                   /locus_tag="Cfla_0186"
FT   CDS_pept        complement(223443..223772)
FT                   /locus_tag="Cfla_0186"
FT                   /gene_family="HOG000268007" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00893"
FT                   /codon_start="1"
FT                   /product="small multidrug resistance protein"
FT                   /transl_table="11"
FT                   /note="PFAM: small multidrug resistance protein; KEGG:
FT                   rop:ROP_48320 quaternary ammonium compound- resistance
FT                   protein"
FT                   /db_xref="GI:296128054"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="GeneID:9144052"
FT                   /translation="MSATSLAWVVLVLSGVLEAVWASALGRSEGFTRPGPTVLFGVALI
FT                   ASMGGLAYAMRTLPTGTSYAVWVGIGAALTVTYAMLTGTEPASLVKILLILGIVGCVIG
FT                   LKLTH"
FT                   /protein_id="YP_003635304.1"
FT   misc_feature    complement(<223509..223757)
FT                   /note="Small Multidrug Resistance protein; Region:
FT                   Multi_Drug_Res; cl00910"
FT                   /db_xref="CDD:174452"
FT                   /locus_tag="Cfla_0186"
FT   gene            complement(223910..225808)
FT                   /db_xref="GeneID:9144053"
FT                   /locus_tag="Cfla_0187"
FT   CDS_pept        complement(223910..225808)
FT                   /locus_tag="Cfla_0187"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ABC transporter related protein; PFAM: ABC
FT                   transporter related; ABC transporter transmembrane region;
FT                   SMART: AAA ATPase"
FT                   /db_xref="GI:296128055"
FT                   /db_xref="InterPro:IPR001140"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017940"
FT                   /db_xref="GeneID:9144053"
FT                   /translation="MAHPGPLPGGNPGMRGFSRDRDVARQRLAPGTLRRILAFAHPYRG
FT                   RLAVFLVLIALSAAVGAVTPWLFQRLIDDGITAGRTGTVVGIAAVVAGLAVVSAVLGVA
FT                   ERWVSARIGEGLIHDLRTAVFDHVQRMPLAFFSRAKTGALVQRLNGDVLGAQQAFTSTL
FT                   SNVVSNSLTVVFVLAAMLTMSWQLTLLSLVLVPVFVLPARWFGRRIAAITRESYELNAD
FT                   ASQTMTERFNVAGAHLVKIFGDPVRESAAYAEQTGRVRDIGVKRALYSTWFRIGLTTVA
FT                   AVATAVVYGVGGLLAIRGELTVGVVVALAAYLGRLYGPLTAMSNVQVDVMTALVSFERV
FT                   LEVLDLEPMVAEKPGATDLRTAVAARGASLDLERVGFRYPSADEVSLASLESVAALGRD
FT                   AHADTLRDVTFHVPAGAMVALVGPSGAGKTTISQLVTRMYDPTRGAVRIAGQDLRDVSA
FT                   ASLRDTVGVVSQEAHLFHDTIAGNLRFARPDATDDDIERALRAAHVWDLVASLPDGIHT
FT                   VVGDRGYRLSGGERQRLAIARLLLKAPDVVVLDEATAHLDSESEAAVQAALDEALVGRT
FT                   SLVIAHRLSTVRQADLIVVVEAGRVVQTGTHVDLLASGGLYADLYRTQFAPTATAA"
FT                   /protein_id="YP_003635305.1"
FT   misc_feature    complement(223934..225721)
FT                   /note="ABC-type multidrug transport system, ATPase and
FT                   permease components [Defense mechanisms]; Region: MdlB;
FT                   COG1132"
FT                   /db_xref="CDD:31327"
FT                   /locus_tag="Cfla_0187"
FT   misc_feature    complement(224990..225670)
FT                   /note="ABC transporter transmembrane region; Region:
FT                   ABC_membrane; cl00549"
FT                   /db_xref="CDD:174279"
FT                   /locus_tag="Cfla_0187"
FT   misc_feature    complement(223946..224701)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Cfla_0187"
FT   misc_feature    complement(224522..224545)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0187"
FT   misc_feature    complement(order(224063..224065,224156..224161,
FT                   224399..224401,224519..224527,224531..224536))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0187"
FT   misc_feature    complement(224399..224410)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0187"
FT   misc_feature    complement(224204..224233)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0187"
FT   misc_feature    complement(224156..224173)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0187"
FT   misc_feature    complement(224138..224149)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0187"
FT   misc_feature    complement(224057..224077)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0187"
FT   gene            225918..226472
FT                   /db_xref="GeneID:9144054"
FT                   /locus_tag="Cfla_0188"
FT   CDS_pept        225918..226472
FT                   /locus_tag="Cfla_0188"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, MarR family"
FT                   /transl_table="11"
FT                   /note="KEGG: transcriptional regulator, MarR family; PFAM:
FT                   regulatory protein MarR; SMART: regulatory protein MarR"
FT                   /db_xref="GI:296128056"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9144054"
FT                   /translation="MQQRTDGHHDDGHDGAPTSRTASSDPATSTVRHLRPGRDPERPLP
FT                   PAEELLELLHDVLRAVRRDTADRLGPGAAPGQLRMLRVLDRCERPCRLGELAEALDVAP
FT                   RSVTTKVDQAEADGWIRRIPDPRDRRATLVELTDAGHDLLDRAARQRHAGVRARLDALD
FT                   PDEQRTLLDLLRRVAGATPGD"
FT                   /protein_id="YP_003635306.1"
FT   misc_feature    226140..226418
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Cfla_0188"
FT   gene            226528..226941
FT                   /db_xref="GeneID:9144055"
FT                   /locus_tag="Cfla_0189"
FT   CDS_pept        226528..226941
FT                   /locus_tag="Cfla_0189"
FT                   /gene_family="HOG000237035" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bcav_0166"
FT                   /codon_start="1"
FT                   /product="glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /transl_table="11"
FT                   /note="KEGG: bcv:Bcav_0166 glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="GI:296128057"
FT                   /db_xref="GeneID:9144055"
FT                   /translation="MADRPRLSVTSVTVGSPDPRASARFWAQLLGHRITADDPPGPDEP
FT                   AEGGWARVSPPAGVDGLTLAFEHERQWRPPVWPARPGEQLATQHVDVHVRDGDLDAAVA
FT                   WAVACGARLAEHQPQDDVRVLFAPDGHPFCLFL"
FT                   /protein_id="YP_003635307.1"
FT   gene            227058..227726
FT                   /db_xref="GeneID:9144056"
FT                   /locus_tag="Cfla_0190"
FT   CDS_pept        227058..227726
FT                   /locus_tag="Cfla_0190"
FT                   /gene_family="HOG000224718" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Mflv_2737"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mgi:Mflv_2737 hypothetical protein"
FT                   /db_xref="GI:296128058"
FT                   /db_xref="GeneID:9144056"
FT                   /translation="MPMTVHLIVHRTNICTVSVDALTRISRAPMRTVRARDLADVYAYP
FT                   APALADLARRDLVRRLAHGVYCAVPPEHVGTGWFPTVEAAAAAVATAFYGDRVPVLTGV
FT                   SAARVHQAWPRAVSDGYVAVPARHRPLSLADRPGAIRFVTRAVETLDAVAVPTELGAAL
FT                   VTTPEQTVLDLARSDPHGDVADVEAAIDAMWDTCDVQVLAGIAARHRMRATFERVAADR
FT                   "
FT                   /protein_id="YP_003635308.1"
FT   gene            227723..228475
FT                   /db_xref="GeneID:9144057"
FT                   /locus_tag="Cfla_0191"
FT   CDS_pept        227723..228475
FT                   /locus_tag="Cfla_0191"
FT                   /gene_family="HOG000224720" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08843"
FT                   /codon_start="1"
FT                   /product="Domain of unknown function DUF1814"
FT                   /transl_table="11"
FT                   /note="PFAM: Domain of unknown function DUF1814; KEGG:
FT                   mva:Mvan_3801 hypothetical protein"
FT                   /db_xref="GI:296128059"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="GeneID:9144057"
FT                   /translation="MSTQIEEWHRVAAQFGVGTEQVRRDHLISHVLAALASSLSTDDVV
FT                   FFGGTALSRTFLVDARLSEDVDLIALAPRTDVARAIEVAVARGLARTHGRVSWRPALTA
FT                   TMGSRPAVLVAGESLGVQVQLVPGSGYLWPTEVRAIEQRYADAPAARLRTLTAPGFAAA
FT                   KLAAWMDRGASRDLYDMWALSERGYIGPEAVDVFRRVGPTARAPENWVFSSGPTQSSWE
FT                   HDLAHQTVLRVTASEALARVADAWARAR"
FT                   /protein_id="YP_003635309.1"
FT   misc_feature    227846..>228319
FT                   /note="Domain of unknown function (DUF1814); Region:
FT                   DUF1814; cl00973"
FT                   /db_xref="CDD:154118"
FT                   /locus_tag="Cfla_0191"
FT   gene            complement(228501..229376)
FT                   /db_xref="GeneID:9144058"
FT                   /locus_tag="Cfla_0192"
FT   CDS_pept        complement(228501..229376)
FT                   /locus_tag="Cfla_0192"
FT                   /gene_family="HOG000241610" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04307"
FT                   /codon_start="1"
FT                   /product="membrane-bound metal-dependent hydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: membrane-bound metal-dependent hydrolase;
FT                   KEGG: membrane-bound metal-dependent hydrolase"
FT                   /db_xref="GI:296128060"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="GeneID:9144058"
FT                   /translation="MKGAHHALCGAAAWVAVASTAPWTLGWYPTSPLGVLTGALVCAGA
FT                   ALAPDADHHDATVANSLRPVSQWVCDVVGKVSGGHRNGTHSLLGIAALTGVAWAAGQVT
FT                   VATEALGDLAVGAGLMSVLLVAFAAQALRLTRRRRDSWPLALALAAFITVAAPTEWDWL
FT                   PVAVGLGAAVHVAGDMLTDAGVPLLWPWEPRPPRWWRRTPVLDEVWSRGGHFAVPVLGT
FT                   TGSWRERALVAPLTAYAAYGTGVAVVVGGLTALGYDAGAVVDRWWDAAEELVGGATAVG
FT                   AVALQVVAPG"
FT                   /protein_id="YP_003635310.1"
FT   gene            229596..230171
FT                   /db_xref="GeneID:9144059"
FT                   /locus_tag="Cfla_0193"
FT   CDS_pept        229596..230171
FT                   /locus_tag="Cfla_0193"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hsl:OE3596F potassium channel protein"
FT                   /db_xref="GI:296128061"
FT                   /db_xref="GeneID:9144059"
FT                   /translation="MTTQLGDTATHPSPAVYLPGPGPRAGAALNMVVAVGALVGGVVGL
FT                   VVEVGNGFTGTAQRYGSEFPVWIVWAAGVALGGWMLVQRARRAPWYRGWSMIEMVERPD
FT                   GIVLFVGRLGRRHEGLQVNRGETVTLSADQASRTTFHYVVSTRSGSMTFSADGYVHKLT
FT                   MQPLEEAAARHGITVLTTGHADRIPRRV"
FT                   /protein_id="YP_003635311.1"
FT   gene            230246..230866
FT                   /db_xref="GeneID:9144060"
FT                   /locus_tag="Cfla_0194"
FT   CDS_pept        230246..230866
FT                   /locus_tag="Cfla_0194"
FT                   /gene_family="HOG000094755" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /codon_start="1"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /transl_table="11"
FT                   /note="KEGG: kra:Krad_2275 RNA polymerase, sigma-24
FT                   subunit, ECF subfamily; TIGRFAM: RNA polymerase sigma
FT                   factor, sigma-70 family; PFAM: Sigma-70 region 4 type 2;
FT                   sigma-70 region 2 domain protein"
FT                   /db_xref="GI:296128062"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="GeneID:9144060"
FT                   /translation="MSPPPPGDADARRVRFTDLFDRTHAPLLAYAVRRVADPADAADVV
FT                   AETFLVAWRRLDDVPAGEAARPWLYGVARRVLANHYRGERRRLALADRLREQVVEAVAP
FT                   HEPVDPVLLRAMDALPPDDRELLRLVAWEELARDEIALVLGVPRATVRVRLHRARRRLM
FT                   AQLAALGEAREDPDPPPTVQRTDDIGHVRSGWASARPGPQEAR"
FT                   /protein_id="YP_003635312.1"
FT   misc_feature    230291..230686
FT                   /note="RNA polymerase sigma factor, sigma-70 family;
FT                   Region: sigma70-ECF; TIGR02937"
FT                   /db_xref="CDD:163078"
FT                   /locus_tag="Cfla_0194"
FT   misc_feature    230579..>230686
FT                   /note="Sigma70, region (SR) 4 refers to the most C-terminal
FT                   of four conserved domains found in Escherichia coli (Ec)
FT                   sigma70, the main housekeeping sigma, and related
FT                   sigma-factors (SFs). A SF is a dissociable subunit of RNA
FT                   polymerase, it directs bacterial...; Region: Sigma70_r4;
FT                   cl01055"
FT                   /db_xref="CDD:174508"
FT                   /locus_tag="Cfla_0194"
FT   gene            230863..232035
FT                   /db_xref="GeneID:9144061"
FT                   /locus_tag="Cfla_0195"
FT   CDS_pept        230863..232035
FT                   /locus_tag="Cfla_0195"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sgr:SGR_3470 putative AfsR-like
FT                   transcriptional regulator"
FT                   /db_xref="GI:296128063"
FT                   /db_xref="GeneID:9144061"
FT                   /translation="MNDDLVRRLRAADPAARLHLRADDAMREAIMTTDVTTDRAAQVAR
FT                   GRRLRRGLVSGGLATVLVGGGVAYAGVVNDWYRGGGAHDGLTCLTQWGGPEDERSGGPV
FT                   LSGDLVADCRRYQEETGLAAIEDAVAFRHQGVLYVAPRGEVPADATLVAAGPDDLALQE
FT                   LESSLMDWVDGLGSLCLDESAAVAAARAELDRLGLDDWSVRTQASVPVGAGQEPDPGAG
FT                   SCADITYAYDTADEEVVDPGLPDPVAEPADAPVPSAHPESVPSGARPKTPASTTSASAA
FT                   PAPSPTAGDLEWPYGQVPRTLAVLPHSRAPRDSLREHSVPFVYDLRDLLRERVADACVE
FT                   LDEAERIVTEAIGDEHHWPTVVIEDGEVQCTRVDLAVGGSIQVSLRGPRG"
FT                   /protein_id="YP_003635313.1"
FT   gene            232185..233639
FT                   /db_xref="GeneID:9144062"
FT                   /locus_tag="Cfla_0196"
FT   CDS_pept        232185..233639
FT                   /locus_tag="Cfla_0196"
FT                   /gene_family="HOG000237181" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00282"
FT                   /codon_start="1"
FT                   /product="Pyridoxal-dependent decarboxylase"
FT                   /transl_table="11"
FT                   /note="PFAM: Pyridoxal-dependent decarboxylase; KEGG:
FT                   pyridoxal-dependent decarboxylase"
FT                   /db_xref="GI:296128064"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="GeneID:9144062"
FT                   /translation="MHELLSAASADAYVDAMRGTVDRVATRFRTTTQPFSGASREQLQA
FT                   LVDAVDLDAPGRGTPAALREIDELFAQHAVWFHDPAYTAHLNCPVALPAVAAEAVLAAV
FT                   NPSVDTYDQSTVGTLMERRLVAWTARRIGFLAGGGVFTSGGTQSNLQALLLAREHALAT
FT                   APGVRASDLVVLATASSHFSVQRAAYLLGLAPDAVRLVPVDERGRMRPDALRIALRHVA
FT                   DDGRYTAAVVATAGTTDRGCLDPLADVADMCDAADVWLHVDAAYGCGLLVSRTRRHLLD
FT                   GIERARSVTVDFHKAFFQPVSSSALVVRHTADLRLVAHHHDYLNPAGEDEPNQVDVSLQ
FT                   TTRRFDALKLWATLRALGADRLGEMVDATIDLAAAVHDLVADDPDLRLLAPTDLSTVLF
FT                   RYQPDGLDDAHADALVGEVRRVLFGSGRALVARTTLDGRPCLKLTLLNPATTVADVRHV
FT                   LELVRQTAAALVERDDLLRPDAAVAL"
FT                   /protein_id="YP_003635314.1"
FT   misc_feature    232284..233546
FT                   /note="Glutamate decarboxylase and related PLP-dependent
FT                   proteins [Amino acid transport and metabolism]; Region:
FT                   GadB; COG0076"
FT                   /db_xref="CDD:30425"
FT                   /locus_tag="Cfla_0196"
FT   misc_feature    232434..233576
FT                   /note="Aspartate aminotransferase (AAT) superfamily (fold
FT                   type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine intermediate, which depending on
FT                   the reaction, is the...; Region: AAT_I; cl00321"
FT                   /db_xref="CDD:176816"
FT                   /locus_tag="Cfla_0196"
FT   misc_feature    order(232617..232622,232629..232631,232884..232886,
FT                   232971..232973,232980..232982,233058..233060,
FT                   233067..233069)
FT                   /note="pyridoxal 5'-phosphate binding pocket; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="Cfla_0196"
FT   misc_feature    233067..233069
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="Cfla_0196"
FT   gene            233636..235006
FT                   /db_xref="GeneID:9144063"
FT                   /locus_tag="Cfla_0197"
FT   CDS_pept        233636..235006
FT                   /locus_tag="Cfla_0197"
FT                   /gene_family="HOG000237192" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:1.14.13.59"
FT                   /codon_start="1"
FT                   /EC_number="1.14.13.59"
FT                   /transl_table="11"
FT                   /note="KEGG: L-lysine 6-monooxygenase (NADPH)"
FT                   /db_xref="GI:296128065"
FT                   /db_xref="GeneID:9144063"
FT                   /translation="MSAAQVRPDAPVHDLVGVGIGPFNLGLAALAAPLDLDAVFLDRAD
FT                   EFRWHPGMMLEGATIQVPFLADLVTMADPTSPYSFLAWLKATGRLYAFYIRESFYPLRA
FT                   EYDAYCRWVAEQLPALRWGRTVTSVEVDPHDADLYVVHAATASGVESYRTRHVVLGVGT
FT                   QPVVPAALRDLPGPAVHSADYLTHRDALQAAGSVTVVGSGQSAAEVYRDLLEATGPGGP
FT                   RLDWVTRSPRFFPMEYTKLTLEMTSPEYTDHFHALPAELRDRLTREQRGLYKGISGDLV
FT                   DDIYDTLYRKSATGAVPTTLLSDTEVLGATWDGERYTLRLRHAQLGVEHERTTDALVLA
FT                   TGYAAQVPDVVLGIAHRLAWDDRGRLDVARDYSVDGGRRRVFVQNGEEHTHGLTAPDLG
FT                   FGAWRSSAILAAVCGREVYPREQRIAFQEFGVPTGAHPAPAGTVTAPLATAADGTPR"
FT                   /product="L-lysine 6-monooxygenase (NADPH)"
FT                   /protein_id="YP_003635315.1"
FT   misc_feature    233669..234952
FT                   /note="Lysine/ornithine N-monooxygenase [Secondary
FT                   metabolites biosynthesis, transport, and catabolism];
FT                   Region: IucD; COG3486"
FT                   /db_xref="CDD:33289"
FT                   /locus_tag="Cfla_0197"
FT   gene            235003..235632
FT                   /db_xref="GeneID:9144064"
FT                   /locus_tag="Cfla_0198"
FT   CDS_pept        235003..235632
FT                   /locus_tag="Cfla_0198"
FT                   /gene_family="HOG000237194" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Xcel_1801"
FT                   /codon_start="1"
FT                   /product="IucA/IucC family protein"
FT                   /transl_table="11"
FT                   /note="KEGG: IucA/IucC family protein"
FT                   /db_xref="GI:296128066"
FT                   /db_xref="GeneID:9144064"
FT                   /translation="MTGWRGQPTEPLSAETVRDEAWKHIGPIRLDRVVPERDALALHHW
FT                   LTHPSSAFWQMTELGLDEVLAYSRRVADATDEHAWIGRIGGRPRFMVETYDPSRVLLAG
FT                   LYRARTGDVGMHLLTAPAEGPRLHGLTDAVMAATMRFCFRTLRAQRVVVEPDVRNTAIA
FT                   AKNAAAGFRVVREIDLPGKRAALSVCTREDFAASRLGARTIHEDPR"
FT                   /protein_id="YP_003635316.1"
FT   misc_feature    235090..235551
FT                   /note="Acetyltransferases, including N-acetylases of
FT                   ribosomal proteins [Translation, ribosomal structure and
FT                   biogenesis]; Region: RimL; COG1670"
FT                   /db_xref="CDD:31856"
FT                   /locus_tag="Cfla_0198"
FT   gene            235629..237437
FT                   /db_xref="GeneID:9144065"
FT                   /locus_tag="Cfla_0199"
FT   CDS_pept        235629..237437
FT                   /locus_tag="Cfla_0199"
FT                   /gene_family="HOG000237215" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04183"
FT                   /codon_start="1"
FT                   /product="IucA/IucC family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: IucA/IucC family protein; KEGG: IucA/IucC
FT                   family protein"
FT                   /db_xref="GI:296128067"
FT                   /db_xref="InterPro:IPR007310"
FT                   /db_xref="GeneID:9144065"
FT                   /translation="MTLTAVAPAPVRPHTADHLTPEHMAAAQRHLVTKALAEFAHERLI
FT                   APALDRTVPADGDVRAYVLTLDAPDGHRAVYRFRARRLALEHWAIDAASLEREVDGSPA
FT                   PLDVQDLVLELQPLLQVPDDMLPLYLEELASTLASHAYRRARPQPTVAELLDADLLTVE
FT                   SAMTEGHPCFVANNGRIGFGVSEHAAYAPEAAQPVRLLWLGVRRAVSHVATGEGLSEET
FT                   LYRHELDDATRDAFAARLRDLGLDPAEYRYLPVHPWQWEHRLAITFAPDVARRDLVLLG
FT                   ESDDTYRPQQSVRTLMNVDRPDRHYVKTAVAIQNMGFLRGLSPYYMRTTPAINDWVASL
FT                   VDTDTELAACGVRLLRERASIGYTGDAYHRTAEPSKHRAMVAALWREQPVLAPGQRATT
FT                   MAALLHRDAAGDAYATAAVRASGLDPVDWLRAYLRVYLRPLVHCLRAYDLAFMPHGENV
FT                   ILVWEDHVPVGAFLKDIGEEIAVLSDRPLPEDVERVRTVVDDEEKALAIFTDVFDGVLR
FT                   HLAAVLVTDGVLAEDAFWDLVAETIDAHLADHPDLPSGVDLRAPRFKHSCLNRLQLRNT
FT                   EHMVDLTDLSGSLIYAGTLANPVARS"
FT                   /protein_id="YP_003635317.1"
FT   misc_feature    235656..237431
FT                   /note="Siderophore synthetase component [Secondary
FT                   metabolites biosynthesis, transport, and catabolism];
FT                   Region: RhbC; COG4264"
FT                   /db_xref="CDD:33987"
FT                   /locus_tag="Cfla_0199"
FT   misc_feature    236094..236849
FT                   /note="IucA / IucC family; Region: IucA_IucC; pfam04183"
FT                   /db_xref="CDD:146691"
FT                   /locus_tag="Cfla_0199"
FT   misc_feature    236907..237350
FT                   /note="Ferric iron reductase FhuF-like transporter; Region:
FT                   FhuF; pfam06276"
FT                   /db_xref="CDD:148091"
FT                   /locus_tag="Cfla_0199"
FT   gene            237440..239668
FT                   /db_xref="GeneID:9144066"
FT                   /locus_tag="Cfla_0200"
FT   CDS_pept        237440..239668
FT                   /locus_tag="Cfla_0200"
FT                   /gene_family="HOG000093944" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01804"
FT                   /codon_start="1"
FT                   /product="peptidase S45 penicillin amidase"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase S45 penicillin amidase; KEGG:
FT                   penicillin amidase"
FT                   /db_xref="GI:296128068"
FT                   /db_xref="InterPro:IPR002692"
FT                   /db_xref="InterPro:IPR014395"
FT                   /db_xref="GeneID:9144066"
FT                   /translation="MSHGPDVRFEVFRDTWGVPHVRADDELTLAHGQGWVTARDRTWQV
FT                   QTDRWRAEGRLAEHIGAGGVAWDVVAHRLDLPGLAQRAYDALADDDRAWVDSYTAGVNA
FT                   GLASADRPVEVDELDRVLGGTTPDDPWPAWAPLGVFLVNHALFSTFPRVLWHDHVVRAA
FT                   RGSDLLADVDPLELVRLFDPSGDGPTSGSNAWALHGSRTASGAPLLAGDPHRVLELPGP
FT                   YQQIRLACGEYDVLGLAFPGVPGLPHFGHTGPAAWGITNAVAHSAETYRELLLHDGDAW
FT                   RAIGPDGSEPVDVRTVQVRVRGGEALTVEALRTARGPVVVRGMPPGRAVDQDGVATGPV
FT                   PLAGLEEGRSVRLQAAEDADLGFACLRPLLRARTARDVADALAGWIDPVNRVVAADADG
FT                   DVLTFDAGRVADRAPDDRWLSLRAWDATHAPRPWRRLAAPVVVDGFAVDANDRPLSADR
FT                   DHGAVYSPDRGERIRSLLAGRASWDVPDMAAVHGDTHWGGAARLLRHVAGLDGLSAEAA
FT                   AVRDRLLAWDLHMDANSAEAALLADLRAALVARLVEEPALRALDAPHHAGPAFDAWFSL
FT                   RGRIGAALPALLGRADLGIDGPAHVRAALESVAAGGVGGTWGDRHTVLPAHVLADVPGA
FT                   VVPGVPALPLGGDQDTVRCTGTVPGVTDRAFRGSVARWVWDLGDRSRSRWGVPFGSSGD
FT                   PRSPHFADQHATWAVAGTVEVVTDWETLSPEPLPPQVGVRGAGERTPG"
FT                   /protein_id="YP_003635318.1"
FT   misc_feature    237467..239605
FT                   /note="Penicillin amidase; Region: Penicil_amidase;
FT                   pfam01804"
FT                   /db_xref="CDD:145130"
FT                   /locus_tag="Cfla_0200"
FT   misc_feature    237470..>237625
FT                   /note="The Ntn hydrolases (N-terminal nucleophile) are a
FT                   diverse superfamily of of enzymes that are activated
FT                   autocatalytically via an N-terminally lcated nucleophilic
FT                   amino acid.  N-terminal nucleophile (NTN-) hydrolase
FT                   superfamily, which contains a four-...; Region:
FT                   Ntn_hydrolase; cl00467"
FT                   /db_xref="CDD:174223"
FT                   /locus_tag="Cfla_0200"
FT   misc_feature    238013..238918
FT                   /note="Penicillin G acylase (PGA) belongs to a family of
FT                   beta-lactam acylases that includes cephalosporin acylase
FT                   (CA) and aculeacin A acylase. PGA and CA are crucial for
FT                   the production of backbone chemicals like
FT                   6-aminopenicillanic acid and 7-...; Region: Ntn_PGA_like;
FT                   cd03747"
FT                   /db_xref="CDD:73357"
FT                   /locus_tag="Cfla_0200"
FT   misc_feature    order(238013..238015,238082..238084,238184..238186,
FT                   238220..238222,238226..238228,238535..238537,
FT                   238607..238609,238787..238789)
FT                   /note="active site"
FT                   /db_xref="CDD:73357"
FT                   /locus_tag="Cfla_0200"
FT   gene            complement(239696..240670)
FT                   /db_xref="GeneID:9144067"
FT                   /locus_tag="Cfla_0201"
FT   CDS_pept        complement(239696..240670)
FT                   /locus_tag="Cfla_0201"
FT                   /gene_family="HOG000237888" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Arth_0926"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: art:Arth_0926 hypothetical protein"
FT                   /db_xref="GI:296128069"
FT                   /db_xref="GeneID:9144067"
FT                   /translation="MTLDGALLDWLLDSDPALRWQVERDLAGAPAAVWRATRARVATEG
FT                   FGARLLALQDADGQWAGGAYFPGGFDFDGPEAQPGAGQPWTATTWTLNTLRDWGLDAAA
FT                   LAGTADRLQQHSRWEYNDEPYWNGEVDCCINAFTLANGAWLGADVTALAEWFPAHRLPD
FT                   GGWNCEWVEGSTRSSVHSTLNTVKGLLAYEAMTGGTDVLRDARHAGEEYLLQRRLLRRV
FT                   TTGEPLGPWVTVLSYPFRWRFSTLNALDHFRAAALHDGTPPDPRLADAVETVRTARQPD
FT                   GTWLQQDRLPGKAWFEVDVPAGEPSRWLTFHAARVLAWWDAAA"
FT                   /protein_id="YP_003635319.1"
FT   gene            240728..241123
FT                   /db_xref="GeneID:9144068"
FT                   /locus_tag="Cfla_0202"
FT   CDS_pept        240728..241123
FT                   /locus_tag="Cfla_0202"
FT                   /gene_family="HOG000029676" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /codon_start="1"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /transl_table="11"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: fra:Francci3_0152 DNA polymerase"
FT                   /db_xref="GI:296128070"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="GeneID:9144068"
FT                   /translation="MGRPAPPESPWRCRWGEETTTSRRGWATTSLFAMIRVDERQHHAL
FT                   VELCARYGFARLEVFGSVARGEDRADSDIDVLYDLLPGRHLTWEVVDAADEMAEILGRP
FT                   VDLVSRRAVHPLLRERIETEARALYAA"
FT                   /protein_id="YP_003635320.1"
FT   misc_feature    240842..241114
FT                   /note="Nucleotidyltransferase (NT) domain of Staphylococcus
FT                   aureus kanamycin nucleotidyltransferase, and similar
FT                   proteins; Region: NT_KNTase_like; cd05403"
FT                   /db_xref="CDD:143393"
FT                   /locus_tag="Cfla_0202"
FT   misc_feature    order(240905..240913,240920..240922,240941..240946,
FT                   240950..240952,241037..241039,241043..241045)
FT                   /note="active site"
FT                   /db_xref="CDD:143393"
FT                   /locus_tag="Cfla_0202"
FT   misc_feature    order(240905..240913,240920..240922,240941..240946,
FT                   240950..240952)
FT                   /note="NTP binding site; other site"
FT                   /db_xref="CDD:143393"
FT                   /locus_tag="Cfla_0202"
FT   misc_feature    order(240944..240946,240950..240952,241043..241045)
FT                   /note="metal binding triad; metal-binding site"
FT                   /db_xref="CDD:143393"
FT                   /locus_tag="Cfla_0202"
FT   misc_feature    order(241037..241039,241043..241045)
FT                   /note="antibiotic binding site; other site"
FT                   /db_xref="CDD:143393"
FT                   /locus_tag="Cfla_0202"
FT   gene            241113..241451
FT                   /db_xref="GeneID:9144069"
FT                   /locus_tag="Cfla_0203"
FT   CDS_pept        241113..241451
FT                   /locus_tag="Cfla_0203"
FT                   /gene_family="HOG000219663" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01934"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF86"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF86; KEGG:
FT                   fra:Francci3_0153 hypothetical protein"
FT                   /db_xref="GI:296128071"
FT                   /db_xref="InterPro:IPR008201"
FT                   /db_xref="GeneID:9144069"
FT                   /translation="MRPDLLFVAEMIDAAARIAALTSGLDAAAVERDLTVRDALLWNFT
FT                   VLGEAANQVSQETRAQHPQVPWRRAAGLRNRIVHGYWSADVDVLVSTAHDVIPDLLVQL
FT                   DTVRDSLR"
FT                   /protein_id="YP_003635321.1"
FT   misc_feature    241173..241448
FT                   /note="Protein of unknown function DUF86; Region: DUF86;
FT                   cl01031"
FT                   /db_xref="CDD:154157"
FT                   /locus_tag="Cfla_0203"
FT   gene            241548..242084
FT                   /db_xref="GeneID:9144070"
FT                   /locus_tag="Cfla_0204"
FT   CDS_pept        241548..242084
FT                   /locus_tag="Cfla_0204"
FT                   /gene_family="HOG000252320" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04229"
FT                   /codon_start="1"
FT                   /product="protein of unknown function UPF0157"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function UPF0157; KEGG:
FT                   gau:GAU_2960 hypothetical protein"
FT                   /db_xref="GI:296128072"
FT                   /db_xref="InterPro:IPR007344"
FT                   /db_xref="GeneID:9144070"
FT                   /translation="MRVFVVPYDECWPSAFESVRRELVAALAPGTVSAIEHVGSTAVPG
FT                   LPAKPVIDVDVVADEAQLAGVIAALCAAGYVHRGERGIPGRHAFESPPHGVPRHVYVCV
FT                   EGCLALRNHLAVRDVLRNDPLLRAEYAAVKEALAGRDLASVEEYVAGKTAVLQQVLKAS
FT                   GMTAHELESVASMNA"
FT                   /protein_id="YP_003635322.1"
FT   misc_feature    241551..242030
FT                   /note="Uncharacterized protein family (UPF0157); Region:
FT                   UPF0157; cl00987"
FT                   /db_xref="CDD:154127"
FT                   /locus_tag="Cfla_0204"
FT   gene            complement(242264..242533)
FT                   /db_xref="GeneID:9144071"
FT                   /locus_tag="Cfla_0205"
FT   CDS_pept        complement(242264..242533)
FT                   /locus_tag="Cfla_0205"
FT                   /gene_family="HOG000057257" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:KRH_22940"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: krh:KRH_22940 hypothetical protein"
FT                   /db_xref="GI:296128073"
FT                   /db_xref="GeneID:9144071"
FT                   /translation="MPRSLDEIMAQADDLADRFESYEPEPGDRDTVSPLTQLRLAALKR
FT                   AEAEREIAEAVANARRSDTSWKVIGAAVGTSGEAARQRYGKRAS"
FT                   /protein_id="YP_003635323.1"
FT   gene            complement(242539..242769)
FT                   /db_xref="GeneID:9144072"
FT                   /locus_tag="Cfla_0206"
FT   CDS_pept        complement(242539..242769)
FT                   /locus_tag="Cfla_0206"
FT                   /gene_family="HOG000101876" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro11304"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rha:RHA1_ro11304 hypothetical protein"
FT                   /db_xref="GI:296128074"
FT                   /db_xref="GeneID:9144072"
FT                   /translation="MDSEPIVLHSAYRHGVSEESIKHALRNHVDLFDVGDGMTMVIGPD
FT                   RSGGLIEVGVVERYDDLYVVHAMPARPKFLR"
FT                   /protein_id="YP_003635324.1"
FT   gene            complement(242918..245242)
FT                   /db_xref="GeneID:9144073"
FT                   /locus_tag="Cfla_0207"
FT   CDS_pept        complement(242918..245242)
FT                   /locus_tag="Cfla_0207"
FT                   /gene_family="HOG000217684" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02754"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF224 cysteine-rich
FT                   region domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF224 cysteine-
FT                   rich region domain protein; KEGG: kse:Ksed_26190 Fe-S
FT                   oxidoreductase"
FT                   /db_xref="GI:296128075"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012285"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="GeneID:9144073"
FT                   /translation="MDGLQVTALVLAAVATVVGVAAFARGVVVIVRTVRTGRPLPGRWS
FT                   PVGPRLTNLVREVLGHGRFQQRPVVRVAHWLVMVSFPVLVVTLLTGYGQLVDPRYGLPL
FT                   VGHWLPMEWAVEAFAWLGLLGIGALIVLRQRVRPRASQPEAEQRRSRFFGSNQVWAYVV
FT                   EATVLLVVLAVLVLRGLEYALGVQDGEAWATAAHFPLTAWFGASWVPVAAGTLETAVVV
FT                   VALVKILVSMTWFVVVGLAPTMGVAWHRFLAVVNVYARREVDGSPALGPLVPLRDPAGE
FT                   ALDLTAVEDLPDDAVLGVRAVEDLPWKGLLDVATCTECGRCQDQCPAWATGKPLSPKLL
FT                   TLALRDQAAATAPYVRAARAAGASPEAAADPHLGVDLVASGVIDPDVLWACTMCGACVQ
FT                   QCPVDIEHVDTIVDIRRYQTLMESAFPAELGGTFTKLERRGNPWGLPARQRLEWAKGLE
FT                   FDVPVVGVDVESAAEVDWLFWVGCAGAFEDRAKRTTRAVAELLHAAGVTFAVLGDGETC
FT                   TGDPARRAGNELLYQTLAVQNVETLTEAGATRVVVTCAHCFNTLSREYPAMGGRYEVVH
FT                   HTQLLDTLVREGRLRFAPGVGEDADGATVTYHDPCYLGRHNQVYSPPRDLLAAAGVTLA
FT                   EMPRNRETSFCCGAGGARMWMEETIGERIGTVRAAEAVATGASAIATACPFCTVMLHDG
FT                   VAAQARASAEADGSGAQGSGAGPAADGSTPDATGTHPTPGAATTGANAPAGPGAPAARG
FT                   QVGVPEVADIAVLLRDRLTTD"
FT                   /protein_id="YP_003635325.1"
FT   misc_feature    complement(243158..244324)
FT                   /note="Fe-S oxidoreductase [Energy production and
FT                   conversion]; Region: GlpC; COG0247"
FT                   /db_xref="CDD:30596"
FT                   /locus_tag="Cfla_0207"
FT   misc_feature    complement(243560..243742)
FT                   /note="Cysteine-rich domain; Region: CCG; pfam02754"
FT                   /db_xref="CDD:111630"
FT                   /locus_tag="Cfla_0207"
FT   misc_feature    complement(243170..243364)
FT                   /note="Cysteine-rich domain; Region: CCG; pfam02754"
FT                   /db_xref="CDD:111630"
FT                   /locus_tag="Cfla_0207"
FT   gene            245637..248753
FT                   /db_xref="GeneID:9144074"
FT                   /locus_tag="Cfla_0208"
FT   CDS_pept        245637..248753
FT                   /locus_tag="Cfla_0208"
FT                   /gene_family="HOG000066204" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00361"
FT                   /codon_start="1"
FT                   /product="NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /transl_table="11"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   NADH-Ubiquinone oxidoreductase (complex I) chain 5/L domain
FT                   protein; Na+/H+ antiporter MnhB subunit-related protein;
FT                   KEGG: NADH dehydrogenase (quinone)"
FT                   /db_xref="GI:296128076"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003916"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="GeneID:9144074"
FT                   /translation="MLLLLILHLAAALVAPLLFTWLGRRAFWTLALAPASAAVWALTQT
FT                   AEVQAGDGPVQVVEWIPALGIELSFRLDTLSWLMTVVVGGVGALVLVYCAAYFSPTASG
FT                   LGRFGGVFTAFAGSMLGLVTADDLLLMFMFWELTTVTSYLLIGHYADRKASRRAAMQAI
FT                   IVTTAGGLAMLVGVVILGHAAGTYSMSALVTDPPAASPAIIAAVACLLAGAATKSALIP
FT                   FHFWLPAAMAAPTPVSAYLHAAAMVKAGVYLVARFAPAFAELPVWRWTVVVLGGGTLLL
FT                   GGYRALRQHDLKLVLAFGTVSQLGLIILLVGLGTQATALAGLAMLGAHAMFKAALFLVV
FT                   GTVDVACGTRDLRRLSGVGRALPWTALAGGLATASMIGLPPFAGYVAKEAGLEALVHLE
FT                   DGTIGTVVLTVVVLGSALTVAYGLRFWWGAFATKPALVPQSQTQDEQGVATTTSLAAGG
FT                   DESVEPAPVSRPSFLLTAPALVLAFLGVAVALLPQLGEHLLAPYAATYPLGEPGHLVLW
FT                   GGFGLVLWLTVGVLGVGGLLFLVRDRAERWQARAPHVFEADLTYRRSMRKLDDVAADVT
FT                   AVTQRGSLPLYLGVILFTWVAAVGTALLAGTSLQVETRPWDYAAQTIFAAAAIVAAILV
FT                   ARARRRLKAVILAGISGYATAGMFLLYGAPDLAVTQVLVETITLVVFVLVLRRLPPYFS
FT                   DRPLAGSRWLRLGLGLAVGLTVAGVALVAPSARVHAPVSTDFATEAYEFGGGKNIVNVT
FT                   LVDIRAWDTMGELSVLLVAATGVASLVFLSARGGRIFREREAPADRAVWGGTPDPMAAL
FT                   RRPGTAPGTTAPTGAQAIDGGAPATPSRGTGRAVGSRAREWLRAGRTVAPQRRSVIFEV
FT                   VVRLLFHTMIVYSAFLLFSGHNQPGGGFAAGLVTGIALAVRYLAGGRYELGEAAPVQPG
FT                   VLLGMGLFLSAGVGLAALFVGGNVLESWILEFRLPVWGDVKLVTSLFFDVGVYLVVVGL
FT                   VLDILRSVGAEIDRRAETGEDEVAEHAVSGYDHVVVARGSGSTGEGTAP"
FT                   /protein_id="YP_003635326.1"
FT   misc_feature    245691..248678
FT                   /note="putative monovalent cation/H+ antiporter subunit A;
FT                   Reviewed; Region: PRK12644"
FT                   /db_xref="CDD:171625"
FT                   /locus_tag="Cfla_0208"
FT   misc_feature    246009..246821
FT                   /note="NADH-Ubiquinone/plastoquinone (complex I), various
FT                   chains; Region: Oxidored_q1; cl14187"
FT                   /db_xref="CDD:175557"
FT                   /locus_tag="Cfla_0208"
FT   misc_feature    <247827..247976
FT                   /note="Domain related to MnhB subunit of Na+/H+ antiporter;
FT                   Region: MnhB; cl00676"
FT                   /db_xref="CDD:176821"
FT                   /locus_tag="Cfla_0208"
FT   misc_feature    248223..>248438
FT                   /note="Domain related to MnhB subunit of Na+/H+ antiporter;
FT                   Region: MnhB; cl00676"
FT                   /db_xref="CDD:176821"
FT                   /locus_tag="Cfla_0208"
FT   gene            248765..249292
FT                   /db_xref="GeneID:9144075"
FT                   /locus_tag="Cfla_0209"
FT   CDS_pept        248765..249292
FT                   /locus_tag="Cfla_0209"
FT                   /gene_family="HOG000066431" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00420"
FT                   /codon_start="1"
FT                   /product="NADH-ubiquinone oxidoreductase chain 4L"
FT                   /transl_table="11"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 4L; KEGG:
FT                   bcv:Bcav_3817 NADH-ubiquinone oxidoreductase chain 4L"
FT                   /db_xref="GI:296128077"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="GeneID:9144075"
FT                   /translation="MSPNLVFVVTIAVMFTVGVYLVLERSLTRILLGIVLLSNGTNLLI
FT                   LVAGGAAGAPPIIGVASDRPMSDPLPQALILTAIVITLGLTAFLLAMAYRSWQLHRHDE
FT                   VQDDVEDRRIVRLAAIDERAFEDDDTEYEGETLDEEAASTRDETDLGEAFGGAPAERPP
FT                   PGSDTTHREEGR"
FT                   /protein_id="YP_003635327.1"
FT   misc_feature    248765..249265
FT                   /note="NADH-ubiquinone/plastoquinone oxidoreductase chain
FT                   4L; Region: Oxidored_q2; cl00492"
FT                   /db_xref="CDD:174240"
FT                   /locus_tag="Cfla_0209"
FT   gene            249289..250866
FT                   /db_xref="GeneID:9144076"
FT                   /locus_tag="Cfla_0210"
FT   CDS_pept        249289..250866
FT                   /locus_tag="Cfla_0210"
FT                   /gene_family="HOG000066542" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00361"
FT                   /codon_start="1"
FT                   /product="NADH/Ubiquinone/plastoquinone (complex I)"
FT                   /transl_table="11"
FT                   /note="PFAM: NADH/Ubiquinone/plastoquinone (complex I);
FT                   KEGG: bcv:Bcav_3816 NADH dehydrogenase (quinone)"
FT                   /db_xref="GI:296128078"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="GeneID:9144076"
FT                   /translation="MTDWSWLVPLPVVLPLSAAGLALALYRRPRLQRIVSLATLTIVAI
FT                   VSAALLVLADAGPVVVEVGDWAAPVGISLVADRLSALMLTVSSVVILCVLVYSLAQGRE
FT                   DGEQFAPISIFHPTYLVLSAGVANAFLSGDLFNIYVGFEILLAASYVLITLSGTTERIR
FT                   AGTIYVVVAILSSVLFLVAIAAVYAAVGTVNLAQLAIRLPEVDPGVRLVLQTMLLLAFG
FT                   IKAAVFPLSSWLPDSYPTAPAPVTAVFAGLLTKVGVYAIIRTQSLLFPGGRLDDILLWV
FT                   ALATMVVGILGAVAQDDVKRLLSFTLVSHIGYMVFGIALGSTEGWTAAVYYVAHHITVQ
FT                   TALFLVVGLVERFGGTTSLDRLGGLAKMTPVLAILFFVPAMNLGGIPPFSGFLGKVGLL
FT                   EAGVQLGTPLGYTLVVGSVVTSLLTLYALIKAWNKAFWQSPPEELPANRVPSMMVAPTA
FT                   ALVVFSLALTVFAGPLYAYTERAALALKERDPYVTAVLPDGARGEGESQRAAEENAEDA
FT                   TDDAEADG"
FT                   /protein_id="YP_003635328.1"
FT   misc_feature    249682..250491
FT                   /note="NADH-Ubiquinone/plastoquinone (complex I), various
FT                   chains; Region: Oxidored_q1; cl14187"
FT                   /db_xref="CDD:175557"
FT                   /locus_tag="Cfla_0210"
FT   gene            250863..251435
FT                   /db_xref="GeneID:9144077"
FT                   /locus_tag="Cfla_0211"
FT   CDS_pept        250863..251435
FT                   /locus_tag="Cfla_0211"
FT                   /gene_family="HOG000252265" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bcav_3815"
FT                   /codon_start="1"
FT                   /product="multisubunit Na+/H+ antiporter MnhE subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: bcv:Bcav_3815 multisubunit Na+/H+ antiporter
FT                   MnhE subunit"
FT                   /db_xref="GI:296128079"
FT                   /db_xref="GeneID:9144077"
FT                   /translation="MSLHPRRTGWSFQWATIIWLTAVWVLLWGDVTWGNIVNGALLGVL
FT                   VTAGLRMTPVDFRGRVHPVGLVVLLGRFAVDLVRASFEVSLVALRPRHTPRGAVICVQL
FT                   RSHSDLYLTLTAELVSLVPGSIIVEAHRLTGRLYVHVLDVATSGGVEKARQNVLDQEAR
FT                   VLRALASPDELAAAGLHRSARAGEVTA"
FT                   /protein_id="YP_003635329.1"
FT   misc_feature    250896..251366
FT                   /note="Na+/H+ ion antiporter subunit; Region: MNHE;
FT                   cl00807"
FT                   /db_xref="CDD:174399"
FT                   /locus_tag="Cfla_0211"
FT   gene            251432..251929
FT                   /db_xref="GeneID:9144078"
FT                   /locus_tag="Cfla_0212"
FT   CDS_pept        251432..251929
FT                   /locus_tag="Cfla_0212"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04066"
FT                   /codon_start="1"
FT                   /product="multiple resistance and pH regulation protein F"
FT                   /transl_table="11"
FT                   /note="PFAM: multiple resistance and pH regulation protein
FT                   F; KEGG: multiple resistance and pH regulation protein F"
FT                   /db_xref="GI:296128080"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="GeneID:9144078"
FT                   /translation="MSAFDVVVVVCGVLLTLGALFAIARAEKGPSMLDRTVALDIVVTT
FT                   MIAAVALYAAYFRRADVVPLLVVLSLVGFVGSVTIARFAAVEPEGEGRVRTREEVAAEE
FT                   AEKRRLEQEEEEARRRRRRAVEERAEGELVAEEEVPASARETVEDQPDPEHHGGPADEE
FT                   AR"
FT                   /protein_id="YP_003635330.1"
FT   misc_feature    <251495..>251611
FT                   /note="Multiple resistance and pH regulation protein F
FT                   (MrpF / PhaF); Region: MrpF_PhaF; cl09154"
FT                   /db_xref="CDD:175020"
FT                   /locus_tag="Cfla_0212"
FT   gene            251926..252309
FT                   /db_xref="GeneID:9144079"
FT                   /locus_tag="Cfla_0213"
FT   CDS_pept        251926..252309
FT                   /locus_tag="Cfla_0213"
FT                   /gene_family="HOG000066880" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01300"
FT                   /codon_start="1"
FT                   /product="monovalent cation/proton antiporter, MnhG/PhaG
FT                   subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: bcv:Bcav_3813 monovalent cation/proton
FT                   antiporter, MnhG/PhaG subunit; TIGRFAM: monovalent
FT                   cation/proton antiporter, MnhG/PhaG subunit; PFAM: Na+/H+
FT                   antiporter subunit"
FT                   /db_xref="GI:296128081"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="GeneID:9144079"
FT                   /translation="MTVWGAMADAVSIVCLLGGAFFAFAAGVGALRFPDLLARMHAGTK
FT                   PQVLGLILVLIGLALRLREGGAVWALLLVAVFQMITAPVAAHMVGRAGFRTGKVRSDLL
FT                   VVDELTRDLDETQGSPTRAGEDL"
FT                   /protein_id="YP_003635331.1"
FT   misc_feature    <252019..252216
FT                   /note="Na+/H+ antiporter subunit; Region: PhaG_MnhG_YufB;
FT                   cl00583"
FT                   /db_xref="CDD:174295"
FT                   /locus_tag="Cfla_0213"
FT   gene            complement(252335..253810)
FT                   /db_xref="GeneID:9144080"
FT                   /locus_tag="Cfla_0214"
FT   CDS_pept        complement(252335..253810)
FT                   /locus_tag="Cfla_0214"
FT                   /gene_family="HOG000238955" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /codon_start="1"
FT                   /product="FAD dependent oxidoreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bcv:Bcav_0818 dehydrogenase"
FT                   /db_xref="GI:296128082"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="GeneID:9144080"
FT                   /translation="MDVVVVGSGPNGLAAAVTMARAGLAVTVLEAQPTIGGGARTLDLG
FT                   LADGLVHDVCSAVHPMAWASPFMRAFGLERRVDLLTPEVSFAQPLPGGRAGIAWHDLER
FT                   TVESLEEDGPAWRSLVGELSRHSGDVVRVALGDKRSLPPGLLPAGLVGAARFGLGVLEQ
FT                   GTPAWDARFRGDVAPALLTGVAAHAISPLPSLAGAGTALLLASLAHAGSGWPIPRGGSG
FT                   AIVAALVADLEAHGGTVVADHPVRSRADLPDARCYLFDTTPRTLVEVLGDELPPGRRAA
FT                   LERYAYGDGAAKVDFVLSGPVPWEHPDVARAGTVHVGGTRAEMARAEADVHAGRHAELP
FT                   MCLVSDPSVVDPGRRSGDLRPLWAYAHVPGGSDVDVTEAVVRHVERYAPGFRDVVMTSR
FT                   CVPASQMSHHNANYVGGDISAGAVSLQSMFARPTAAPDPYAAGVDGVYLCSASTPPGPG
FT                   VHGLGGWFAASRALRREFGIRVRSVFADRRGGV"
FT                   /protein_id="YP_003635332.1"
FT   misc_feature    complement(252374..253810)
FT                   /note="Phytoene dehydrogenase and related proteins
FT                   [Secondary metabolites biosynthesis, transport, and
FT                   catabolism]; Region: COG1233"
FT                   /db_xref="CDD:31426"
FT                   /locus_tag="Cfla_0214"
FT   misc_feature    complement(<253676..253807)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="Cfla_0214"
FT   misc_feature    complement(252428..>253162)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="Cfla_0214"
FT   gene            253919..254446
FT                   /db_xref="GeneID:9144081"
FT                   /locus_tag="Cfla_0215"
FT   CDS_pept        253919..254446
FT                   /locus_tag="Cfla_0215"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="GI:296128083"
FT                   /db_xref="GeneID:9144081"
FT                   /translation="MAAGGRDRSGRARDAQDRLDRREAHLARWVTVVVVAVLLGVAHDD
FT                   ETELWPLTAYRLFSGVRTESQVSLELVAVGADGTRAPVPLDEHDQVLATTSHQYRLLRE
FT                   VPPARQREMAAAWLGLAGIDVADVESVEVERVRRTMDARTLDERVTDRRVVVQIAMRAA
FT                   ERRPVAGAGEAP"
FT                   /protein_id="YP_003635333.1"
FT   gene            254443..255351
FT                   /db_xref="GeneID:9144082"
FT                   /locus_tag="Cfla_0216"
FT   CDS_pept        254443..255351
FT                   /locus_tag="Cfla_0216"
FT                   /gene_family="HOG000097750" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Xcel_0216"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="GI:296128084"
FT                   /db_xref="GeneID:9144082"
FT                   /translation="MSGVARALARLDARLVAPGPAFRLLEVHTLVALVVGLRLATRDWT
FT                   RIAARPAELTWHGTAVGWFPAPAPAWVLVALQVAGLAGVVLVVARRRPQVGFVLAWVAY
FT                   MVLTGLWGSSGKVMHNDVLTVSVGAVLLLARVPGRDVPARDARVAWGWPPRAALAVLAC
FT                   VYFLTGAQKVRHSGIEWVLSDNMAWVLRWGESPFGPGLTQAVADQAWLTQLLAGGALCL
FT                   ELGAPLLLALRVTRIPFALAVLVMHTSIWAFLGLDYSAWVLTAAAVAVPQGLPRGVPLL
FT                   AAPRAAAAALRGRTAGRAPVG"
FT                   /protein_id="YP_003635334.1"
FT   gene            complement(255391..255657)
FT                   /db_xref="GeneID:9144083"
FT                   /locus_tag="Cfla_0217"
FT   CDS_pept        complement(255391..255657)
FT                   /locus_tag="Cfla_0217"
FT                   /gene_family="HOG000252254" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Tfu_1937"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tfu:Tfu_1937 hypothetical protein"
FT                   /db_xref="GI:296128085"
FT                   /db_xref="GeneID:9144083"
FT                   /translation="MSSDAQKQSMAAKVVGAGVALAAAWVVQKLIDSAWEKTRGHKPPA
FT                   ADSTAEDIRFGEVAAAAAITGAAVALSRVLATRGAAKLAKRVG"
FT                   /protein_id="YP_003635335.1"
FT   misc_binding    255760..255886
FT                   /note="TPP riboswitch (THI element) as predicted by Rfam
FT                   (RF00059), score 58.21"
FT                   /bound_moiety="thiamin/thiaminpyrophosphate"
FT   gene            255972..257075
FT                   /db_xref="GeneID:9144084"
FT                   /locus_tag="Cfla_0218"
FT   CDS_pept        255972..257075
FT                   /locus_tag="Cfla_0218"
FT                   /gene_family="HOG000272498" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01254"
FT                   /codon_start="1"
FT                   /product="ABC transporter, periplasmic binding protein,
FT                   thiB subfamily"
FT                   /transl_table="11"
FT                   /note="KEGG: bcv:Bcav_3809 ABC transporter, periplasmic
FT                   binding protein, ThiB subfamily; TIGRFAM: ABC transporter,
FT                   periplasmic binding protein, thiB subfamily; PFAM:
FT                   extracellular solute-binding protein family 1"
FT                   /db_xref="GI:296128086"
FT                   /db_xref="InterPro:IPR005948"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="GeneID:9144084"
FT                   /translation="MSTPRPRPATGPRRVACALTAGVAVAALTSCSATGGATPGESADA
FT                   TSAGTVTLVTHESFGLSEGLLEQFEADTGLTVEVVQQADAGALVNQLVLTKDAPLGDLV
FT                   FGVDDAFASRALDEGVVVPVELDAPAAQDAAAYAVPGDEGALTAVDLGDVCLNVDVGWF
FT                   AERGVPEPTTLESLLDPAYRDLVVVPDPVTSSPGLAFLLATVGAFGEDGWVDYWAGLRD
FT                   NGLKVADGWSEAYYTDFTAGGGDGPRPVVLSYASSPPFTVPDGGDEPTTRALLDTCYRQ
FT                   VEYAGVLAGAANPEGAAQLLEFLLSDEVQADIPTSMYMYPVSSSVELPEEWARWAPLAD
FT                   EPFDVAPADISTHREQWLQTWSDTVIG"
FT                   /protein_id="YP_003635336.1"
FT   misc_feature    256062..257066
FT                   /note="ABC-type thiamine transport system, periplasmic
FT                   component [Coenzyme metabolism]; Region: TbpA; COG4143"
FT                   /db_xref="CDD:33896"
FT                   /locus_tag="Cfla_0218"
FT   misc_feature    256119..257054
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Cfla_0218"
FT   gene            257135..258940
FT                   /db_xref="GeneID:9144085"
FT                   /locus_tag="Cfla_0219"
FT   CDS_pept        257135..258940
FT                   /locus_tag="Cfla_0219"
FT                   /gene_family="HOG000218723" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bcv:Bcav_3808
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:296128087"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9144085"
FT                   /translation="MSDVTVGGDGVAPTPADRNPGHRSEGRSGSGVPVGGGSGGGTRWG
FT                   ARSGWGARTGWGLAVGVPLAFLAVFFVWPVAEIVGRGFVADGRVDLGGFGDVFSRPRTW
FT                   RVVGQTLAQAGVATAAAVLLGVPGAYLLYRCRFPGRGALRAFVTVPFVMPTVVVGVAFR
FT                   SLLVDGGLLGRLGLDGTFTAIVLALVFFNYAVVVRTVGGMWERLDPRTEQAARALGASP
FT                   WRVLRTVTLPALGPAIASAASLVFLFCATAFGTVLVLGGRRYGTVETEIWIQTTQFLDL
FT                   RAAAVLSVVQLVVVAAALTVAGRARARTERALTLGAPAATARRVRLREPLDLVTVVVTG
FT                   VTVAGLLATPLVNLVVRSLRTPDGWGLDHYRALAVPQDTLAVSAWQAAGTSVRTAVDAT
FT                   VLALVVGGLVALVVSRRPRRAAARRAVAGLDALFMLPLGVSAVTVGFGFLVSMDAPLGL
FT                   PVDLRTSPVLVAVAQAVVAVPLVVRTVLPVLRAIDPRQREVAATLGAAPGRVLRTVDVA
FT                   VALRAVGLALGFAFAASLGEFGATSFLARPQEPTLPVVIFRLLGRPGAESYGAALAASV
FT                   LLAALTAGVVAVCERLRRPGIGGAW"
FT                   /protein_id="YP_003635337.1"
FT   misc_feature    257318..>257974
FT                   /note="ABC-type Fe3+ transport system, permease component
FT                   [Inorganic ion transport and metabolism]; Region: ThiP;
FT                   COG1178"
FT                   /db_xref="CDD:31371"
FT                   /locus_tag="Cfla_0219"
FT   misc_feature    <257675..257968
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Cfla_0219"
FT   misc_feature    order(257687..257689,257903..257905,257939..257941,
FT                   257948..257950)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Cfla_0219"
FT   misc_feature    order(257762..257800,257816..257821,257831..257833)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Cfla_0219"
FT   gene            258937..260106
FT                   /db_xref="GeneID:9144086"
FT                   /locus_tag="Cfla_0220"
FT   CDS_pept        258937..260106
FT                   /locus_tag="Cfla_0220"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcv:Bcav_3807 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="GI:296128088"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9144086"
FT                   /translation="MSDGLQVADVVVRYAGAAAAAVDGVDLAVPTGEVLALLGPSGCGK
FT                   SSLLRAVAGLEPLTGGDVAWDGVSVAEVPVHRRGFGLLFQDGQLFAHRDVAGNVAYGLP
FT                   AAVRRDRAARTTRVAELLDLVGLPGTERRDVATLSGGERQRVALARALAPRPRLLLLDE
FT                   PLSALDRALRERLALDLRDVLVATGTTALFVTHDQDEAFAVADRVAVMDSGRLLQVAPP
FT                   AALWARPASRRVAQFLGYEAFVDVPATGAVVPAAVRALVDAVGAAGVAPVPTGGVLALV
FT                   AGAFVVDPTTTPAPPPADRNPAHLLGVEAVSRVPVGGVVGGGGERGAARGDVSGVVRAV
FT                   RSRRGRTEVVVDVDGVGTVSALAPAGWTCVPGARVALQVDAAAVAGLPG"
FT                   /protein_id="YP_003635338.1"
FT   misc_feature    259024..259653
FT                   /note="ABC-type thiamine transport system, ATPase component
FT                   [Coenzyme metabolism]; Region: ThiQ; COG3840"
FT                   /db_xref="CDD:33632"
FT                   /locus_tag="Cfla_0220"
FT   misc_feature    259030..259653
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Cfla_0220"
FT   misc_feature    259051..259074
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0220"
FT   misc_feature    order(259060..259065,259069..259077,259189..259191,
FT                   259420..259425,259522..259524)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0220"
FT   misc_feature    259180..259191
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0220"
FT   misc_feature    259348..259377
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0220"
FT   misc_feature    259408..259425
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0220"
FT   misc_feature    259432..259443
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0220"
FT   misc_feature    259510..259530
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Cfla_0220"
FT   gene            260182..260937
FT                   /db_xref="GeneID:9144087"
FT                   /locus_tag="Cfla_0221"
FT   CDS_pept        260182..260937
FT                   /locus_tag="Cfla_0221"
FT                   /gene_family="HOG000221506" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:ROP_19660"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rop:ROP_19660 hypothetical protein"
FT                   /db_xref="GI:296128089"
FT                   /db_xref="GeneID:9144087"
FT                   /translation="MSLERREVVAVDVHAPVATVWEHLRDPRLVRRWFGWDHDGLDAEI
FT                   QEIFATGVHEEHDHADGLTTRSLVWRNHDHLTVTAHDDRPTLTRVTVTRPSHDGLSTFD
FT                   GVFDEMDEGWTQFVHQLAFALEVHPGKDRVTLTAHRLDAGGRSDPLLFRAGLHGVRGLP
FT                   VGAHVDATRPDGSRVGGRVRYKTEHQVGIHLKGIAESLLVLVVRPAVEAPPHGAVDATL
FT                   STYGLDADVLDEARRRWAGWWRAGASARA"
FT                   /protein_id="YP_003635339.1"
FT   gene            complement(260964..262067)
FT                   /db_xref="GeneID:9144088"
FT                   /locus_tag="Cfla_0222"
FT   CDS_pept        complement(260964..262067)
FT                   /locus_tag="Cfla_0222"
FT                   /gene_family="HOG000248815" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bcv:Bcav_3785 GCN5-related protein N- acetyltransferase"
FT                   /db_xref="GI:296128090"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="GeneID:9144088"
FT                   /translation="MTRWSIRELSAPASLDADDAWLLHGMVDAQNASTLALWGSDDFAT
FT                   TPRRALSQLADQEYVRRARLVAVDESTDAPDPARVLGFARLDLPLADNTHTGWLDLGVR
FT                   PEHRGRGVGDALHATACDVARSAGRTHLLTETDQAAEPAPGPDTFGAPTGEGLVSRADR
FT                   DVRFALARGWQLEQVARHSRLTLPVDAAALEEHRARAAAAAGPDYRPVTWDDATPDERV
FT                   EQMCALHVAMSTDEPTAGLDVEEEVWDAARVRHADAQTLGRGEHLLTTAIEHVPTGRLV
FT                   AYSAFMIPPHTDEFVWQEDTLVAGDHRGHRLGMLVKAVQLQALVERRPSVRRISTWNAE
FT                   ENRWMLAINVALGFRPAGGSGVWQRTL"
FT                   /protein_id="YP_003635340.1"
FT   misc_feature    complement(261639..261833)
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:176420"
FT                   /locus_tag="Cfla_0222"
FT   gene            262150..262791
FT                   /db_xref="GeneID:9144089"
FT                   /locus_tag="Cfla_0223"
FT   CDS_pept        262150..262791
FT                   /locus_tag="Cfla_0223"
FT                   /gene_family="HOG000223940" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Xcel_2045"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="GI:296128091"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR020137"
FT                   /db_xref="GeneID:9144089"
FT                   /translation="MPWWEVVGWAGSVLVVVSLMQARVWRFRVMNLVGAVLATAYNAVF
FT                   GIWAFAAMNGAIAVIDVYWLWRLRRERSDAAVYAVVEVASDDAYLRHVLAVHADDVARH
FT                   RTVPAEVVDDALADGPHGELAFLVVRGDETVGVVLVRDEGDGTGTVLLDWVTPRFRDFT
FT                   PGEFVYRDSDVFARHGLHRLVVPTAPTGAVAYLERVGFRRVDDRAWERAV"
FT                   /protein_id="YP_003635341.1"
FT   gene            262870..264078
FT                   /db_xref="GeneID:9144090"
FT                   /locus_tag="Cfla_0224"
FT   CDS_pept        262870..264078
FT                   /locus_tag="Cfla_0224"
FT                   /gene_family="HOG000152205" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01566"
FT                   /codon_start="1"
FT                   /product="natural resistance-associated macrophage protein"
FT                   /transl_table="11"
FT                   /note="PFAM: natural resistance-associated macrophage
FT                   protein; KEGG: cms:CMS_0593 putative manganese transport
FT                   protein"
FT                   /db_xref="GI:296128092"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="GeneID:9144090"
FT                   /translation="MKPRVPVLLGPAFVAAVAYVDPGNVAANLTAGARYGYLLLWVLVA
FT                   ANAMAVLVQYQSAKLGLVTGESMPGLLGSRLRRGPRLAYWAQAEIVAAATDVAEVVGGA
FT                   IALHLLLGLPLPVGGAIVGAASLVLLATQDRYGQRRFEAVVVALLAVITVGFLVGLVVS
FT                   PPDADGVLGGLVPRFAGTDTVLLAASMLGATVMPHAIYVHSALVRDRHGRAPEGEGRRL
FT                   LLRATRWDVAVALVVAGAVNIGLLLLAASGLQGTEGTDTIEGAHAAIVGALGPGIGLAF
FT                   AIGLLASGLASTSVGAYAGATIMEGLLHRRIPLLVRRVVTIIPAVLLLALGADPTWTLV
FT                   LSQVVLSFGIPFALVPLVRLGRDRTLMGADRNGPVLHAVLCVVVALVVVLNLALLGLLL
FT                   TGA"
FT                   /protein_id="YP_003635342.1"
FT   misc_feature    262891..263991
FT                   /note="Natural resistance-associated macrophage protein;
FT                   Region: Nramp; cl00836"
FT                   /db_xref="CDD:174415"
FT                   /locus_tag="Cfla_0224"
FT   gene            complement(264167..265456)
FT                   /db_xref="GeneID:9144091"
FT                   /locus_tag="Cfla_0225"
FT   CDS_pept        complement(264167..265456)
FT                   /locus_tag="Cfla_0225"
FT                   /gene_family="HOG000152991" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /codon_start="1"
FT                   /product="putative RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /transl_table="11"
FT                   /note="KEGG: bcv:Bcav_3762 putative RNA polymerase, sigma-
FT                   24 subunit, ECF subfamily; TIGRFAM: RNA polymerase sigma
FT                   factor, sigma-70 family; PFAM: sigma-70 region 2 domain
FT                   protein; Sigma-70 region 4 type 2"
FT                   /db_xref="GI:296128093"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="GeneID:9144091"
FT                   /translation="MTTGQGGPPAAGGEEDVAAALGDAWRAHWSRVVALLVAQFASPDL
FT                   AEDAAGDAFEAAARTWPRDGVPANPGAWLLTAGRRRVLDRLRAQSVHRRKEPLMVVDDE
FT                   MRALAAATQDPGAHVADEQLRLVLACCHPALAPADRVAMTLRFVVGLGTAEIGRLLLVQ
FT                   HTAMSARLTRAKKRLAAAGVPFVVPPADRLDERLDAVATVLYLLFTAGYQPADAPGGLR
FT                   VDLADEAVRLARELDGLLGGSPRVRALLALMLLQHSRRDARVDDDGRLVLLPDQDRSRW
FT                   HASEIAEGVALLRALPALDGLAEDHRLQAVAAAEHATAPTAADTRWDVVASVYAVLEAR
FT                   TGSPVVRLARAVAVAEADGPEAGLALLDGLDEVLAHHHRLPAVRGELLLRAGHGPQAAA
FT                   ELERALTLVPDTAERHHLECRLAEARTLPT"
FT                   /protein_id="YP_003635343.1"
FT   misc_feature    complement(264179..265384)
FT                   /note="Predicted RNA polymerase sigma factor containing a
FT                   TPR repeat domain [Transcription]; Region: COG4941"
FT                   /db_xref="CDD:34549"
FT                   /locus_tag="Cfla_0225"
FT   gene            complement(265485..265826)
FT                   /db_xref="GeneID:9144092"
FT                   /locus_tag="Cfla_0226"
FT   CDS_pept        complement(265485..265826)
FT                   /locus_tag="Cfla_0226"
FT                   /gene_family="HOG000152879" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03795"
FT                   /codon_start="1"
FT                   /product="YCII-related protein"
FT                   /transl_table="11"
FT                   /note="PFAM: YCII-related; KEGG: bcv:Bcav_3455 YCII-related
FT                   protein"
FT                   /db_xref="GI:296128094"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="GeneID:9144092"
FT                   /translation="MRFVVLVYEDEAIWRAADEAGRARYDEGHRAFVQAAQAAGVRVEA
FT                   GEALAGVASASTVRHARGATTVTDGPFAETTEQLGGFYLVDAPDRQTLLDLVALLPETT
FT                   HEVRECVEP"
FT                   /protein_id="YP_003635344.1"
FT   misc_feature    complement(265491..265826)
FT                   /note="YCII-related domain; Region: YCII; cl00999"
FT                   /db_xref="CDD:174492"
FT                   /locus_tag="Cfla_0226"
FT   gene            complement(265823..266221)
FT                   /db_xref="GeneID:9144093"
FT                   /locus_tag="Cfla_0227"
FT   CDS_pept        complement(265823..266221)
FT                   /locus_tag="Cfla_0227"
FT                   /gene_family="HOG000152879" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03795"
FT                   /codon_start="1"
FT                   /product="YCII-related protein"
FT                   /transl_table="11"
FT                   /note="PFAM: YCII-related; KEGG: bcv:Bcav_3763 YCII-related
FT                   protein"
FT                   /db_xref="GI:296128095"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="GeneID:9144093"
FT                   /translation="MSTTTTYMLLLWGDPDACVDLGAAYAAHGTFAEQCALQGHEIVGG
FT                   EELASPRDARLLTVADGTAQVTDGPYAETTEQLGGFYLVRTSDPDGLLRLAAPLVMDDE
FT                   GTLELRPVAVHEAAPTGTSPAAVAQPVA"
FT                   /protein_id="YP_003635345.1"
FT   misc_feature    complement(265865..266203)
FT                   /note="YCII-related domain; Region: YCII; cl00999"
FT                   /db_xref="CDD:174492"
FT                   /locus_tag="Cfla_0227"
FT   gene            266382..266939
FT                   /db_xref="GeneID:9144094"
FT                   /locus_tag="Cfla_0228"
FT   CDS_pept        266382..266939
FT                   /locus_tag="Cfla_0228"
FT                   /gene_family="HOG000063195" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01382"
FT                   /codon_start="1"
FT                   /product="intracellular protease, PfpI family"
FT                   /transl_table="11"
FT                   /note="KEGG: sgr:SGR_458 hypothetical protein; TIGRFAM:
FT                   intracellular protease, PfpI family; PFAM: ThiJ/PfpI domain
FT                   protein"
FT                   /db_xref="GI:296128096"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="GeneID:9144094"
FT                   /translation="MSTDLNGRRVLAVVTNYGVEQDELVVPVEHLRGAGAHVDVAAVDD
FT                   APVETLVGDKDPGRTVQPTTTLGEADADGYDLLLVPGGTLNADSLRLQDDAVRLVTAFA
FT                   RSGRPVAAICHGPWLLVEAGLVEGKRLTSYPSLTTDVRNAGGTWVDEEVVADDVHGFRL
FT                   VTSRTPDDLDAFLREVDAALAA"
FT                   /protein_id="YP_003635346.1"
FT   misc_feature    266415..266927
FT                   /note="A type 1 glutamine amidotransferase (GATase1)-like
FT                   domain found in PfpI from Pyrococcus furiosus; Region:
FT                   GATase1_PfpI_like; cd03134"
FT                   /db_xref="CDD:153228"
FT                   /locus_tag="Cfla_0228"
FT   misc_feature    266721..266726
FT                   /note="proposed catalytic triad; other site"
FT                   /db_xref="CDD:153228"
FT                   /locus_tag="Cfla_0228"
FT   misc_feature    266721..266723
FT                   /note="conserved cys residue; other site"
FT                   /db_xref="CDD:153228"
FT                   /locus_tag="Cfla_0228"
FT   gene            267055..268902
FT                   /db_xref="GeneID:9144095"
FT                   /locus_tag="Cfla_0229"
FT   CDS_pept        267055..268902
FT                   /locus_tag="Cfla_0229"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcv:Bcav_4114 hypothetical protein"
FT                   /db_xref="GI:296128097"
FT                   /db_xref="GeneID:9144095"
FT                   /translation="MTTLPRTVATAAAVLTAALTSLALVAPAAAAGPGASAALTTGLTC
FT                   DDVTCRFVFAPDVFTPQTFVVPPGVTRVTADLVGGAGGRVAEHPGGAGGALRTSVPVRP
FT                   GETLTAQVPRSGDRLQVPADARPDAEPADHVGGELAALYRGTGTQTTAIAVAGGGGAGG
FT                   STGAGGAGGGWHADPTQVLRGQDGGGNGAGLGATPTAGGGVFDGEAALPGVVGSGPAGH
FT                   VPGGRGVGGSTGAQRVSWWIVTETWQGAPGGMGWYGGGSGAFVTDSWVAGGGGGSGYLA
FT                   PGRVAQQVPAATVEAAGDQGLVAIEWAVDQTTATLEPVVLDAGGADSGGVVDGELESRD
FT                   LVLSLEGLPVGARVSVDSGPVASETLWGTVADDGTVRVPYTVPAGEHLEDLWLDVAVLV
FT                   DDEVTASSRIDLDVPALEVATVLDAPREVAPGGGLTVEIGRTGTQFGAPTPGLAPVVLR
FT                   DLLLSGAVAVVLDGEVVDPQDLQLPQVADLPATGTVRVGLTAPEVLGDHTLAVVPGPSV
FT                   QDTLLEETALTFAVVTAPAAEPTVAPTAPAGAAAGVAPTAAPTAAAASERSEVLAAASG
FT                   VLATTGAKVTGLAIVATLLIVAGGVVLHARGRGRAAHAR"
FT                   /protein_id="YP_003635347.1"
FT   gene            268994..269494
FT                   /db_xref="GeneID:9144096"
FT                   /locus_tag="Cfla_0230"
FT   CDS_pept        268994..269494
FT                   /locus_tag="Cfla_0230"
FT                   /gene_family="HOG000261968" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /codon_start="1"
FT                   /product="NUDIX hydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: nfa:nfa13200
FT                   hypothetical protein"
FT                   /db_xref="GI:296128098"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="GeneID:9144096"
FT                   /translation="MPVTSAALLLHHGRGADAHVLIAHMGGPFWARKDEGAWSIPKGLV
FT                   EPGEDVEAAARREFAEELGVPAPDGPVVDLGAFRYSSGKVVHVLAVEVPAWLVGSPDDP
FT                   ASPELTARAGISTAQVEWPPRSGRRVDVPEVDRAVWFPLERARPLLVAGQQPVLDALAT
FT                   ATS"
FT                   /protein_id="YP_003635348.1"
FT   misc_feature    269006..269422
FT                   /note="Nudix hydrolase is a superfamily of enzymes found in
FT                   all three kingdoms of life, and it catalyzes the hydrolysis
FT                   of NUcleoside DIphosphates linked to other moieties, X.
FT                   Enzymes belonging to this superfamily require a divalent
FT                   cation, such as Mg2+ or...; Region: Nudix_Hydrolase;
FT                   cl00447"
FT                   /db_xref="CDD:176581"
FT                   /locus_tag="Cfla_0230"
FT   misc_feature    order(269120..269128,269156..269182)
FT                   /note="nudix motif; other site"
FT                   /db_xref="CDD:72880"
FT                   /locus_tag="Cfla_0230"
FT   gene            complement(269548..269928)
FT                   /db_xref="GeneID:9144097"
FT                   /locus_tag="Cfla_0231"
FT   CDS_pept        complement(269548..269928)
FT                   /locus_tag="Cfla_0231"
FT                   /gene_family="HOG000097245" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:RER_55940"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rer:RER_55940 hypothetical protein"
FT                   /db_xref="GI:296128099"
FT                   /db_xref="GeneID:9144097"
FT                   /translation="MAVRLHYRATRPRALSADEVTTARALVAAHNADFPYDAELLTLAA
FT                   PGDEALEGTTTLPEQDPFSTLLGLAHWCRALTEVRRALPGTQWEVSVDDEPVPWDDEGG
FT                   FGWPEQRDPATLDLMRDLRPSS"
FT                   /protein_id="YP_003635349.1"
FT   gene            complement(269983..270582)
FT                   /db_xref="GeneID:9144098"
FT                   /locus_tag="Cfla_0232"
FT   CDS_pept        complement(269983..270582)
FT                   /locus_tag="Cfla_0232"
FT                   /gene_family="HOG000131214" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bcav_2990"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcv:Bcav_2990 hypothetical protein"
FT                   /db_xref="GI:296128100"
FT                   /db_xref="GeneID:9144098"
FT                   /translation="MADDLPELLLPDAAAWRAWLTEHHTQTTGVWLVLHKKGGDVTSLT
FT                   YVEAVEEALCFGWIDGQARRRDDASSFQRMTPRRARSPWSAVNVARVERLEAEGRMQDA
FT                   GRAQVATAKTDGRWEAAYPGPATAEVPDDLAAALDAVPAARAWFDVLTSGNRFAVLHRV
FT                   REAKRPETRARRIAGFVADLAEGRTPYPQKRRPDSV"
FT                   /protein_id="YP_003635350.1"
FT   misc_feature    complement(270007..270537)
FT                   /note="Domain of unknown function (DU1801); Region:
FT                   DUF1801; cl01838"
FT                   /db_xref="CDD:154618"
FT                   /locus_tag="Cfla_0232"
FT   gene            complement(270612..271157)
FT                   /db_xref="GeneID:9144099"
FT                   /locus_tag="Cfla_0233"
FT   CDS_pept        complement(270612..271157)
FT                   /locus_tag="Cfla_0233"
FT                   /gene_family="HOG000240273" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04978"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF664"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF664; KEGG:
FT                   bcv:Bcav_0332 protein of unknown function DUF664"
FT                   /db_xref="GI:296128101"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="GeneID:9144099"
FT                   /translation="MDVDTPLTPERTEAPHHADEATTLLAFLDLHRRTLLRKVDGLDAA
FT                   GLRRPLPPSTMTLAGLLKHLAMVEDNWFSTVWLDAPVEPWASAPWDQDRDWEWTSALDE
FT                   TPEQLRAQWDASVARSRRTVAAALAAGGLDQVSARRHHGTGAPVSLRWVLVHMVEEYAR
FT                   HNGHADLLREAVDGATGE"
FT                   /protein_id="YP_003635351.1"
FT   misc_feature    complement(270627..271091)
FT                   /note="DinB family; Region: DinB; cl00986"
FT                   /db_xref="CDD:176591"
FT                   /locus_tag="Cfla_0233"
FT   gene            complement(271190..272518)
FT                   /db_xref="GeneID:9144100"
FT                   /locus_tag="Cfla_0234"
FT   CDS_pept        complement(271190..272518)
FT                   /locus_tag="Cfla_0234"
FT                   /gene_family="HOG000021748" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   nca:Noca_3278 major facilitator transporter"
FT                   /db_xref="GI:296128102"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="GeneID:9144100"
FT                   /translation="MRAYADPVSTSLLERALPERLGRPFRWLLGSAWSSNLGDGLVLAA
FT                   GPLLVASRTDEAFLVALAALLGWLPPLLFGLVAGVVTDRVDRRRLVMAMDAVRVVVLAV
FT                   LAACVAVEAAPIWLVLVALFLLGTAETFADNVGGTLIPMIVRRDDLAVANSRAMAGYVG
FT                   MNQLAGPPLGGALFLLGQWTPFAGAAVLMAAGVVLISRITLPPHGREQHERGSVRADIA
FT                   EGVRWTWHHPAVRTLVLTILIFNVTFGAAWSVLVLYAQQRLGLGEVGFGMVATTQAVGG
FT                   IIGVAAFGWLTARLTLSNLLRIGLVVETLTHLGLALATSPWVAMPVFFVFGAHAFVWGT
FT                   TSVTIRQRAVPSELQGRVNSVNLIGTFGGLVVGAGIGGWLAQHWGVTAPFWFAFVGSAV
FT                   FVVLIWHELRHVAHTDAQPAPDAADVGRDDVPVPDPSAADARP"
FT                   /protein_id="YP_003635352.1"
FT   misc_feature    complement(271433..>272176)
FT                   /note="H+ Antiporter protein; Region: 2A0121; TIGR00900"
FT                   /db_xref="CDD:162098"
FT                   /locus_tag="Cfla_0234"
FT   misc_feature    complement(271304..271657)
FT                   /note="The Major Facilitator Superfamily (MFS) is a large
FT                   and diverse group of secondary transporters that includes
FT                   uniporters, symporters, and antiporters. MFS proteins
FT                   facilitate the transport across cytoplasmic or internal
FT                   membranes of a variety of...; Region: MFS; cl11420"
FT                   /db_xref="CDD:176432"
FT                   /locus_tag="Cfla_0234"
FT   gene            complement(272590..273054)
FT                   /db_xref="GeneID:9144101"
FT                   /locus_tag="Cfla_0235"
FT   CDS_pept        complement(272590..273054)
FT                   /locus_tag="Cfla_0235"
FT                   /gene_family="HOG000216247" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sma:SAV_6753 acetyltransferase"
FT                   /db_xref="GI:296128103"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="GeneID:9144101"
FT                   /translation="MTTLDTARYRFTADRADVDRDTVHHWLADLSYWARGRTRAAQDAA
FT                   VDASLCFGVHERDTGRQVAFARVVTDGATFAWLCDVFVDDSARGHGVGTALVAGVVEHL
FT                   DALGLPRTVLATADAHGLYEKFGFERTAPGRYMARLTDATAGPPTSATGD"
FT                   /protein_id="YP_003635353.1"
FT   misc_feature    complement(272668..272886)
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:176420"
FT                   /locus_tag="Cfla_0235"
FT   gene            complement(273051..274793)
FT                   /db_xref="GeneID:9144102"
FT                   /locus_tag="Cfla_0236"
FT   CDS_pept        complement(273051..274793)
FT                   /locus_tag="Cfla_0236"
FT                   /gene_family="HOG000266394" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /codon_start="1"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; KEGG:
FT                   kra:Krad_0523 diguanylate cyclase/phosphodiesterase; SMART:
FT                   EAL domain protein; GGDEF domain containing protein"
FT                   /db_xref="GI:296128104"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="GeneID:9144102"
FT                   /translation="MATTTRTGTSDVLVRTTAFLFGVGGVAAALLSLDVVRMQGARGLP
FT                   LLTLALLAVATSPVLLLVGPRIPTRGIAATVLVGALALTVGTMFSPTLTLAMTSAAIAM
FT                   LVAIESMLFLRRLDAWVLVTVAGVGQVVPLLVVHHVPPLVCAAYAVLWTGVARAVGVLA
FT                   RYASTAGVDALTGLADRRAWDAALEQAIDRRGRRGQPLSLALVDIDHFKLVNDERGHAA
FT                   GDDLLRATADAWRTLDVPGMVLGRRGGDEFAVLLPGRTGAEAHALADRLCAAAPAPASC
FT                   GVAEHVEGETVTEVLRRTDTALYAAKAAGRGRTVLSERRRHGLVDDLVRGLDAGEVHVE
FT                   LQPIIELGSHRAVAVEALARWDHPDLGRVPPLEFVAVAEDGGIIDRLGATVLRLACADA
FT                   HALQEAWGRRVSLGVNVSGRELVGQDYAARVLAALDAADWPTTQFVLEVTESVVEASDP
FT                   AALRALATLRASGVRVAIDDFGTGYSSLSRLDELPADFLKLDRQFLTSLPTSTRRTGMV
FT                   RALLDLCAELGMHVVAEGVETAEQAAMLEELGCHSAQGYHYERPLPVAALAATRWATGG
FT                   TVPA"
FT                   /protein_id="YP_003635354.1"
FT   misc_feature    complement(273849..274280)
FT                   /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
FT                   GGDEF; cd01949"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Cfla_0236"
FT   misc_feature    complement(order(274044..274046,274173..274175))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Cfla_0236"
FT   misc_feature    complement(order(274041..274052,274056..274058,
FT                   274122..274124,274134..274136,274146..274151,
FT                   274158..274160))
FT                   /note="active site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Cfla_0236"
FT   misc_feature    complement(order(273984..273986,274068..274070))
FT                   /note="I-site; other site"
FT                   /db_xref="CDD:143635"
FT                   /locus_tag="Cfla_0236"
FT   misc_feature    complement(273096..273815)
FT                   /note="EAL domain. This domain is found in diverse
FT                   bacterial signaling proteins. It is called EAL after its
FT                   conserved residues and is also known as domain of unknown
FT                   function 2 (DUF2).  The EAL domain has been shown to
FT                   stimulate degradation of a second...; Region: EAL; cd01948"
FT                   /db_xref="CDD:30163"
FT                   /locus_tag="Cfla_0236"
FT   gene            complement(274908..275711)
FT                   /db_xref="GeneID:9144103"
FT                   /locus_tag="Cfla_0237"
FT   CDS_pept        complement(274908..275711)
FT                   /locus_tag="Cfla_0237"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   sen:SACE_2206 3-ketoacyl-(acyl-carrier- protein) reductase"
FT                   /db_xref="GI:296128105"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9144103"
FT                   /translation="MSEGLRGRTAVVTGVSRRRGIGFAVASRLARAGADLFVQHWQPHD
FT                   ASVPWGADDVDAVLAALQEQLVPGARLAATSLDLAAPTGGEELVARATDALGHLDVLVC
FT                   NHATSQSDGPLATQTAESLDLHWAVNARSTILATKAFAAQHDGRPGGRVVWMTSGQVRG
FT                   AMPDEIAYVASKAALAGLTASVAADLARRGVLLNTVNPGPVNTGYLDDAVAHLPPEKLA
FT                   EINAQFPGGRFGEPDDPARLIAWLVSDEGRWMVGQVLSTEGGFDL"
FT                   /protein_id="YP_003635355.1"
FT   misc_feature    complement(274917..275699)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="Cfla_0237"
FT   misc_feature    complement(274917..275699)
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Provisional; Region: PRK12859"
FT                   /db_xref="CDD:171777"
FT                   /locus_tag="Cfla_0237"
FT   gene            275845..277008
FT                   /db_xref="GeneID:9144104"
FT                   /locus_tag="Cfla_0238"
FT   CDS_pept        275845..277008
FT                   /locus_tag="Cfla_0238"
FT                   /gene_family="HOG000071500" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01757"
FT                   /codon_start="1"
FT                   /product="acyltransferase 3"
FT                   /transl_table="11"
FT                   /note="PFAM: acyltransferase 3; KEGG: msm:MSMEG_0390
FT                   putative acyltransferase"
FT                   /db_xref="GI:296128106"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="GeneID:9144104"
FT                   /translation="MSSATGQVEVRRHKGLVPWQGQTILAAFDPRRNSLNLVRLVLALM
FT                   VLLAHSYTLSGNGFGPLFNGDHLGTWAVYGFFCLSGYLITGSRLRSRFVDYLSHRIARI
FT                   FPGFLVSLVVVVAGFAPIAYVRQHGSIDGYLTTPATPLHHVVANMGLSMHEWSVAGTLT
FT                   ANPYPHMWNGSLWSLYYEFLCYLAVGALLSFAVMRRRPWLLVPTFLLTVLAAANADTVV
FT                   NGYFGGNRDVALLVDVLPFFMGGAAVHALRGVIPLTRWSALASAVGLVLLVSADGTWGP
FT                   ALAAPFITVLLMWLGKVLPCPELVRRHDVSYGCYIYAFPSQQLVAALGGAAWGTYVHAA
FT                   LALPITVALATASWLLVERRAMRVVRRGEPVPVATVSPVAAPIAVSE"
FT                   /protein_id="YP_003635356.1"
FT   misc_feature    276049..276945
FT                   /note="Predicted acyltransferases [Lipid metabolism];
FT                   Region: COG1835; cl00792"
FT                   /db_xref="CDD:174391"
FT                   /locus_tag="Cfla_0238"
FT   gene            277262..277801
FT                   /db_xref="GeneID:9144105"
FT                   /locus_tag="Cfla_0239"
FT   CDS_pept        277262..277801
FT                   /locus_tag="Cfla_0239"
FT                   /gene_family="HOG000244125" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /codon_start="1"
FT                   /product="UspA domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: UspA domain protein; KEGG: lxx:Lxx00710
FT                   hypothetical protein"
FT                   /db_xref="GI:296128107"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="GeneID:9144105"
FT                   /translation="MDARAVPQPALDRMVDPAGHPLVVGVVPGQDPLVVRTAAAWGRAV
FT                   GAPYLHLAYVDPTRYVVHERADGSVAHMSMDPDGNDDAWRRTRDELRAQAAEHLAGQQV
FT                   VWRVHYLAGRPDRALTHLARAVDASAVVVGSRSGRLRELLEGSIALHLAYHQHRPVLTV
FT                   PLSVADWKDPQAPWQR"
FT                   /protein_id="YP_003635357.1"
FT   misc_feature    <277439..277753
FT                   /note="Adenine nucleotide alpha hydrolases superfamily
FT                   including N type ATP PPases, ATP sulphurylases Universal
FT                   Stress Response protein and electron transfer flavoprotein
FT                   (ETF). The domain forms a apha/beta/apha fold which  binds
FT                   to Adenosine nucleotide; Region: AANH_like; cl00292"
FT                   /db_xref="CDD:176814"
FT                   /locus_tag="Cfla_0239"
FT   gene            277789..278325
FT                   /db_xref="GeneID:9144106"
FT                   /locus_tag="Cfla_0240"
FT   CDS_pept        277789..278325
FT                   /locus_tag="Cfla_0240"
FT                   /gene_family="HOG000052573" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02537"
FT                   /codon_start="1"
FT                   /product="Camphor resistance CrcB protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Camphor resistance CrcB protein; KEGG:
FT                   gbr:Gbro_3466 CrcB protein"
FT                   /db_xref="GI:296128108"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="GeneID:9144106"
FT                   /translation="MAALTPPGTAPGAPGDDTPLALPAGAALVAAGGTLGVLVRALLTS
FT                   PAGPGAWPWATFVVNVTGSLVLGALLAVLQRGPDVGQRRAVRLVVGTGVLGGFTTYSTF
FT                   ALEVHRLVSTGHVVTGVVYALGSVVLGVAAAGVGIVVAGRVLAARVPSREGHGPGADGA
FT                   TSGTPDGPGTPGASA"
FT                   /protein_id="YP_003635358.1"
FT   gene            278322..278687
FT                   /db_xref="GeneID:9144107"
FT                   /locus_tag="Cfla_0241"
FT   CDS_pept        278322..278687
FT                   /locus_tag="Cfla_0241"
FT                   /gene_family="HOG000052573" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02537"
FT                   /codon_start="1"
FT                   /product="Camphor resistance CrcB protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Camphor resistance CrcB protein; KEGG:
FT                   aau:AAur_2835 putative CrcB-like protein"
FT                   /db_xref="GI:296128109"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="GeneID:9144107"
FT                   /translation="MIVVLALAGGLGAAARFVVDTLVTRRTRSVGVPVGTVVVNATACL
FT                   LLGALTGWLLGHAGHDGAGAVLGVGFLGGYSTFSTASVEAARLLLAGRGPAAATHALVM
FT                   LTTSLAASVVGLTLTSP"
FT                   /protein_id="YP_003635359.1"
FT   gene            complement(278887..280230)
FT                   /db_xref="GeneID:9144108"
FT                   /locus_tag="Cfla_0242"
FT   CDS_pept        complement(278887..280230)
FT                   /locus_tag="Cfla_0242"
FT                   /gene_family="HOG000171266" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00553"
FT                   /codon_start="1"
FT                   /product="cellulose-binding family II"
FT                   /transl_table="11"
FT                   /note="KEGG: ami:Amir_3303 glycoside hydrolase family 62;
FT                   PFAM: cellulose-binding family II; glycoside hydrolase
FT                   family 62; SMART: cellulose-binding family II"
FT                   /db_xref="GI:296128110"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR005193"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="GeneID:9144108"
FT                   /translation="MRLRHTSRPRRAVLVAAAAALVLGGLAAPATAQPAPTLAGGVAPM
FT                   AGSAGCGSSPRLSTGNQTITSGGQQRSFRLDVPSNYDPNRQYRLVFGIHWWHGTSQDVV
FT                   NEQFYGLKPLANNSTIFVAPQGIDNAWPNPNGRDTTFIDDILRTVQNALCVDSSQIFST
FT                   GFSYGGGMSNALACARANVFRAVAVLNGAQLSGCDGGTQPIAYLGSHGVVDSVLNISQG
FT                   RALRDRALRNNGCQAQNAPEPQGNSGQAHTKTVYQCRDGYPVVWIANDSDHQWAAVDRG
FT                   QQRSHVPGEIWSFFTSLPSTSGPTPTPTPTPTPTVSPTPTFSPTPSSTPTVSTTPSPTP
FT                   SPAGTTPPPASGGCTATYKLMNSWPGGWQGEVTVSAGSSIRGWTVSWSSNGERIEQLWN
FT                   GELSQGGQVQVKNVSWNGALNASGSASFGFLGSGNAPSSLSNLTCSAA"
FT                   /protein_id="YP_003635360.1"
FT   misc_feature    complement(279394..280047)
FT                   /note="Poly(3-hydroxybutyrate) depolymerase [Secondary
FT                   metabolites biosynthesis, transport, and catabolism];
FT                   Region: LpqC; COG3509"
FT                   /db_xref="CDD:33312"
FT                   /locus_tag="Cfla_0242"
FT   misc_feature    complement(<278974..279171)
FT                   /note="Cellulose binding domain; Region: CBM_2; cl02709"
FT                   /db_xref="CDD:155069"
FT                   /locus_tag="Cfla_0242"
FT   gene            complement(280446..281075)
FT                   /db_xref="GeneID:9144109"
FT                   /locus_tag="Cfla_0243"
FT   CDS_pept        complement(280446..281075)
FT                   /locus_tag="Cfla_0243"
FT                   /gene_family="HOG000218797" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04299"
FT                   /codon_start="1"
FT                   /product="FMN-binding negative transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: Negative transcriptional regulator;
FT                   pyridoxamine 5'-phosphate oxidase-related FMN-binding;
FT                   KEGG: fre:Franean1_4787 FMN-binding negative
FT                   transcriptional regulator"
FT                   /db_xref="GI:296128111"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="GeneID:9144109"
FT                   /translation="MYVPVFNALDDAEQVRALVASAGSAELVTVGPDGYPTSTLLPVVW
FT                   DGDRLVMHMARANPQWRTIGDDAPALAVVTGPQAYVSASWYPSKAEHGRMVPTWNYSAV
FT                   HLTGRARVRTDAAWLREAVTLLTDRNEAGRADRWHVADAPEGFVEKQLRAIVGIELTIE
FT                   RVEAKDKLSQNRSAADHAGVVAGLEAEGDPRAAAVAQAMRRTSTVR"
FT                   /protein_id="YP_003635361.1"
FT   misc_feature    complement(280581..281072)
FT                   /note="Pyridoxine 5'-phosphate (PNP) oxidase-like proteins;
FT                   Region: PNPOx_like; cl00381"
FT                   /db_xref="CDD:174160"
FT                   /locus_tag="Cfla_0243"
FT   gene            complement(281226..283304)
FT                   /db_xref="GeneID:9144110"
FT                   /locus_tag="Cfla_0244"
FT   CDS_pept        complement(281226..283304)
FT                   /locus_tag="Cfla_0244"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00457"
FT                   /codon_start="1"
FT                   /product="glycoside hydrolase family 11"
FT                   /transl_table="11"
FT                   /note="KEGG: cja:CJA_3763 endo-1,4-beta-xylanase, esterase,
FT                   xyn11A; PFAM: glycoside hydrolase family 11; cellulose-
FT                   binding family II; polysaccharide deacetylase; SMART:
FT                   cellulose-binding family II"
FT                   /db_xref="GI:296128112"
FT                   /db_xref="InterPro:IPR001137"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="InterPro:IPR018208"
FT                   /db_xref="GeneID:9144110"
FT                   /translation="MLDTFEPARPAARRSRAMRALVGTVAMAAMAVGGAATAAPASAQT
FT                   ITSNGTGTHSGWWYSFWTDSPGTVSATMKSGGSYSTSWRNTGNFVIGKGWNRGDASKSV
FT                   TYSGSFNPSGNAYLTLYGWTNGPLIEYYIVDNWGTYRPTGTFKGTVTSDGGTYDIYETT
FT                   RVNAPSIEGDSSTFKQFWSVRQQKRNGGGTITAGNHFSAWQRAGMNLGTHNYMIFATEG
FT                   YQSSGSSDLTVTSGGGNTGGGDQGGGNTGGGNTGGGTSNGCTVTGSAVAGESWGDRFNV
FT                   QYTVSGASSWTVTVNPGSGQSIQNSWNATRSGNTFTSSGSNTFGVTYYSGGNTSVPSAS
FT                   CQAAGGNTGGNTGGNTGGNTGGNTGGNTGGNTGGNTGGNTGGNTQNCSGYVALTFDDGP
FT                   NAGTTNQLISALKNAGATATVFPTGQNVSGNPSLAKAYADAGFQIGNHSWDHPYLTQQS
FT                   QSNIQSQLSRTQDAIRNATGVTPTVFRPPYGDQNGTVQSVASGLGMRTVTWDIDTSDYN
FT                   NASVQSIRQAAGRATNGQVVLMHDWPANTIQAIPGIVQDLASRGLCTGHISSSTGRAVA
FT                   PASTGGNTGGNTGGNTGGNTGGNTGGNTGGNTGGCTVTGSAVAGESWGDRFNVSYTVSG
FT                   ASSWSVTVNPGSGQSIQNSWNATRSGNTFTSSGSNTFGVTYYSGGNTSVPSATCTAR"
FT                   /protein_id="YP_003635362.1"
FT   misc_feature    complement(282615..283145)
FT                   /note="Glycosyl hydrolases family 11; Region:
FT                   Glyco_hydro_11; pfam00457"
FT                   /db_xref="CDD:144158"
FT                   /locus_tag="Cfla_0244"
FT   misc_feature    complement(281622..282134)
FT                   /note="Polysaccharide deacetylase; Region: Polysacc_deac_1;
FT                   cl12061"
FT                   /db_xref="CDD:164326"
FT                   /locus_tag="Cfla_0244"
FT   gene            complement(283694..286699)
FT                   /db_xref="GeneID:9144111"
FT                   /locus_tag="Cfla_0245"
FT   CDS_pept        complement(283694..286699)
FT                   /locus_tag="Cfla_0245"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00331"
FT                   /codon_start="1"
FT                   /product="glycoside hydrolase family 10"
FT                   /transl_table="11"
FT                   /note="KEGG: ami:Amir_4732 endo-1,4-beta-xylanase; PFAM:
FT                   glycoside hydrolase family 10; glycoside hydrolase family
FT                   11; polysaccharide deacetylase; cellulose- binding family
FT                   II; SMART: glycoside hydrolase family 10; cellulose-
FT                   binding family II"
FT                   /db_xref="GI:296128113"
FT                   /db_xref="InterPro:IPR001000"
FT                   /db_xref="InterPro:IPR001137"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018208"
FT                   /db_xref="GeneID:9144111"
FT                   /translation="MRNTRSSVPRRTRGLRAAISSVATGALLATSVLLAAPASAQTITS
FT                   NGTGTHSGWWYSFWTDSPGTVSATMKSGGSYSTSWRNTGNFVIGKGWNRGDATKVVNYS
FT                   GSFNPSGNAYLTLYGWTNGPLIEYYIVDNWGTYRPTGTFKGTVTSDGGTYDIYETTRVN
FT                   APSIEGDRSTFKQFWSVRQQKRNGGGTITAANHFNAWSRAGMQLGTHNYMIFATEGYQS
FT                   SGSSDLTVTSGGGNTGGNTGGNTGGGTSNGCTVTATRGESWSDRFNVTYTVSGASNWTV
FT                   TVNPGSGQSIQNSWNATRSGNTFTSSGSNSFGVTYYSGGNTSIPSASCNSTGGSTGGDT
FT                   GGNTQNCSAGYVALTFDDGPNTGTTNSLINALKSAGATATVFPTGQNVAANPSLAKAYA
FT                   DAGFQIGNHSWDHPYLTQQSQSNQQSQLSRTQDAIRSATGQTPTIFRPPYGDTNSQLQS
FT                   VASGLGLRTVTWDVDSTDYNNASVQTIRNAAARLTSGQIILMHDWPANTIQAIPGIVQD
FT                   LRSRNLCTGHISSSTGRAVAPAGGGTQPTQQPTTQPTTQPTQQPTTQPTAQPTNAPAGT
FT                   TLQAAAARTGRYFGAAAANFYLTNSGISPILNREFNMITAENEMKVDAMQPNQGQFNWN
FT                   SGNTIVNWALQNNKRVRGHALAWHSQQPGWMQNQSGTTLRNSMLNHITQVAGYYKGKIY
FT                   AWDVVNEAFADGSSGARRDSNLQRTGNDWIEAAFRAARAADPQAKLCYNDYNTDNWSHA
FT                   KTQGVYNMVRDFKARGVPIDCVGFQAHFNSGNPVPSNYDVTLRNFADLGVDVQITELDI
FT                   EGSGTSQAEQFRGVTQACLSVPRCTGITVWGVRDSESWRSYGTPLLFDGSGNKKAAYNY
FT                   VLDALNAGSGQSTGGNTGGNTGGGDTGGNTGGGDGGATGGYDSGSYVNNGCTVSWTRDN
FT                   DWSDRFNVTYTVTGKSNWTVTMHPNSGQSIQSSWNATRSGNTFTPAGSNSFGVTWYKGS
FT                   SNNGWIPWGICS"
FT                   /protein_id="YP_003635363.1"
FT   misc_feature    complement(286019..286549)
FT                   /note="Glycosyl hydrolases family 11; Region:
FT                   Glyco_hydro_11; pfam00457"
FT                   /db_xref="CDD:144158"
FT                   /locus_tag="Cfla_0245"
FT   misc_feature    complement(<285803..285922)
FT                   /note="Cellulose binding domain; Region: CBM_2; cl02709"
FT                   /db_xref="CDD:155069"
FT                   /locus_tag="Cfla_0245"
FT   misc_feature    complement(285137..285646)
FT                   /note="Polysaccharide deacetylase; Region: Polysacc_deac_1;
FT                   cl12061"
FT                   /db_xref="CDD:164326"
FT                   /locus_tag="Cfla_0245"
FT   misc_feature    complement(284072..284938)
FT                   /note="Glycosyl hydrolase family 10; Region:
FT                   Glyco_hydro_10; cl01495"
FT                   /db_xref="CDD:154432"
FT                   /locus_tag="Cfla_0245"
FT   misc_feature    complement(<283760..283936)
FT                   /note="Cellulose binding domain; Region: CBM_2; cl02709"
FT                   /db_xref="CDD:155069"
FT                   /locus_tag="Cfla_0245"
FT   gene            complement(287080..288111)
FT                   /db_xref="GeneID:9144112"
FT                   /locus_tag="Cfla_0246"
FT   CDS_pept        complement(287080..288111)
FT                   /locus_tag="Cfla_0246"
FT                   /gene_family="HOG000179135" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:3.2.1.8"
FT                   /codon_start="1"
FT                   /EC_number="3.2.1.8"
FT                   /transl_table="11"
FT                   /note="PFAM: glycoside hydrolase family 11; cellulose-
FT                   binding family II; KEGG: endo-1,4-beta-xylanase; SMART:
FT                   cellulose-binding family II"
FT                   /db_xref="GI:296128114"
FT                   /db_xref="InterPro:IPR001137"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR013319"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="InterPro:IPR018208"
FT                   /db_xref="GeneID:9144112"
FT                   /translation="MTDTFGTPQVARRRARAALGAVAAAALAAGTLALASPATAQNVSS
FT                   NQTGTHSGYWYSFWTDSPGTVSAVLGNGGNYSTSWRNTGNFVIGKGWSTGSNRSVSYSG
FT                   SFNPSGNAYLTLYGWTTGPLVEYYIVDNWGTYRPTGTFKGTVSSDGGTYDIYETTRYNA
FT                   PSIQGNQTFKQFWSVRQQKRTGGTITAGNHFSAWQRAGMQMGSHNYMIMATEGYQSSGS
FT                   SNITVGSTSSGGNTGGGSTGGGSTGGGSTGGTDSGSNTNNGCTVSWTRGEEWGDRFNVT
FT                   YTVSGRSSWSVTVYPNTGQSIQSSWGATRSGNTFRSSGSNSFGVTYYKGSQNINYIPWG
FT                   ICS"
FT                   /product="Endo-1,4-beta-xylanase"
FT                   /protein_id="YP_003635364.1"
FT   misc_feature    complement(287458..287961)
FT                   /note="Glycosyl hydrolases family 11; Region:
FT                   Glyco_hydro_11; pfam00457"
FT                   /db_xref="CDD:144158"
FT                   /locus_tag="Cfla_0246"
FT   gene            complement(288467..288832)
FT                   /db_xref="GeneID:9144113"
FT                   /locus_tag="Cfla_0247"
FT   CDS_pept        complement(288467..288832)
FT                   /locus_tag="Cfla_0247"
FT                   /gene_family="HOG000223859" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Krad_2652"
FT                   /codon_start="1"
FT                   /product="DoxX family protein"
FT                   /transl_table="11"
FT                   /note="KEGG: kra:Krad_2652 DoxX family protein"
FT                   /db_xref="GI:296128115"
FT                   /db_xref="GeneID:9144113"
FT                   /translation="MLVALWTVNALLALAFIGTGTFKLARSKEQLRAAGMAWTDDFDAA
FT                   RIKLAGIAEVLGALGLVLPLATGVAPVLTPVAAVALAGTMVAATAVHLRRRESPAPAVV
FT                   LLVLSLASAALGFLVLA"
FT                   /protein_id="YP_003635365.1"
FT   gene            complement(289087..289719)
FT                   /db_xref="GeneID:9144114"
FT                   /locus_tag="Cfla_0248"
FT   CDS_pept        complement(289087..289719)
FT                   /locus_tag="Cfla_0248"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: art:Arth_0438 hypothetical protein"
FT                   /db_xref="GI:296128116"
FT                   /db_xref="GeneID:9144114"
FT                   /translation="MPALREHREKDVVAWLLDYDPALRRQVLRDLADAPAGEVARERYR
FT                   VAHDGWGAQLLAAQDPDGRWSGGTFFPQRVSTEATLRLLRTLGADPDDSTCSPKRGPDG
FT                   RWCLEQQHHDRLSIDLGETVGAPSRRAHAPRAARPALGAWSSGVGPAPGVAVVGGGRAL
FT                   RHPHRVGGAWSALDGAEVGVARHVAPRRQVDGRDGIGGDEVDDGSRP"
FT                   /protein_id="YP_003635366.1"
FT   gene            289853..290755
FT                   /db_xref="GeneID:9144115"
FT                   /locus_tag="Cfla_0249"
FT   CDS_pept        289853..290755
FT                   /locus_tag="Cfla_0249"
FT                   /gene_family="HOG000160733" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: scl:sce8432 hypothetical protein"
FT                   /db_xref="GI:296128117"
FT                   /db_xref="GeneID:9144115"
FT                   /translation="MAVLAATTLALAPGATADDGPTGSGGGAGPQAGHGAGGPGKPGGP
FT                   GPGPGRPGPGQPGPGGPGGHGPRGTCADLDVLFCEDFEGQPTGGAASLDWGVSTRNGTL
FT                   TVERAGRAGKALHVHTVDNGKAFLEVTDFAAPDNTFWGRLRIKVDEFPTAPDWAHFTLV
FT                   EVTGTDSDEIVRPLGGQFAPTVGEDAIFWGIGADGGPTGDWTSWRESAPTVADRWQCVE
FT                   FEWSAQENRVALWFDGVAQPDLTVTGEDHGGADVPFVLPTADTVRIGWQLYQGGTTPDH
FT                   FDVLVDDITLAAERVGCGS"
FT                   /protein_id="YP_003635367.1"
FT   gene            complement(291023..292615)
FT                   /db_xref="GeneID:9144116"
FT                   /locus_tag="Cfla_0250"
FT   CDS_pept        complement(291023..292615)
FT                   /locus_tag="Cfla_0250"
FT                   /gene_family="HOG000237401" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Svir_36960"
FT                   /codon_start="1"
FT                   /product="putative exporter of polyketide antibiotics"
FT                   /transl_table="11"
FT                   /note="KEGG: svi:Svir_36960 putative exporter of polyketide
FT                   antibiotics"
FT                   /db_xref="GI:296128118"
FT                   /db_xref="GeneID:9144116"
FT                   /translation="MSAALVGTRPLLHATARHDGRRFVPWIGVATLLTVSSVVVYPWVF
FT                   PDAAARQGLAVAVDANPALGLIFGPARDLTTVDGFNAWRTLALGGFLVALGAVLAVTRA
FT                   TRAQEDSGQAELLASGVVGRSARLLAGVALALVGSLAAGVAAGVGAALCGGDPEASLLL
FT                   GATFTATGWMFAAVAAVTAQLGSDARTASSLAVATLGTLFVLRGFTTSLGAPAWTTWVN
FT                   PLGWTLETRPASGNHWAPLLLAVAFTAAGVAVAFALQGRRDFGQGTIAPRPGPARGTTR
FT                   STWRLAVRVNRASVATWAVAACLLGVVLGSFTTSLDDLLAGSPGVQQVLAAGATTPAAL
FT                   TGVFVRTVLALAGIVATVPGVQVVLRVRAEEVDDRLEPVLATAVDRRRCYASHVVLALA
FT                   VSGTCTLLTGTVVAALADRADVAVGFTDVLRQATATVPAVWTVVALSVAVVGARPAASL
FT                   VAWAGVLVSFMLTLLGPTFGLDDWVLGISPFWHVPATAAPSPDWSGLAWLALTATLLVT
FT                   AGVTAFHRRDVPH"
FT                   /protein_id="YP_003635368.1"
FT   misc_feature    complement(291134..292615)
FT                   /note="Putative exporter of polyketide antibiotics [Cell
FT                   envelope biogenesis, outer membrane]; Region: TnrB3;
FT                   COG3559"
FT                   /db_xref="CDD:33361"
FT                   /locus_tag="Cfla_0250"
FT   gene            complement(292612..293505)
FT                   /db_xref="GeneID:9144117"
FT                   /locus_tag="Cfla_0251"
FT   CDS_pept        complement(292612..293505)
FT                   /locus_tag="Cfla_0251"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rer:RER_17880 ABC transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="GI:296128119"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9144117"
FT                   /translation="MTDTVIDVRGLTKSFGRFRALDGLDLEVERGQVHGFLGPNGAGKS
FT                   TTIRVLLGLLRADAGTVRLLGGDPWVDVVALHRRLAYVPGDVSLWPGMTGGEAIDLLGA
FT                   LRGGLDERRRAELVERFELDPTKRGRQYSKGNRQKVAIVAALASDVELLVLDEPTSGLD
FT                   PLMENVFQEVIGEAKARGTTVLLSSHVLAEVESLADRISIIRDGRVVRSGSLADLRGES
FT                   RTTIHATLTHVPPADTLGALDDVHLDGDRLTATVASDRVGDAMTALTPHGLTALTVAPP
FT                   SLESLFLRLYGDEDAR"
FT                   /protein_id="YP_003635369.1"
FT   misc_feature    complement(292630..293493)
FT                   /note="ABC-type multidrug transport system, ATPase
FT                   component [Defense mechanisms]; Region: CcmA; COG1131"
FT                   /db_xref="CDD:31326"
FT                   /locus_tag="Cfla_0251"
FT   misc_feature    complement(292879..293490)
FT                   /note="This family of ATP-binding proteins belongs to a
FT                   multisubunit transporter involved in drug resistance (BcrA
FT                   and DrrA), nodulation, lipid transport, and lantibiotic
FT                   immunity.  In bacteria and archaea, these transporters
FT                   usually include an ATP-binding...; Region:
FT                   ABC_DR_subfamily_A; cd03230"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="Cfla_0251"
FT   misc_feature    complement(293371..293394)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="Cfla_0251"
FT   misc_feature    complement(order(292939..292941,293035..293040,
FT                   293251..293253,293368..293376,293380..293385))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="Cfla_0251"
FT   misc_feature    complement(293251..293262)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="Cfla_0251"
FT   misc_feature    complement(293083..293112)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="Cfla_0251"
FT   misc_feature    complement(293035..293052)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="Cfla_0251"
FT   misc_feature    complement(293017..293028)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="Cfla_0251"
FT   misc_feature    complement(292933..292953)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72989"
FT                   /locus_tag="Cfla_0251"
FT   gene            293580..294164
FT                   /db_xref="GeneID:9144118"
FT                   /locus_tag="Cfla_0252"
FT   CDS_pept        293580..294164
FT                   /locus_tag="Cfla_0252"
FT                   /gene_family="HOG000021524" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, TetR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG: saq:Sare_3404
FT                   TetR family transcriptional regulator"
FT                   /db_xref="GI:296128120"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="GeneID:9144118"
FT                   /translation="MPTERARPTGRRPGESGTRDAIRDAALRLFAEHGYGASVRAIATA
FT                   AGVDPGLVRHYYGDKDGLFTTVVAERLHLAPLLAQTLAADPEVAAPEFARAYLGIWEQP
FT                   AVRPLLLAIVRSATSSSRAAHMLRDMLGTRIRSASGGDPERERRLALAGASLMGIAVAR
FT                   HVVGVGPLAEMPYDELVEHVTPAVRGYLAGE"
FT                   /protein_id="YP_003635370.1"
FT   misc_feature    293610..294155
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   AcrR; COG1309"
FT                   /db_xref="CDD:31500"
FT                   /locus_tag="Cfla_0252"
FT   misc_feature    293643..293771
FT                   /note="Bacterial regulatory proteins, tetR family; Region:
FT                   TetR_N; pfam00440"
FT                   /db_xref="CDD:144144"
FT                   /locus_tag="Cfla_0252"
FT   gene            complement(294165..294632)
FT                   /db_xref="GeneID:9144119"
FT                   /locus_tag="Cfla_0253"
FT   CDS_pept        complement(294165..294632)
FT                   /locus_tag="Cfla_0253"
FT                   /gene_family="HOG000216558" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF10604"
FT                   /codon_start="1"
FT                   /product="Polyketide cyclase/dehydrase"
FT                   /transl_table="11"
FT                   /note="PFAM: Polyketide cyclase/dehydrase; KEGG:
FT                   gbr:Gbro_0406 polyketide cyclase/dehydrase"
FT                   /db_xref="GI:296128121"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="GeneID:9144119"
FT                   /translation="MIVESAVDVPVPPDVAFAVSQTTGEVRLRWDPFIRRQRFLDGATV
FT                   PAKGVRTLTLHRSGLRMVSEYVSYKLPTNVGMKMVEGPWFFAVMAGGWRFAPLPDGGTR
FT                   AVWRYSFTCRPAWLAPVAERIGRVVLQRDVDRRIAGFARGCADPQVLAAVR"
FT                   /protein_id="YP_003635371.1"
FT   misc_feature    complement(294204..294548)
FT                   /note="Polyketide cyclase / dehydrase and lipid transport;
FT                   Region: Polyketide_cyc2; cl10449"
FT                   /db_xref="CDD:175214"
FT                   /locus_tag="Cfla_0253"
FT   gene            complement(294629..295057)
FT                   /db_xref="GeneID:9144120"
FT                   /locus_tag="Cfla_0254"
FT   CDS_pept        complement(294629..295057)
FT                   /locus_tag="Cfla_0254"
FT                   /gene_family="HOG000232017" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /codon_start="1"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /transl_table="11"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: bcv:Bcav_1024 hypothetical
FT                   protein"
FT                   /db_xref="GI:296128122"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="GeneID:9144120"
FT                   /translation="MRGGLHHLELWVTDLERATATLGWLLERLGHTRTDTWATGASWRL
FT                   GDAYVVLEAGPDVVDAPHERRRPGLNHVAFHAGTRRDVDDLTADAVAHGWRLLFADRHP
FT                   HAGGPEHYAAYLEDADGFEVELVASPGAEAAATPRVGG"
FT                   /protein_id="YP_003635372.1"
FT   misc_feature    complement(294674..295048)
FT                   /note="This conserved domain belongs to a superfamily
FT                   including the bleomycin resistance protein, glyoxalase I,
FT                   and type I ring-cleaving dioxygenases; Region:
FT                   Glo_EDI_BRP_like_6; cd07242"
FT                   /db_xref="CDD:176666"
FT                   /locus_tag="Cfla_0254"
FT   misc_feature    complement(order(294677..294679,294692..294694,
FT                   294812..294814,294824..294856,294893..294895,
FT                   294899..294901,294914..294916,295025..295048))
FT                   /note="putative dimer interface; other site"
FT                   /db_xref="CDD:176666"
FT                   /locus_tag="Cfla_0254"
FT   misc_feature    complement(order(294683..294685,294689..294691,
FT                   294713..294715,294842..294847))
FT                   /note="ligand binding site; other site"
FT                   /db_xref="CDD:176666"
FT                   /locus_tag="Cfla_0254"
FT   misc_feature    complement(order(294683..294685,294842..294844))
FT                   /note="Zn binding site; other site"
FT                   /db_xref="CDD:176666"
FT                   /locus_tag="Cfla_0254"
FT   gene            complement(295060..295551)
FT                   /db_xref="GeneID:9144121"
FT                   /locus_tag="Cfla_0255"
FT   CDS_pept        complement(295060..295551)
FT                   /locus_tag="Cfla_0255"
FT                   /gene_family="HOG000070339" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:BCAM1834"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcj:BCAM1834 hypothetical protein"
FT                   /db_xref="GI:296128123"
FT                   /db_xref="GeneID:9144121"
FT                   /translation="MSTEHLDPAEQFLREFLTSATPQQRHTFVRRCNYDAGDATVRFVL
FT                   DDPTTDRATALAAYWILGASYYSRFASAEEVADDERPTWELLRTIEDRYASGFWADHGI
FT                   AFDPTDDDEIDWTDDYGAPVNRPVPDAMKRAVPGTLVDDEGTEDGLPLDVHLRWTALVD
FT                   "
FT                   /protein_id="YP_003635373.1"
FT   gene            295648..295812
FT                   /db_xref="GeneID:9144122"
FT                   /locus_tag="Cfla_0256"
FT   CDS_pept        295648..295812
FT                   /locus_tag="Cfla_0256"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Achl_3345"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ach:Achl_3345 hypothetical protein"
FT                   /db_xref="GI:296128124"
FT                   /db_xref="GeneID:9144122"
FT                   /translation="MKKLIVFLLIAWLVLSVLGALIEGLLWLLVVGLVLFAATAVYGWF
FT                   TGRRDASHS"
FT                   /protein_id="YP_003635374.1"
FT   gene            295809..296099
FT                   /db_xref="GeneID:9144123"
FT                   /locus_tag="Cfla_0257"
FT   CDS_pept        295809..296099
FT                   /locus_tag="Cfla_0257"
FT                   /gene_family="HOG000000276" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Krad_3984"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: kra:Krad_3984 hypothetical protein"
FT                   /db_xref="GI:296128125"
FT                   /db_xref="GeneID:9144123"
FT                   /translation="MTGRTAALVDRAIDAYQRRLSPRKGWGCAHRVAHGGPSCSGAVRT
FT                   LVRCRGVTRSVVPTVVRFVACYQAARMLAQTDVSGVCCCGGIPIPFRFPGR"
FT                   /protein_id="YP_003635375.1"
FT   gene            complement(296423..298771)
FT                   /db_xref="GeneID:9144124"
FT                   /locus_tag="Cfla_0258"
FT   CDS_pept        complement(296423..298771)
FT                   /locus_tag="Cfla_0258"
FT                   /gene_family="HOG000055022" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03632"
FT                   /codon_start="1"
FT                   /product="glycoside hydrolase family 65 central catalytic"
FT                   /transl_table="11"
FT                   /note="PFAM: glycoside hydrolase family 65 central
FT                   catalytic; glycoside hydrolase family 65 domain protein;
FT                   KEGG: kra:Krad_3033 kojibiose phosphorylase"
FT                   /db_xref="GI:296128126"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="GeneID:9144124"
FT                   /translation="MTPASRAVRRGAWSTVRVPLSVEPWVLREPTLDVDDLPRTAALLT
FT                   VANGHLGVRGVLEEQRPPVPDATLLSSVYEHHPHEYPEHAYGYPAHDERLEAVVDACGV
FT                   DLRVDGEPFDVRTGTLEHHERRLDLRTAVLEREAVWTSPGGSTVEVRTRRWASLVRREL
FT                   VVASYEVRAPGRARVRLRPVPGCGGPSSDVPAPGLRTDACAHAPGTTWVAQRTVAAGIG
FT                   VVLATTHGVTASPGAQHRWVEDRHGWALDVELPADGWVRVATHGAYACGRRPVEALLAD
FT                   ARTVLAGAHDEATLEAEHRAFLDDVWERADVLVEGDDELQQAVRLAVLHTVQSAARVEG
FT                   SGLRAKGLTGTGYHGHTFWDAESFVLPVLDHVLPGAAAAHLRWRHATLPAAVERARTLG
FT                   LPGAAFPWRTISGAECSGYWPAGTAAVHVTADVMDAVSRYVAVTGDDALEREVGVELLV
FT                   QGARFWLGRGHRTPDGAFHLHGVTGPDEYTAVVDDNTYTNLLVARSLTAAVEATGRWPD
FT                   EARRLGVDDDERARWAQAAGAVTVPYADDLGVTEQCTGFTQRPVWDFARGPQGWAPFED
FT                   HVHYTELYRHQLVKQADLVLALAVVGERFTREQKRRDFAYYEPLTVRDSSLSASAQAVV
FT                   AAELGHLTLAHAYVRECAFIDLHDLRRETQEGVHVAAMAGTWDALVRGYGGVRLEGGGL
FT                   RVEPRLPPRLARLRFRVQIDGWRVEVDARRDEVTYRLLTGARVALRHVGDGAQEDVVLT
FT                   ADDPVASRALRPVAEPTPPAQPPGREPRG"
FT                   /protein_id="YP_003635376.1"
FT   misc_feature    complement(296531..298708)
FT                   /note="Trehalose and maltose hydrolases (possible
FT                   phosphorylases) [Carbohydrate transport and metabolism];
FT                   Region: ATH1; COG1554"
FT                   /db_xref="CDD:31743"
FT                   /locus_tag="Cfla_0258"
FT   misc_feature    complement(<298256..298693)
FT                   /note="Glycosyl hydrolase family 65, N-terminal domain;
FT                   Region: Glyco_hydro_65N; pfam03636"
FT                   /db_xref="CDD:146332"
FT                   /locus_tag="Cfla_0258"
FT   gene            298863..299795
FT                   /db_xref="GeneID:9144125"
FT                   /locus_tag="Cfla_0259"
FT   CDS_pept        298863..299795
FT                   /locus_tag="Cfla_0259"
FT                   /gene_family="HOG000235950" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /codon_start="1"
FT                   /product="PfkB domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: PfkB domain protein; KEGG: mpa:MAP0299c
FT                   hypothetical protein"
FT                   /db_xref="GI:296128127"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="GeneID:9144125"
FT                   /translation="MVDVVVLGQVGRDLVVRVDAVPAAGEAAPVRERVEVLGGKGANQG
FT                   VACAQLGLATALVGVVGDDRAADAVLERAVADGMDVGHVVRRAGATTALLLDVVADGGE
FT                   RRLLEHVPDDVLLRPDDVRAAAGLVGRARAVLLQLQQPADALAPALGTARDALLVADGA
FT                   PQDEGFRDTLLDRVHVLRADEDEAALLLGDAPDGVDATVAAAHELVGRGPRVVALEAGD
FT                   ANVVAWAEGHVVVPLLGGPPVDPTGGGDSFVAGLVAALLAGHDAATAAWWASTAAAATA
FT                   SRLGGRPDLDVARVAADAARHRREHETGH"
FT                   /protein_id="YP_003635377.1"
FT   misc_feature    298869..>299186
FT                   /note="ribokinase/pfkB superfamily: Kinases that accept a
FT                   wide variety of substrates, including carbohydrates and
FT                   aromatic small molecules, all are phosphorylated at a
FT                   hydroxyl group. The superfamily includes ribokinase,
FT                   fructokinase, ketohexokinase, 2-...; Region:
FT                   ribokinase_pfkB_like; cl00192"
FT                   /db_xref="CDD:176811"
FT                   /locus_tag="Cfla_0259"
FT   gene            complement(299833..300504)
FT                   /db_xref="GeneID:9144126"
FT                   /locus_tag="Cfla_0260"
FT   CDS_pept        complement(299833..300504)
FT                   /locus_tag="Cfla_0260"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bur:Bcep18194_C7216 hypothetical protein"
FT                   /db_xref="GI:296128128"
FT                   /db_xref="GeneID:9144126"
FT                   /translation="MAPPVGGPDVRAAVVLLPAPAWAGDLQPEEFEDAALQPWQVIGWG
FT                   EDGASAKVRDGTLTVDPETLVMLREEATPSEWTGSANRLTGFDVEFRMRLGGDAQGGCT
FT                   GENGTPPTLLWVGDTTDLLQIGFSATELCLLYPYGEGHVVTLDALRWHRYALEVRGQHV
FT                   RLLVDGRAVLDEILRQTGGGTVGLGLETYRGTSTWDYVRYDTAPGRACTIRGTDGLAHS
FT                   G"
FT                   /protein_id="YP_003635378.1"
FT   misc_feature    complement(<299974..300279)
FT                   /note="Laminin G domain; Laminin G-like domains are usually
FT                   Ca++ mediated receptors that can have binding sites for
FT                   steroids, beta1 integrins, heparin, sulfatides, fibulin-1,
FT                   and alpha-dystroglycans. Proteins that contain LamG domains
FT                   serve a variety of...; Region: LamG; cl00102"
FT                   /db_xref="CDD:153513"
FT                   /locus_tag="Cfla_0260"
FT   gene            complement(300512..301345)
FT                   /db_xref="GeneID:9144127"
FT                   /locus_tag="Cfla_0261"
FT   CDS_pept        complement(300512..301345)
FT                   /locus_tag="Cfla_0261"
FT                   /gene_family="HOG000221469" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:ROP_23500"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rop:ROP_23500 hypothetical membrane protein"
FT                   /db_xref="GI:296128129"
FT                   /db_xref="GeneID:9144127"
FT                   /translation="MTTTSTAPQQTTTSRDRVRQVTVLVGAAVAIVGATIGSGAFGGQP
FT                   IAEAAGGALSATATPVAPDSPAFSIWSVIYTGLVVFAIVQALPRYAADRRLRAIAWWVL
FT                   VSMLLNALWIGVVQTGSVGGSVVVIVVLLAVLATMYVKLLRTPRTATLPSVVTDVTVGL
FT                   YTGWVSVATLANTAAFLADAEVGELGLGATGWSVVLVSAAALLAIAYGAYGRRLPTLVV
FT                   PIGLAMGWGLMWIGLGRTNGPLVDGTVATAAFVAAGVALLAPVVATLAARRSGRR"
FT                   /protein_id="YP_003635379.1"
FT   gene            complement(301429..302028)
FT                   /db_xref="GeneID:9144128"
FT                   /locus_tag="Cfla_0262"
FT   CDS_pept        complement(301429..302028)
FT                   /locus_tag="Cfla_0262"
FT                   /gene_family="HOG000266991" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, TetR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   cyn:Cyan7425_2726 transcriptional regulator, TetR family"
FT                   /db_xref="GI:296128130"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="GeneID:9144128"
FT                   /translation="MPSGPRTPRERTTYHHGALREALLAGAREMLAERGLDGFSLSALA
FT                   RRLGVSTAAPYRHFADRDALLDALCLEGYALFGAALARAARTTDDPREVLHALGVAYLT
FT                   FAREHPSFFAIMFTGRSDATIEAGAPTFEPLVQAVLAAQQAGALPAGTDPRVLSRTLWA
FT                   TLHGLAVLSRQRGFVKLGLDDTDERLVADAFALALR"
FT                   /protein_id="YP_003635380.1"
FT   misc_feature    complement(<301852..301902)
FT                   /note="nucleoid occlusion protein; Provisional; Region:
FT                   slmA; PRK09480"
FT                   /db_xref="CDD:169908"
FT                   /locus_tag="Cfla_0262"
FT   gene            302106..302822
FT                   /db_xref="GeneID:9144129"
FT                   /locus_tag="Cfla_0263"
FT   CDS_pept        302106..302822
FT                   /locus_tag="Cfla_0263"
FT                   /gene_family="HOG000084626" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF10067"
FT                   /codon_start="1"
FT                   /product="Protein of unknown function DUF2306, membrane"
FT                   /transl_table="11"
FT                   /note="PFAM: Protein of unknown function DUF2306, membrane;
FT                   KEGG: fre:Franean1_0531 hypothetical protein"
FT                   /db_xref="GI:296128131"
FT                   /db_xref="InterPro:IPR018750"
FT                   /db_xref="GeneID:9144129"
FT                   /translation="MTTTAPPRIEPPADPAVRRRRVGLGVVAFLALGVTLTMLSIYGSA
FT                   SLDELAADDAGLAGAYAVAAPFFQGALYVHIVTACVALALGPLQFVARLRRSRPRLHRG
FT                   VGRTYLGAVALGAVSGLAILPVNSAGLVGVFGFGALAVLWLVTGYRALRAIRGGDVATH
FT                   QAWMIRSYALTFAAVTLRLWLGLLMGAQLALGAAPDAAFANAYAAVPFLCWLPNLVVAE
FT                   ALVRRRGLPSYALPAT"
FT                   /protein_id="YP_003635381.1"
FT   misc_feature    <302478..302642
FT                   /note="Predicted membrane protein (DUF2306); Region:
FT                   DUF2306; cl02232"
FT                   /db_xref="CDD:154810"
FT                   /locus_tag="Cfla_0263"
FT   gene            complement(302801..303559)
FT                   /db_xref="GeneID:9144130"
FT                   /locus_tag="Cfla_0264"
FT   CDS_pept        complement(302801..303559)
FT                   /locus_tag="Cfla_0264"
FT                   /gene_family="HOG000218760" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /codon_start="1"
FT                   /product="metallophosphoesterase"
FT                   /transl_table="11"
FT                   /note="PFAM: metallophosphoesterase; KEGG:
FT                   bcm:Bcenmc03_5021 metallophosphoesterase"
FT                   /db_xref="GI:296128132"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR011152"
FT                   /db_xref="GeneID:9144130"
FT                   /translation="MRIAVISDVHGNLPALEAVLVDAGAHAVDVTVNLGDLLSGAVLPR
FT                   ETADRLVELGLPTVRGNHERQLLTLPVGRMGASDRLAHDALTPAHRAWLAGLPLTLELP
FT                   GDVLAFHGSPTDDLQYLLETVGPAGLRRATVDEVIERLGGHAHRRLLLCGHTHLQRAVT
FT                   LPTGALVVNPGSVGWPAYEDDAPHPHVVEAGTPHARYALVEEVAGRWDVTFRAVDYDWE
FT                   AAAAAAQGHGRPDVAHALRTGRVPHVAGSA"
FT                   /protein_id="YP_003635382.1"
FT   misc_feature    complement(303017..303559)
FT                   /note="Predicted phosphoesterases, related to the Icc
FT                   protein [General function prediction only]; Region:
FT                   COG2129"
FT                   /db_xref="CDD:32312"
FT                   /locus_tag="Cfla_0264"
FT   misc_feature    complement(<303191..303547)
FT                   /note="metallophosphatase superfamily, metallophosphatase
FT                   domain; Region: MPP_superfamily; cl13995"
FT                   /db_xref="CDD:175423"
FT                   /locus_tag="Cfla_0264"
FT   misc_feature    complement(order(303227..303229,303371..303376,
FT                   303452..303454,303530..303532,303536..303538))
FT                   /note="active site"
FT                   /db_xref="CDD:163614"
FT                   /locus_tag="Cfla_0264"
FT   misc_feature    complement(order(303227..303229,303374..303376,
FT                   303452..303454,303530..303532,303536..303538))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:163614"
FT                   /locus_tag="Cfla_0264"
FT   gene            complement(303590..304516)
FT                   /db_xref="GeneID:9144131"
FT                   /locus_tag="Cfla_0265"
FT   CDS_pept        complement(303590..304516)
FT                   /locus_tag="Cfla_0265"
FT                   /gene_family="HOG000023913" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /codon_start="1"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   aminoglycoside phosphotransferase"
FT                   /db_xref="GI:296128133"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016477"
FT                   /db_xref="GeneID:9144131"
FT                   /translation="MPRVERTTRYGPRVDGRGNEAVLLAHLHAADVADVVAVEAAEGGQ
FT                   AAVAGLARRRDGSRVFVKAFDEPPAADVFAAEAEGLAALRMLGGATTPEVLLASTDLLV
FT                   LEALHPRRDDAAFWEHLAHDLARVHSTTHDRFGWHQDNWLGRRRQANTWEEDGFEFFTQ
FT                   HRLLRWLDEPRVQAALDAEDRAALERLCARLPELLPERPACLVHGDLWAGNVLATAAGA
FT                   PALIDPAVSYTWAEIDLAHVWTTSPPPQAARFFAVYAEVTGLDAGWRERVPLVQLRQHL
FT                   AVVAQFEPDRGAADAIRSTLAPFRRRT"
FT                   /protein_id="YP_003635383.1"
FT   misc_feature    complement(303719..304360)
FT                   /note="Phosphotransferase enzyme family; Region: APH;
FT                   pfam01636"
FT                   /db_xref="CDD:145007"
FT                   /locus_tag="Cfla_0265"
FT   misc_feature    complement(303656..304342)
FT                   /note="Protein Kinases, catalytic domain; Region: PKc_like;
FT                   cl09925"
FT                   /db_xref="CDD:175044"
FT                   /locus_tag="Cfla_0265"
FT   gene            304573..304965
FT                   /db_xref="GeneID:9144132"
FT                   /locus_tag="Cfla_0266"
FT   CDS_pept        304573..304965
FT                   /locus_tag="Cfla_0266"
FT                   /gene_family="HOG000058723" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /codon_start="1"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   saq:Sare_2411 cupin 2 domain-containing protein"
FT                   /db_xref="GI:296128134"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="GeneID:9144132"
FT                   /translation="MEHWTIATVAQESPDFRRVLWTGKHSQLVIMTIPPGGEIGQEVHE
FT                   DIDQILTFVSGTGKAIVSGQERKVAQGDLVVVPAGRTHNFLNTGENPLILYTVYGPPEH
FT                   AEGAVHRTKEEADAAEESGQDEPPEQ"
FT                   /protein_id="YP_003635384.1"
FT   misc_feature    304588..304920
FT                   /note="Cupin domain; Region: Cupin_2; cl09118"
FT                   /db_xref="CDD:175009"
FT                   /locus_tag="Cfla_0266"
FT   gene            305020..305736
FT                   /db_xref="GeneID:9144133"
FT                   /locus_tag="Cfla_0267"
FT   CDS_pept        305020..305736
FT                   /locus_tag="Cfla_0267"
FT                   /gene_family="HOG000079147" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro05008"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rha:RHA1_ro05008 hypothetical protein"
FT                   /db_xref="GI:296128135"
FT                   /db_xref="GeneID:9144133"
FT                   /translation="MPVAEAVPKVDGMIVAEDVLLLLTDDSTGRSVVDGTRRDIAVAGA
FT                   LVGELAATGRLAVARTTGLFARTELRVVDATPFGDDVLDDALQRAGARGGASPAAVLER
FT                   VRKGRPRERVYERLVARGILRADHGRILGIFPTSAWPAVDSAHEAETRRGLHDVLVVGR
FT                   TATPREAALVALLVGVDGLAKVLPGTGLSKRELNARAKRVAAQDVGGEAVRKAVEAMQA
FT                   AVIAASTAATAAATSG"
FT                   /protein_id="YP_003635385.1"
FT   gene            complement(305749..306699)
FT                   /db_xref="GeneID:9144134"
FT                   /locus_tag="Cfla_0268"
FT   CDS_pept        complement(305749..306699)
FT                   /locus_tag="Cfla_0268"
FT                   /gene_family="HOG000024561" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Smal_2810"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: smt:Smal_2810 hypothetical protein"
FT                   /db_xref="GI:296128136"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="GeneID:9144134"
FT                   /translation="MRFRRGTSALRRAYRHALDDGDHAAAERLARQIVEQDSSDGAMWF
FT                   DLGLAAKRRRDWPAAIEHNERALAAAAEPTEEPAAWNLGIAATAVGDWARARRAWSAFG
FT                   ITMPPGDGPLEMRLGHVPVRLNPGETELGEDPLTLDGVVHDPEVVWAERLSPAHARIAN
FT                   VPTPDSGHRWGDLVLHDGVPDGERFDGHRWVSVFNELALLERSPHPTWTVEVTAPSDED
FT                   RAALVELVEGIDRAAEDWTTSVRPLCPECSRGRPGKHDHDDGADAGPVRLFGLAGSRDE
FT                   LTDVLIAWAATGAGRSWDTLGPAVGRDRTGPDAGR"
FT                   /protein_id="YP_003635386.1"
FT   gene            complement(307420..308784)
FT                   /db_xref="GeneID:9144135"
FT                   /locus_tag="Cfla_0269"
FT   CDS_pept        complement(307420..308784)
FT                   /locus_tag="Cfla_0269"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aav:Aave_2130 hypothetical protein"
FT                   /db_xref="GI:296128137"
FT                   /db_xref="GeneID:9144135"
FT                   /translation="MPPRAAGHVVPADGDATRRPSRRPVGGVAVGTRTPASVQPPPGRA
FT                   SLPHLQRLVGNRAVAAALLRRTGAGAPVVQRAAGLPFDSHTEIHHNLLTSREFQLSSGE
FT                   GVIVELRPEWFLEDDTEDKEDRVPVPHSGPEAPPGLGGEVRVDLENLEWLDESKGRCAA
FT                   AVGRWNEIPLRTDEDGAHQLSFEIDDHHHHYYVDGPVHVRQGDAAELTDSCAAPASRSG
FT                   KDVLHDVLALAGMIPVLGVLADAADTAIYVIDGDWTGAGISAAAMVPVLGDAASLARIG
FT                   GRTVVRVTRAGAKQIEKRTAAELLKETRAALTRLRTPPGLAHAGNRLGQSVDPRLLEMA
FT                   KEARVTQAGISREAFASYNVATARVRVGTEIRYLDAGNSPGRLMHSEDWLITQVEELRR
FT                   VHGRESVALEQLFSERIPCGECLPKLERLFNAEVFYAVAKRGTRATDLMKAYGLR"
FT                   /protein_id="YP_003635387.1"
FT   gene            complement(308957..310468)
FT                   /db_xref="GeneID:9144136"
FT                   /locus_tag="Cfla_0270"
FT   CDS_pept        complement(308957..310468)
FT                   /locus_tag="Cfla_0270"
FT                   /gene_family="HOG000245066" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:nfa25540"
FT                   /codon_start="1"
FT                   /product="putative short chain dehydrogenase"
FT                   /transl_table="11"
FT                   /note="KEGG: nfa:nfa25540 putative short chain
FT                   dehydrogenase"
FT                   /db_xref="GI:296128138"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9144136"
FT                   /translation="MSAHTPTPELEPTDVDTPDVPGVDAGEFATFLRVADQVAALPQDH
FT                   PQHAAARRAASSMFKAAKKHRRTEKRRMIAEADAAVVAATATGSPGRIDDETNGIPLSS
FT                   AATGATAGTLLKPRPCYVCKQDYTVVDAFYHQLCPQCAALHHAKRDARTDLTGRRALLT
FT                   GGRAKIGMYIALRLLRDGADLTITTRFPKDAVRRFGAMEDSADWMDRLHVVGIDLRDPS
FT                   QVVSLADHVAAQGPLDILVNNAAQTVRRSPGAYSRIAEAELAPLHDEGAAMITTFGVTS
FT                   DAHPRALAGSVSELTSPALAIERATRDAAELVQQSLTADAASLERLVAGTSIDAGGLIP
FT                   DVAETNSWVATVEQVDPMELLEVQLCNQTAPFILISRLRPALAASPARRTYIVNVSAME
FT                   GVFSRGYKGPGHPHTNMSKAALNMLTRTSAAEMLDDGILMTAVDTGWITDERPHFTKVR
FT                   LAEEGFHAPLDLVDGAARVYDPIVRGEAGEDLYGCFLKDYARSQW"
FT                   /protein_id="YP_003635388.1"
FT   misc_feature    complement(<309701..310012)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="Cfla_0270"
FT   misc_feature    complement(309392..310009)
FT                   /note="Dehydrogenases with different specificities (related
FT                   to short-chain alcohol dehydrogenases) [Secondary
FT                   metabolites biosynthesis, transport, and catabolism /
FT                   General function prediction only]; Region: FabG; COG1028"
FT                   /db_xref="CDD:31231"
FT                   /locus_tag="Cfla_0270"
FT   misc_feature    complement(<309068..>309295)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="Cfla_0270"
FT   gene            310947..311891
FT                   /db_xref="GeneID:9144137"
FT                   /locus_tag="Cfla_0271"
FT   CDS_pept        310947..311891
FT                   /locus_tag="Cfla_0271"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcj:BCAM2672 hypothetical protein"
FT                   /db_xref="GI:296128139"
FT                   /db_xref="GeneID:9144137"
FT                   /translation="MRRGRNVGRVVAVVAAVAAAMMAAPPVWAAEEPPKGTVVVSMVGL
FT                   GGTYTGITYQSLWQGSRPATAYVPSWGHTMQATAYFTNLPEFGGPAWPISGTMQSTYQW
FT                   RAHCNVPGTGSRTFALTSPRTIDVPVHPSASIFRVIPPSAVVTDTVTLPALECWRIYIN
FT                   FSMHGTAKLDGSDGLFLNYFTPGPQHEFAPERASNGDIRLYRIATSGELEEVQRTGNIT
FT                   TVPQKFFQYYFTSCAAAREALGVVIGSFQPGALGLVQVSGPPSLAGSVVGATARQAGAK
FT                   DVVVWGLEHGTATALTQAQVVSDGGSPVDGCSA"
FT                   /protein_id="YP_003635389.1"
FT   gene            312002..312604
FT                   /db_xref="GeneID:9144138"
FT                   /locus_tag="Cfla_0272"
FT   CDS_pept        312002..312604
FT                   /locus_tag="Cfla_0272"
FT                   /gene_family="HOG000033623" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bcav_2757"
FT                   /codon_start="1"
FT                   /product="acetyltransferase"
FT                   /transl_table="11"
FT                   /note="KEGG: bcv:Bcav_2757 acetyltransferase"
FT                   /db_xref="GI:296128140"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="GeneID:9144138"
FT                   /translation="MGESRLTVDGHPVVALGPGTWDLFAGLAERHNGVWGGCWCTYFHL
FT                   YPDPQEERREIGHRELKRRLVMAGRAHAALVLDGDEAVAWAQYGTVAEVPNIHHRKQWE
FT                   AETTQRPDFRITCLFVDRRYRRAGMAAVAVRGALALIAQAGGGLVESYPHDLPPGKKPS
FT                   SSFLYNATRTMYERLGFTYQRPKGVGNCVMTLQVPAA"
FT                   /protein_id="YP_003635390.1"
FT   gene            complement(312834..315782)
FT                   /db_xref="GeneID:9144139"
FT                   /locus_tag="Cfla_0273"
FT   CDS_pept        complement(312834..315782)
FT                   /locus_tag="Cfla_0273"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:COG:COG1511"
FT                   /codon_start="1"
FT                   /product="membrane protein-like protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dra:DR_0075 hypothetical protein"
FT                   /db_xref="GI:296128141"
FT                   /db_xref="InterPro:IPR017909"
FT                   /db_xref="GeneID:9144139"
FT                   /translation="MSAPSPRRTSARRTSAARRTALRRAGAGTLGLPLALLLAVPASAA
FT                   GPLAAASGDVVVTNTETVQARMDADGRLQVARVYDQLAFSGTGTTTVVNPVSTRGLRNL
FT                   DGFGGYTVRDDALEATVTVDGKQRLRTVSDFTGELPVKIEVDYRLDGEKVSAGAVVGRS
FT                   GTLEVRYTVTNLTTRQDQVTYDDGTGRQATATAETVIPFVGQLTTTLPPSFTAIESAEA
FT                   NMAGDGRGGTRMSYTMTLFPPIGSPVAEFGYTAKITGGRIPAANVSVLPVSPLTSPSFK
FT                   GGSASYEGGAESGIRLTEGATEIDGNLLKLRDGAATLLDGLLQLQEGADKLAAGLNDTA
FT                   APGATRLADGLTKDAAPGAARLAGALDGELAPGAARLADGLTKDAVPGAARLAGALDGE
FT                   LAPGAARLADGLTQDAVPGAGRLAAGLNDELAPGAAEIAAGLAAAHQGAGAVAAGTHAL
FT                   DEGATALAAGAEALDAGMTSAGEAVPELLGGLTLVSDGLATMDAGLEKMYTDIGGVPTQ
FT                   AQPIKDGITRLQGGVTALLDGLTTLQGLQGQLAAVYGVLGSTTAVVTVATDAQQMGALA
FT                   QLFTGLAAQTSDPTQKGQFQQLATLYNPTAYAAAPTTPVPLAPAFTGLAGVTSNVVTRL
FT                   EAARCGLSNTVSPSCPLDQTGEAKAAGLREGLAMTDGGLDLLTAGVVASVRAAVGVEGQ
FT                   TAEDETLRGGIASLTAGVGELSTGGQALVDGLGELSAGAAELRDGSARLSVGAGTLADG
FT                   AADLAAGTGRLAPGAQRLSAGLRDAADGSQTLADRLRPAAEGSAALSDGVRAAADGALT
FT                   LADRLRPAADGSRALADGARTAADGATKLSSGIRTAADGSRELSDGLRDAADGSQTLAD
FT                   GVGTAAEGAPALVDGATRLSQEGTSVLVETGAGTAADYGVKYAVIKAGAERAATESMAY
FT                   GGPEGATSVTAYSIDIAAADGAGASSVGRGIAAAALFGIGGIVAGFARGRFV"
FT                   /protein_id="YP_003635391.1"
FT   misc_feature    complement(<313074..>313484)
FT                   /note="Predicted membrane protein [Function unknown];
FT                   Region: COG1511"
FT                   /db_xref="CDD:31700"
FT                   /locus_tag="Cfla_0273"
FT   gene            complement(315784..316473)
FT                   /db_xref="GeneID:9144140"
FT                   /locus_tag="Cfla_0274"
FT   CDS_pept        complement(315784..316473)
FT                   /locus_tag="Cfla_0274"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: GH10507 gene product from transcript GH10507-
FT                   RA"
FT                   /db_xref="GI:296128142"
FT                   /db_xref="GeneID:9144140"
FT                   /translation="MIRHVLAGVFLAVLATLTVLLSGVLGAEVQGVALLGAALGGALGL
FT                   VPDRTPAQRAGAFAAGFAAAWIGYLLRAALLPDAPSGRAVAVLVVVLVCLAVGAGTGGK
FT                   LPLWATLLGAAAMAGSYEAPYAADPSGFATTSPVHATAVLLTAGAGFLATALLGPVVQV
FT                   DRETERRREVAERDVRHLQPVGAAPAEAAPAPAPVAAPAPRAPATPSSRAVPDGRPFRP
FT                   FESTPEA"
FT                   /protein_id="YP_003635392.1"
FT   gene            complement(316664..317734)
FT                   /db_xref="GeneID:9144141"
FT                   /locus_tag="Cfla_0275"
FT   CDS_pept        complement(316664..317734)
FT                   /locus_tag="Cfla_0275"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bcm:Bcenmc03_0547 type II secretion system
FT                   protein"
FT                   /db_xref="GI:296128143"
FT                   /db_xref="GeneID:9144141"
FT                   /translation="MPLEPRLPVRPFVVDALRESGHVVSGSAPLHVEGPATDVVVDELD
FT                   GTLAVWGVEGESVRGIHLVTRDAHVVERFLLMTVAGAWRRRHGRRSLPDRRLRRPRSHR
FT                   TLLQDDGTSAVVDAAGTVVAWRLTRADAHRLAVALGHPVEDVVAALREEKGRPVWTGST
FT                   LAPVVRSLVLAVVPLVVVATVQVRRHAGSWETNLGVTLGLVLSIGGIAWYAWRRRQLRE
FT                   ASARRLDRERLGAARWRATQGAGFVEELARRRVRTRLPRLMGAGLTLVETVTALEVWLD
FT                   GRGTPLLEVPWVDVVSVDAERAPGSDVGVLVVRTRDGGRVPVVPARVRTGSERGASAAA
FT                   TAAYAAHLRAEHLGGA"
FT                   /protein_id="YP_003635393.1"
FT   gene            317967..318899
FT                   /db_xref="GeneID:9144142"
FT                   /locus_tag="Cfla_0276"
FT   CDS_pept        317967..318899
FT                   /locus_tag="Cfla_0276"
FT                   /gene_family="HOG000097731" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /codon_start="1"
FT                   /product="Abortive infection protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Abortive infection protein; KEGG: abortive
FT                   infection protein"
FT                   /db_xref="GI:296128144"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="GeneID:9144142"
FT                   /translation="MSTVTAPAPPQQQRGSVLDLIRRRPLLAFFVLANAASWLAWLPYI
FT                   LSNHGLGLWDFSFPGGFVGGQLLGMLPGAYLGPIGAALAVTAIAEGRDGLRRWARRLWN
FT                   WKVSWKWYVGILLGVPTALVLSGLVFSGGQASMPSTVVLVGLLPGLLFQMVTTGLAEEP
FT                   GWRDFALPRMQRMIGAPGAAVVIGALWGVWHLPLFVTEWAEWSGTAWYRGPEFVAFCIA
FT                   FNVVMTWVFNRTGQSLPMAMLLHVSVNNFAGAWSEIFPTWDSPMFQHVLLAAATAGAAV
FT                   ALVGTRGRLGYDPQQADGLEHRLPAARLS"
FT                   /protein_id="YP_003635394.1"
FT   gene            318905..320185
FT                   /db_xref="GeneID:9144143"
FT                   /locus_tag="Cfla_0277"
FT   CDS_pept        318905..320185
FT                   /locus_tag="Cfla_0277"
FT                   /gene_family="HOG000097730" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /codon_start="1"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /transl_table="11"
FT                   /note="KEGG: histidine kinase; PFAM: histidine kinase
FT                   dimerisation and phosphoacceptor region; ATP-binding region
FT                   ATPase domain protein; SMART: ATP-binding region ATPase
FT                   domain protein"
FT                   /db_xref="GI:296128145"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="GeneID:9144143"
FT                   /translation="MTPAQQRRRPTDVVPAVCWLLAVAVLAVPALAQGTGPTPARGAPG
FT                   FGDAAWWWALGLLTLQAVVVARCGTRPRAAVLLVAGVLPGFVVLGEAIGVALVAVIVAT
FT                   YRAVLARPARPLVPTLVAAGALVTASVAAADVGIGNRGWAVALAGVLQAVAAVVLPLVL
FT                   AGVVGARRDAVDALARSAAALERERDARVQVAVERERTAMARELHDIAAHHLSGIAVMT
FT                   GAIGRQIDVDPEGAKKAVAQVREQSTAMLRDLRNLVVLLRDATPSEADGEVRMETLAGV
FT                   ADLVARARATGQDVTLSETGPVADVATSGAVGPLAQLAAYRVVQEALSNAARHAPGARC
FT                   DVRLDAGTAGRVEVEVRNGPSGPGLEPAAHEPGYGLVGMRERAELTGATLRYGPTVDGG
FT                   WQVRMVVPVGEVVAQPVADATREEQDR"
FT                   /protein_id="YP_003635395.1"
FT   misc_feature    319499..>319645
FT                   /note="Histidine kinase; Region: HisKA_3; pfam07730"
FT                   /db_xref="CDD:149021"
FT                   /locus_tag="Cfla_0277"
FT   misc_feature    319853..320116
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cl00075"
FT                   /db_xref="CDD:173995"
FT                   /locus_tag="Cfla_0277"
FT   gene            320182..320859
FT                   /db_xref="GeneID:9144144"
FT                   /locus_tag="Cfla_0278"
FT   CDS_pept        320182..320859
FT                   /locus_tag="Cfla_0278"
FT                   /gene_family="HOG000034813" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /codon_start="1"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /transl_table="11"
FT                   /note="KEGG: two component transcriptional regulator, LuxR
FT                   family; PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: response regulator receiver;
FT                   regulatory protein LuxR"
FT                   /db_xref="GI:296128146"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="GeneID:9144144"
FT                   /translation="MTQGTVRVVVADDQPLVRAGLSTVIDTEPGLEVVGQAGDGATAVA
FT                   LAHELRPDVVCMDIRMPGTDGITATRALCGPDVTDPIPVLVLTTFDVDEYLFGALEAGA
FT                   SGFLLKDAEPATLVEAVRSVAAGHGMLANALTRRVLREVVTRRRTQPVTAARASELLTP
FT                   RELDILLLLAQGMSNEEIARELYLEVSTVKSHLARAMPKLGVRSRLQAVVWAYQNGIVD
FT                   VPR"
FT                   /protein_id="YP_003635396.1"
FT   misc_feature    320200..320847
FT                   /note="Response regulator containing a CheY-like receiver
FT                   domain and an HTH DNA-binding domain [Signal transduction
FT                   mechanisms / Transcription]; Region: CitB; COG2197"
FT                   /db_xref="CDD:32379"
FT                   /locus_tag="Cfla_0278"
FT   misc_feature    320206..320556
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cfla_0278"
FT   misc_feature    order(320215..320220,320353..320355,320377..320379,
FT                   320443..320445,320500..320502,320509..320514)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cfla_0278"
FT   misc_feature    320353..320355
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cfla_0278"
FT   misc_feature    order(320362..320367,320371..320379)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cfla_0278"
FT   misc_feature    320509..320517
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Cfla_0278"
FT   misc_feature    320662..320826
FT                   /note="C-terminal DNA-binding domain of LuxR-like proteins.
FT                   This domain contains a helix-turn-helix motif and binds
FT                   DNA. Proteins belonging to this group are response
FT                   regulators; some act as transcriptional activators, others
FT                   as transcriptional repressors...; Region: LuxR_C_like;
FT                   cd06170"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="Cfla_0278"
FT   misc_feature    order(320665..320673,320710..320718,320740..320745,
FT                   320749..320754,320758..320772,320803..320805)
FT                   /note="DNA binding residues"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="Cfla_0278"
FT   misc_feature    order(320698..320700,320704..320706,320710..320712,
FT                   320803..320811,320818..320820)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:99777"
FT                   /locus_tag="Cfla_0278"
FT   gene            complement(320888..321403)
FT                   /db_xref="GeneID:9144145"
FT                   /locus_tag="Cfla_0279"
FT   CDS_pept        complement(320888..321403)
FT                   /locus_tag="Cfla_0279"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pfo:Pfl01_2900 LacI family transcription
FT                   regulator"
FT                   /db_xref="GI:296128147"
FT                   /db_xref="GeneID:9144145"
FT                   /translation="MFEYRKADRRDVSALFGEGIEVLDRYHVVDEAAGYALVRCGSDRP
FT                   DEDDRGRARDHYLLRRRDQVLGLVVDVLRRTDEHGTYALLVPGDIGRSHVARWHMGVPD
FT                   VDLDLEEEVRVRRIASEACLVLEASHGTYPRPRVVDPFDGVSELAPEDYGYLISPRLTF
FT                   RGVQGSSR"
FT                   /protein_id="YP_003635397.1"
FT   gene            321641..322732
FT                   /db_xref="GeneID:9144146"
FT                   /locus_tag="Cfla_0280"
FT   CDS_pept        321641..322732
FT                   /locus_tag="Cfla_0280"
FT                   /gene_family="HOG000173721" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /codon_start="1"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   art:Arth_2052 cupin 2 domain-containing protein"
FT                   /db_xref="GI:296128148"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="GeneID:9144146"
FT                   /translation="MHQMDGTADTPELTQLYADFEAESLAPLWTQRDDLMPMSPSPKAV
FT                   PYVWRWKALYDIARRSGDLVPVGRGGERRAMGLANPGLPGTAYATPTLWCAIQYLGGHE
FT                   TAPEHRHSQNAFRFVVEGEGVWTVVNGDPVAMRRGDLLLTPGWNYHGHHNDTDQPMAWI
FT                   DGLDVPFSHYADVGFFEFGSERVTDEASPDVSRSERLWAHPGLRPLSGLQDQTSSPLAA
FT                   YRWEHTDRALTEQLKLEDEGHPATVEQGHAAVRYTNPTTGGDVMPTIRCEFHRLRAGAE
FT                   TATRHEVGSAVWQVFEGEGTVVLGGTEHRVETGDLFAVPSWVPWSLHADTQFDLFRFTD
FT                   GPIIDRLHFTRTYLPGRRNEDLA"
FT                   /protein_id="YP_003635398.1"
FT   misc_feature    321671..322711
FT                   /note="Gentisate 1,2-dioxygenase [Secondary metabolites
FT                   biosynthesis, transport, and catabolism]; Region: COG3435"
FT                   /db_xref="CDD:33241"
FT                   /locus_tag="Cfla_0280"
FT   misc_feature    321926..322132
FT                   /note="Cupin domain; Region: Cupin_2; cl09118"
FT                   /db_xref="CDD:175009"
FT                   /locus_tag="Cfla_0280"
FT   gene            322729..323580
FT                   /db_xref="GeneID:9144147"
FT                   /locus_tag="Cfla_0281"
FT   CDS_pept        322729..323580
FT                   /locus_tag="Cfla_0281"
FT                   /gene_family="HOG000063754" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /codon_start="1"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /transl_table="11"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   svi:Svir_20690 2-keto-4-pentenoate
FT                   hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase"
FT                   /db_xref="GI:296128149"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="GeneID:9144147"
FT                   /translation="MRLGTLRLAVPGQAPEATVAVRVDDGHAVEIPGVADVGALLAADG
FT                   WRALAAGADGRRHALADVEPHAWAPPVLRPSKIVCVGLNYRHHILEMGRELPTHPTLFA
FT                   KFPEALIGPYDPIVLPARAADAVDWEGEVAVVVGATARRLDDTAAASAIAGYAVLNDVT
FT                   MRDYQYRTAQWLQGKTFEATTPFGPWLTVADGPLTGELTTDVDGEKVQRTAVDDMVFGP
FT                   AELVAYVSQILTLHPGDVIATGTPGGVGHARTPPRYLRPGNVLTTSVTGLGELRNDVVA
FT                   EA"
FT                   /protein_id="YP_003635399.1"
FT   misc_feature    322957..323568
FT                   /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
FT                   FAA_hydrolase; cl11421"
FT                   /db_xref="CDD:175247"
FT                   /locus_tag="Cfla_0281"
FT   gene            323580..324425
FT                   /db_xref="GeneID:9144148"
FT                   /locus_tag="Cfla_0282"
FT   CDS_pept        323580..324425
FT                   /locus_tag="Cfla_0282"
FT                   /gene_family="HOG000242756" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Arth_2050"
FT                   /codon_start="1"
FT                   /product="mycothiol-dependent maleylpyruvate isomerase"
FT                   /transl_table="11"
FT                   /note="KEGG: art:Arth_2050 mycothiol-dependent
FT                   maleylpyruvate isomerase"
FT                   /db_xref="GI:296128150"
FT                   /db_xref="InterPro:IPR017517"
FT                   /db_xref="GeneID:9144148"
FT                   /translation="MPARTDRTTDPALRAGLLLARRGQAYFSRQLNELANDELDAPSLV
FT                   PGWTRRHVVAHVGLNARALTRLTEWAATGVENPMYPSREARDEEIEYGATLPARALRNL
FT                   SAHAAVHLDVEWRDLAPEAWDAPVRTAQGRVVPASETVWMRTREVWVHAVDLDHGASYR
FT                   QFPAELVDALLDDVRRIWRARSVPGPVPVLEPTDRAGAAVGTAAEAAVGTAARAGAVRS
FT                   GDADGAGSSDGPAAVGGSVGAVRVRGRAADLARWATGRGGAHLLTTSDGTPVPPPPPWL
FT                   "
FT                   /protein_id="YP_003635400.1"
FT   misc_feature    323652..324047
FT                   /note="Mycothiol maleylpyruvate isomerase N-terminal
FT                   domain; Region: MDMPI_N; cl10108"
FT                   /db_xref="CDD:175084"
FT                   /locus_tag="Cfla_0282"
FT   gene            324679..325152
FT                   /db_xref="GeneID:9144149"
FT                   /locus_tag="Cfla_0283"
FT   CDS_pept        324679..325152
FT                   /locus_tag="Cfla_0283"
FT                   /gene_family="HOG000221447" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, MarR family"
FT                   /transl_table="11"
FT                   /note="KEGG: bph:Bphy_6384 MarR family transcriptional
FT                   regulator; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="GI:296128151"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9144149"
FT                   /translation="MLGCDDVVVTDPLPLDLARHTGFLVRRTQQAHLAVWAQEVGPRLT
FT                   NVQFGVLNVLHQRGEASQRELCDQLDLDRSTVAGLVARLEGRGLVARARATADRRRNVV
FT                   RLTAEGLDLLADVAGAAARVDHVLTSALTPQERLTLQALLTRVLDAAPSATSD"
FT                   /protein_id="YP_003635401.1"
FT   misc_feature    324808..>324945
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Cfla_0283"
FT   gene            325269..326051
FT                   /db_xref="GeneID:9144150"
FT                   /locus_tag="Cfla_0284"
FT   CDS_pept        325269..326051
FT                   /locus_tag="Cfla_0284"
FT                   /gene_family="HOG000057245" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /codon_start="1"
FT                   /product="phosphoesterase PA-phosphatase related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: art:Arth_3450 phosphoesterase, PA-phosphatase
FT                   related; PFAM: phosphoesterase PA-phosphatase related;
FT                   SMART: phosphoesterase PA-phosphatase related"
FT                   /db_xref="GI:296128152"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="GeneID:9144150"
FT                   /translation="MADGDSPRRLIQPRRLLDWYADQPVLRAVVPGVLLGVLGLLVFGV
FT                   MFDAVQEQDDFALWDEPVLEFLYDVRTDVVTTILAALTFVTGPAVLPFIVLVACVAWGV
FT                   ARREWWRPALLAGAMIGSTVLSLLVKGLVARPRPPEETMYIPGSETTGSFPSGHTIGTA
FT                   TFLLVAGYLVVSRRRSRGVVVAWLVAGLLGTAAVALSRLYLGYHFLTDVVAASGLAVVV
FT                   LGVVTVVDRLRVLRGMPVEEPEPGWSPDAPLAPTSREH"
FT                   /protein_id="YP_003635402.1"
FT   misc_feature    325416..325901
FT                   /note="PAP2_like_2 proteins. PAP2 is a super-family of
FT                   phosphatases and haloperoxidases. This subgroup, which is
FT                   specific to bacteria, lacks functional characterization and
FT                   may act as a membrane-associated lipid phosphatase; Region:
FT                   PAP2_like_2; cd03392"
FT                   /db_xref="CDD:48096"
FT                   /locus_tag="Cfla_0284"
FT   misc_feature    order(325656..325658,325677..325679,325734..325742,
FT                   325869..325871,325887..325889,325899..325901)
FT                   /note="active site"
FT                   /db_xref="CDD:48096"
FT                   /locus_tag="Cfla_0284"
FT   gene            complement(326190..326993)
FT                   /db_xref="GeneID:9144151"
FT                   /locus_tag="Cfla_0285"
FT   CDS_pept        complement(326190..326993)
FT                   /locus_tag="Cfla_0285"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: aau:AAur_pTC10247 putative ABC transporter,
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="GI:296128153"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9144151"
FT                   /translation="MAETPLLSVRELKKTYPGASGPVEAVGSITFDVRPGELVCIVGPS
FT                   GCGKTTLLKCLSGLLPPTAGSVVLDGSEVTAPPAKMAVVFQEYGRSLYPWLTVRDNVGL
FT                   PLKARGVPRGERARVVEEALQEVGLGHALDTYPWQLSGGMQQRVAIARAVAYQPEVLVM
FT                   DEPFAAVDAQTRADLEDLVRRVWKDLGVTVLFVTHDIDESVYLGERVLMLSSSPTVVQE
FT                   DLRIDLPDERDQLTTRALPRFTELRTHVYEQIQRAKRGTPLPTPH"
FT                   /protein_id="YP_003635403.1"
FT   misc_feature    complement(326217..326984)
FT                   /note="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, ATPase component [Inorganic ion transport and
FT                   metabolism]; Region: TauB; COG1116"
FT                   /db_xref="CDD:31313"
FT                   /locus_tag="Cfla_0285"
FT   misc_feature    complement(326310..326975)
FT                   /note="NrtD and SsuB are the ATP-binding subunits of the
FT                   bacterial ABC-type nitrate and sulfonate transport systems,
FT                   respectively.  ABC transporters are a large family of
FT                   proteins involved in the transport of a wide variety of
FT                   different compounds, like sugars; Region:
FT                   ABC_NrtD_SsuB_transporters; cd03293"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Cfla_0285"
FT   misc_feature    complement(326844..326867)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Cfla_0285"
FT   misc_feature    complement(order(326400..326402,326499..326504,
FT                   326736..326738,326841..326849,326853..326858))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Cfla_0285"
FT   misc_feature    complement(326736..326747)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Cfla_0285"
FT   misc_feature    complement(326547..326576)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Cfla_0285"
FT   misc_feature    complement(326499..326516)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Cfla_0285"
FT   misc_feature    complement(326481..326492)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Cfla_0285"
FT   misc_feature    complement(326394..326414)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73052"
FT                   /locus_tag="Cfla_0285"
FT   gene            complement(326986..327771)
FT                   /db_xref="GeneID:9144152"
FT                   /locus_tag="Cfla_0286"
FT   CDS_pept        complement(326986..327771)
FT                   /locus_tag="Cfla_0286"
FT                   /gene_family="HOG000134230" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: aau:AAur_pTC10248 putative
FT                   ABC transporter"
FT                   /db_xref="GI:296128154"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9144152"
FT                   /translation="MGVARRVLVPAAYAAGLPLLLVVGWALATQGTTNLYLPSPARVLQ
FT                   AFTRTWLDPDTLTGDVLPSLGRFAVGVLLSIVIGIVAGTAIGATPWLRALLEPMLEFFR
FT                   AIPPVVLVPVLMLLLGIDDSMKLAVIVSGSVWPVLLNTVEGVRGTDPVLVDTSRSYRVR
FT                   GLLAYRYVVLPAASPQIMAGIRLCLSIGLILMVISEMFASSSGLGYQIVYFQRQYMVAE
FT                   MWGGILLLGVVGVVVAAVFQLVERRVLHWYHGSREVARG"
FT                   /protein_id="YP_003635404.1"
FT   misc_feature    complement(327004..327663)
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cl00427"
FT                   /db_xref="CDD:174197"
FT                   /locus_tag="Cfla_0286"
FT   gene            complement(327771..328631)
FT                   /db_xref="GeneID:9144153"
FT                   /locus_tag="Cfla_0287"
FT   CDS_pept        complement(327771..328631)
FT                   /locus_tag="Cfla_0287"
FT                   /gene_family="HOG000134230" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: art:Arth_3082
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:296128155"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9144153"
FT                   /translation="MTGPGRGDVAPAARAGAGPRPAPARRARRRSGRSTLLGALGVLGF
FT                   AATWEVVALTEVVDPRFLPRVTTVAARLVTELGTPRFWEALGDTVVTWAIGLGLAVVAA
FT                   VVAGTVVGLVPFLRRATHTTVEFLRPIPSVAIIPLAVLLAGLSREAALVIVVYAPFWQV
FT                   FVQVLYGVGDVDTVADDTARSFGLGRWQRLRHVVLPTALPYVITGFRLAASIALVLTIT
FT                   AELVIGNPGIGRQIDVYRSNADAPGLYALVLVTGGLGLLVNLATRLVERRVLHWHPSVR
FT                   KEGVA"
FT                   /protein_id="YP_003635405.1"
FT   misc_feature    complement(327789..328487)
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cl00427"
FT                   /db_xref="CDD:174197"
FT                   /locus_tag="Cfla_0287"
FT   gene            complement(328649..329632)
FT                   /db_xref="GeneID:9144154"
FT                   /locus_tag="Cfla_0288"
FT   CDS_pept        complement(328649..329632)
FT                   /locus_tag="Cfla_0288"
FT                   /gene_family="HOG000249207" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09084"
FT                   /codon_start="1"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: NMT1/THI5 like domain protein; KEGG:
FT                   aau:AAur_pTC10256 putative extracellular solute-binding
FT                   protein"
FT                   /db_xref="GI:296128156"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="GeneID:9144154"
FT                   /translation="MNRRPAVVAALVAALSLGLAACSSTDTGTGDATAAPPDANSPRAV
FT                   TIGALSISETAPLWAAVEAGVFAEHGLDVTVQPIQGGAQAMPALLNGDIDFSVGQPFGA
FT                   MRASIQGLDVKIVANYAQSLAEGDDINSVVVGAGSDISSPADLAGKKVAVNSLGAAGDL
FT                   TIMAAVEADGGDPSTVEFVEVAFPDAQAQLDAGNVDAAWVPEPFVSIIVGAGGARVVDP
FT                   YQATLPGLPTLVLQTTGKTVTDDPELVDAVREAFTEAFAWAADNDDAVRQALVDEMSLP
FT                   EPAAKNLRLPTFSTELDRDVLQGLADLAVEHEFFDQAPDLDALVAE"
FT                   /protein_id="YP_003635406.1"
FT   misc_feature    complement(328667..329470)
FT                   /note="ABC transporter, substrate-binding protein,
FT                   aliphatic sulfonates family; Region: SsuA_fam; TIGR01728"
FT                   /db_xref="CDD:130789"
FT                   /locus_tag="Cfla_0288"
FT   misc_feature    complement(328835..329467)
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Cfla_0288"
FT   gene            329816..330658
FT                   /db_xref="GeneID:9144155"
FT                   /locus_tag="Cfla_0289"
FT   CDS_pept        329816..330658
FT                   /locus_tag="Cfla_0289"
FT                   /gene_family="HOG000221582" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08223"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, PaaX family"
FT                   /transl_table="11"
FT                   /note="PFAM: PaaX domain protein domain; PaaX domain
FT                   protein; KEGG: svi:Svir_19070 phenylacetic acid-responsive
FT                   transcriptional repressor"
FT                   /db_xref="GI:296128157"
FT                   /db_xref="InterPro:IPR012906"
FT                   /db_xref="InterPro:IPR013225"
FT                   /db_xref="GeneID:9144155"
FT                   /translation="MSTGSDDAPVPAPGEVRRRPEQLLLAFMGELMVGEGAAPLPAAIL
FT                   IGVLGELGAGEAATRAALTRMAGRRLLATVRTGRTVAYGLTPESERVLAEARGRVFDED
FT                   PFAPHGEGWTLVSFSVPESRRDVRHRVRAQLTWAGFGLLRDGLWIAPGEVDVAQALGGL
FT                   QPDGRDDLELLAFRAHEVPGFSAARSVRTAWRLDAMRERHEQFQARWEGRDPDVPHALC
FT                   DVTALVADWLDLLRAVPRLPPEHLAPDWPGGRSVAAFRRLHAVLAEPARAELARRLAD"
FT                   /protein_id="YP_003635407.1"
FT   misc_feature    330152..330604
FT                   /note="PaaX-like protein C-terminal domain; Region: PaaX_C;
FT                   pfam08223"
FT                   /db_xref="CDD:149339"
FT                   /locus_tag="Cfla_0289"
FT   gene            330837..332654
FT                   /db_xref="GeneID:9144156"
FT                   /locus_tag="Cfla_0290"
FT   CDS_pept        330837..332654
FT                   /locus_tag="Cfla_0290"
FT                   /gene_family="HOG000230015" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /codon_start="1"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /transl_table="11"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mab:MAB_4163c acyl-CoA synthetase"
FT                   /db_xref="GI:296128158"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="GeneID:9144156"
FT                   /translation="MADVPPPSGDLGRANYATIWDAVAHAVPDRVAVQADGESITYADF
FT                   QESAARLAATFVAHGLGPGSTVAIFMYNRPEYLTTLYAAYKIGAIPVNLNFRYQGAELA
FT                   ELLETSRPAALVHPRSLSAAVVDAGTRVPLPGLVLVVPDDAPPDVPASPGTPFAAALAA
FT                   DPLPPRELDPDHRIFMFTGGTTGRPKAVVWTHGNLFDSQLFSVYGSLPVDPPTSLDDVT
FT                   RLAARDDLPPTVCLPLPPMMHATALFNVMNAIVLGGTVVFLSAARFDPRAAVRAIAEHR
FT                   VTRLVVAGNAVVGPLVQVLDTDPDADVSSLTTVLSSGMVWSDDLKRRLAAHAPHATLVD
FT                   ILGSSEGGPFAYGVVRGPDDFPCRPRLAPGAVVLAPDLTPVEEVGGTGMLAYRGAMPLG
FT                   YHEDPVRTAQTYPVIDGVRHVMPGDWVRVLGDGYVELLGRGSGVVNTGGEKVFPGEVEK
FT                   VLLALPGVADAVVLGLPDPRWGEVVTAVVVPEPGEPLAPAQVQDEVGRRLAGYKKPRRL
FT                   YVIDELQRSPSGKVDMHRLRQRLAEGRPALVDTALVDPSTLEGAPAEPVPADPVPTGAA
FT                   PGDPVPGDPVPADPVPAPHPAPHPAESAR"
FT                   /protein_id="YP_003635408.1"
FT   misc_feature    330879..332468
FT                   /note="acyl-CoA synthetase; Validated; Region: PRK07798"
FT                   /db_xref="CDD:169104"
FT                   /locus_tag="Cfla_0290"
FT   misc_feature    330918..>331163
FT                   /note="Acyl-protein synthetase, LuxE; Region: LuxE;
FT                   cl10450"
FT                   /db_xref="CDD:175215"
FT                   /locus_tag="Cfla_0290"
FT   misc_feature    <331374..>331685
FT                   /note="Acyl-protein synthetase, LuxE; Region: LuxE;
FT                   cl10450"
FT                   /db_xref="CDD:175215"
FT                   /locus_tag="Cfla_0290"
FT   misc_feature    <332028..332471
FT                   /note="Acyl-protein synthetase, LuxE; Region: LuxE;
FT                   cl10450"
FT                   /db_xref="CDD:175215"
FT                   /locus_tag="Cfla_0290"
FT   gene            332651..333835
FT                   /db_xref="GeneID:9144157"
FT                   /locus_tag="Cfla_0291"
FT   CDS_pept        332651..333835
FT                   /locus_tag="Cfla_0291"
FT                   /gene_family="HOG000288271" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.3.1.9"
FT                   /codon_start="1"
FT                   /EC_number="2.3.1.9"
FT                   /transl_table="11"
FT                   /note="KEGG: rxy:Rxyl_1737 thiolase"
FT                   /db_xref="GI:296128159"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="GeneID:9144157"
FT                   /translation="MRFTDVHIPFGLSWTSPFAKWQGPLAEVNSLDLAVDVTGRALEAR
FT                   GLPPEEITEWTLGCTVPQQHAFYGVTGVSRRLGAGEHAGPWISRACATSAAVIEHLATQ
FT                   VQLKAHTTTIGVITDRTSNGPLMLWSSAAGPGGAPVSEHWVLDPMTLDPTTGQSMNDTA
FT                   ENTARDAGYTREQVDEVALLRYEQYAKAQAEGIPAAYTVPVRIPRRRGEDWLEQDHGVF
FT                   PTTAEGLARLRPVQEGGVVTYGAQTHPADGCAGVVVASGDRARELGRGGVTAQVLATGF
FT                   ARAEPAYMPKAPVPAALRALWDAGLRIEDVDVVTTHNPFAVNDLWFAEQTGFPLERMNP
FT                   YGSSLVYGHPQGPTGARAVTELVHALHARGGGTGLFTGCAAGDAAGAVVVRVDG"
FT                   /product="Acetyl-CoA C-acetyltransferase"
FT                   /protein_id="YP_003635409.1"
FT   misc_feature    332690..333781
FT                   /note="Thiolase are ubiquitous enzymes that catalyze the
FT                   reversible thiolytic cleavage of 3-ketoacyl-CoA into
FT                   acyl-CoA and acetyl-CoA, a 2-step reaction involving a
FT                   covalent intermediate formed with a catalytic cysteine.
FT                   They are found in prokaryotes and...; Region: thiolase;
FT                   cd00751"
FT                   /db_xref="CDD:29411"
FT                   /locus_tag="Cfla_0291"
FT   misc_feature    332696..333781
FT                   /note="acetyl-CoA acetyltransferases; Region:
FT                   AcCoA-C-Actrans; TIGR01930"
FT                   /db_xref="CDD:162610"
FT                   /locus_tag="Cfla_0291"
FT   misc_feature    order(332729..332731,332810..332812,332852..332854,
FT                   332861..332863,332873..332875,332906..332908,
FT                   332909..332914,332936..332938,332957..332962,
FT                   332969..332971,333014..333016,333485..333487,
FT                   333491..333493,333497..333499,333557..333559)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29411"
FT                   /locus_tag="Cfla_0291"
FT   misc_feature    order(332921..332923,333695..333697)
FT                   /note="active site"
FT                   /db_xref="CDD:29411"
FT                   /locus_tag="Cfla_0291"
FT   gene            333913..334401
FT                   /db_xref="GeneID:9144158"
FT                   /locus_tag="Cfla_0292"
FT   CDS_pept        333913..334401
FT                   /locus_tag="Cfla_0292"
FT                   /gene_family="HOG000242265" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:4.2.1.17"
FT                   /codon_start="1"
FT                   /EC_number="4.2.1.17"
FT                   /transl_table="11"
FT                   /note="KEGG: afo:Afer_0839 MaoC domain protein dehydratase;
FT                   PFAM: MaoC domain protein dehydratase"
FT                   /db_xref="GI:296128160"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="GeneID:9144158"
FT                   /translation="MTSDLAAGTAAPTLTTVPLGDLPSLEGTTFGPSPWRTVTQDEVDR
FT                   FADLTGDHNPIHLDPAYAAGTPFGGTIVHGYLTLALVVPLMAQVVEVTGVGTGVNYGLD
FT                   RLRFPAPVRVGSRIRVTSTLSAVTEVPGGYQAVYENTIEAEGQAKPAAVAVMVVRYYA"
FT                   /product="Enoyl-CoA hydratase"
FT                   /protein_id="YP_003635410.1"
FT   misc_feature    333973..334362
FT                   /note="NodN (nodulation factor N) contains a single hot dog
FT                   fold similar to those of the peroxisomal
FT                   Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the
FT                   fatty acid synthase beta subunit.  Rhizobium and related
FT                   species form nodules on the roots of their...; Region:
FT                   NodN; cd03450"
FT                   /db_xref="CDD:48045"
FT                   /locus_tag="Cfla_0292"
FT   misc_feature    order(334051..334053,334066..334068,334072..334074,
FT                   334081..334083,334126..334128,334135..334140)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:48045"
FT                   /locus_tag="Cfla_0292"
FT   misc_feature    order(334066..334068,334072..334074,334081..334083,
FT                   334135..334137)
FT                   /note="putative catalytic site; other site"
FT                   /db_xref="CDD:48045"
FT                   /locus_tag="Cfla_0292"
FT   gene            334398..335321
FT                   /db_xref="GeneID:9144159"
FT                   /locus_tag="Cfla_0293"
FT   CDS_pept        334398..335321
FT                   /locus_tag="Cfla_0293"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   cai:Caci_4900 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="GI:296128161"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="GeneID:9144159"
FT                   /translation="MSVDLTGRAAVVTGSGQGLGRAYALALAAAGAGVVVNDVDAAAAQ
FT                   ATVDAVVADGGRAVAVVAPVGPSETADLLVAAAVEAYGRLDVLVTNAGVLRDRVLWKTS
FT                   DEDFDLVVATHLRGTFTTARAAAVHMRERGEGGRIVLVGSPAGQHGNFGQTSYAAAKAG
FT                   IVAMARTWSLELARAGITVNAVIPTAITAMTATIPVYAEVAAAHGRGEPLPRVVRQEHA
FT                   LGGPEDVAPLVVWLASEESAHVTGQAIGIGGDKLSLYTVPQEVGVTYRQGGWSAEAIGE
FT                   EWARTFEALRQPSGIALPPLEAPADA"
FT                   /protein_id="YP_003635411.1"
FT   misc_feature    <334617..335156
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="Cfla_0293"
FT   gene            complement(335360..336316)
FT                   /db_xref="GeneID:9144160"
FT                   /locus_tag="Cfla_0294"
FT   CDS_pept        complement(335360..336316)
FT                   /locus_tag="Cfla_0294"
FT                   /gene_family="HOG000221582" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08223"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, PaaX family"
FT                   /transl_table="11"
FT                   /note="PFAM: PaaX domain protein domain; PaaX domain
FT                   protein; KEGG: fre:Franean1_1685 PaaX family
FT                   transcriptional regulator"
FT                   /db_xref="GI:296128162"
FT                   /db_xref="InterPro:IPR012906"
FT                   /db_xref="InterPro:IPR013225"
FT                   /db_xref="GeneID:9144160"
FT                   /translation="MARSEDARTPRTREGSPPSLLITLLGDYWWGQTDPLPSAALVDLL
FT                   ADFGVSDVAARAALSRMVKHGLLVSARSGRHTFYAMTPRAQGIMRAGAERIVRFGVDDG
FT                   TGWDGRWSLVAFSVPEANRAAREALRTRLRWLGFAPLYDALWISPHPRHDEALAELGAL
FT                   GVTRATAFVATCPPLPAAALAPESAWDLDGLAERYRTFVTTWEPTHAALSKGAISPVDA
FT                   LVKRTELMDAWRAFPGVDPDLPRRLLPADWPRDRARDLFLETYEQLGAPASVRVRQVIG
FT                   GYAPALADRVVQFSVLADPPGPRPAVGTAQAAVPAGG"
FT                   /protein_id="YP_003635412.1"
FT   misc_feature    complement(336062..336271)
FT                   /note="PaaX-like protein; Region: PaaX; pfam07848"
FT                   /db_xref="CDD:149102"
FT                   /locus_tag="Cfla_0294"
FT   misc_feature    complement(335501..336262)
FT                   /note="phenylacetic acid degradation operon negative
FT                   regulatory protein PaaX; Region: PaaX_trns_reg; TIGR02277"
FT                   /db_xref="CDD:162794"
FT                   /locus_tag="Cfla_0294"
FT   misc_feature    complement(335501..335998)
FT                   /note="PaaX-like protein C-terminal domain; Region: PaaX_C;
FT                   pfam08223"
FT                   /db_xref="CDD:149339"
FT                   /locus_tag="Cfla_0294"
FT   gene            336518..337375
FT                   /db_xref="GeneID:9144161"
FT                   /locus_tag="Cfla_0295"
FT   CDS_pept        336518..337375
FT                   /locus_tag="Cfla_0295"
FT                   /gene_family="HOG000063754" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:5.3.3.10"
FT                   /codon_start="1"
FT                   /EC_number="5.3.3.10"
FT                   /transl_table="11"
FT                   /note="KEGG: eba:ebA5616 maleylpyruvate isomerase; PFAM:
FT                   fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="GI:296128163"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="GeneID:9144161"
FT                   /translation="MKLASTLDRRLLAVRGDHAVDLTDALGLTPGPGGPLLAFLERGGT
FT                   LDGLLAIDLDALPAQPLDPARLAAPLARPGKVVGAPVNYRDHQVEMAEQRTIADYGVFL
FT                   KATSSVIGPNEHVRLPYTDVRTDHEGELGVVIGRTATRVPPERALDHVLGYAPVLDITV
FT                   RAGEDRSTRKSFDTFTPFGPWVTTADEVPDPGALELRCWVDDELRQHASTTDLLYDVAE
FT                   LIAYTSHVMTLHPGDVIATGTPAGVGPIAAGQRVAVEISGLGRLEVRVTDEGAIPYAER
FT                   PGPR"
FT                   /product="5-carboxymethyl-2-hydroxymuconateDelta-
FT                   isomerase"
FT                   /protein_id="YP_003635413.1"
FT   misc_feature    336743..337330
FT                   /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
FT                   FAA_hydrolase; cl11421"
FT                   /db_xref="CDD:175247"
FT                   /locus_tag="Cfla_0295"
FT   gene            337372..339495
FT                   /db_xref="GeneID:9144162"
FT                   /locus_tag="Cfla_0296"
FT   CDS_pept        337372..339495
FT                   /locus_tag="Cfla_0296"
FT                   /gene_family="HOG000220089" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02629"
FT                   /codon_start="1"
FT                   /product="CoA-binding domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: CoA-binding domain protein; KEGG:
FT                   cag:Cagg_3834 acetyl coenzyme A synthetase (ADP forming),
FT                   alpha domain protein"
FT                   /db_xref="GI:296128164"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="GeneID:9144162"
FT                   /translation="MTATAARAHGAASLDAMFRPASIAVVGASAAPDKAGHAMVRALRD
FT                   FPGTLHLVNPRGGEVLGRAVIPSLREASDVDLAVLVVPPDAVPGALEDARAAGTRAAVV
FT                   CAGGFAESGPAGARVQERVVAVAREAGIRLLGPNTSGFVNPVDRTTANFMPAVADLPPG
FT                   TVGLVAQSGGVNLALAFLLARAGVGLRLGVGLGNAVDVDFPEVLDHLALDDATTAVGLH
FT                   VEGVADGPALLAALRRTTARKPVVALKVGRSDVSEFARSHTGALTGSYAVTRAALQQSG
FT                   AVVVDSLEELVAALVALRSVRLPAAARIGVGLVTGQAGPGLVVTDALGARGVALPPLTD
FT                   ATQLRLAQLLPPLTFQRNPVDTGRPSPTFGPVVRTVLDDPGVDVVGVYALDEPGALDPA
FT                   AALAPLAGRVLLASGGPADALAERRHCLDAVGVPVLAGPGDLATALAAVAADAQVRAVH
FT                   DAPPVAPTRTVGRTLDEHEAKTLLEGHGLRTPRRHVATDRAQAHAALADLVHGGGRAVV
FT                   KVLAADVPHKSDVGGVHVGVRDDAGLDRALDAIDAIPRGADPDDRATDGAGPDVRAPRR
FT                   YLIEELAAPGPELIVGAVRDPVFGPVVLLGLGGVAAELGGEPVLRLAPLSAERAHEMVR
FT                   ALPPAVLHGFRGAPPVDVAALADVLRAVGDVVTTYGDVTELDLNPVRLTADGPVVLDAL
FT                   VVADPATLPGGDS"
FT                   /protein_id="YP_003635414.1"
FT   misc_feature    337411..>338454
FT                   /note="acetyl coenzyme A synthetase (ADP forming), alpha
FT                   domain; Region: AcCoA-syn-alpha; TIGR02717"
FT                   /db_xref="CDD:131764"
FT                   /locus_tag="Cfla_0296"
FT   misc_feature    337438..>337584
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="Cfla_0296"
FT   misc_feature    338788..>338934
FT                   /note="Carbamoyl-phosphate synthase L chain, ATP binding
FT                   domain; Region: CPSase_L_D2; cl03087"
FT                   /db_xref="CDD:164032"
FT                   /locus_tag="Cfla_0296"
FT   gene            339492..340712
FT                   /db_xref="GeneID:9144163"
FT                   /locus_tag="Cfla_0297"
FT   CDS_pept        339492..340712
FT                   /locus_tag="Cfla_0297"
FT                   /gene_family="HOG000244262" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /codon_start="1"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG:
FT                   gyc:GYMC61_2311 monooxygenase FAD-binding protein"
FT                   /db_xref="GI:296128165"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="GeneID:9144163"
FT                   /translation="MTGPTLQPDVLVVGAGPVGLTAALALRAYGLPVTVLEAGPEGRQR
FT                   PGSRAIFTHSQTLQILDRISPGLGAELYRHGVYWNTQRTFHGGREVYAKTYPDPPADVY
FT                   PHFTSLPQVQIEAYLYARALAAGVTFAWDQEVAQVDATDDGVVVTTAAGRRWEAPYVVG
FT                   ADGSRSVVRKQVGARMEGTRDEGWYVVVDVAEKDEPTLPRERHFHYAHPAVDGRNVLIV
FT                   PFAGGYRVDLQLVDGDDPEELASPAGVREWLDAVLPPGYAERTTWVSTYQFLQLVAHDF
FT                   ADPHRRVLLVGEAAHLFAPFGARGLNSGVPDAEAAAIAVAAASRASGAAARAPVEAFAL
FT                   ARRSAALFNRDAAGEALAHLRPDAATAERIAAAAERAPDDRSASEWLEKAPYGPRGVHR
FT                   AETVYRY"
FT                   /protein_id="YP_003635415.1"
FT   misc_feature    339513..>340001
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="Cfla_0297"
FT   misc_feature    <339963..>340427
FT                   /note="phenol 2-monooxygenase; Provisional; Region:
FT                   PRK08294"
FT                   /db_xref="CDD:169350"
FT                   /locus_tag="Cfla_0297"
FT   gene            complement(340797..342098)
FT                   /db_xref="GeneID:9144164"
FT                   /locus_tag="Cfla_0298"
FT   CDS_pept        complement(340797..342098)
FT                   /locus_tag="Cfla_0298"
FT                   /gene_family="HOG000166536" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /codon_start="1"
FT                   /product="monooxygenase FAD-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG: bra:BRADO0592
FT                   hypothetical protein"
FT                   /db_xref="GI:296128166"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="GeneID:9144164"
FT                   /translation="MTEPQVIIAGGGIGGLAVALTLHELGVDFVVLEGARELAPLGVGI
FT                   NLQPNAVRELGDLGIGEDVLDGIGVAAREWALVGRNGQDIYSEPRGRLAGYRWPQYALH
FT                   RGRLQMLLADTLRERAGDDAIRLDHRVTGYERHDDGTVTAVGQRADGTTWRQHGELLVG
FT                   ADGIHSAVRAQMHPDQPPIHWGGTIMWRGTTQAAPVRTGASFVGLGSARQRVVVYPISP
FT                   ADPATGLATVNWIAELRVDDTGSRQADRWFRQVDVEEFAHHFADWTYDWIDVPDLLRRA
FT                   EVVYENPMIDRDPVPTWQDGPVLLIGDAAHAMYPTGSNGASQAIMDARLLGAAMLRHGV
FT                   SADAFAALDADLCGPIGQLVLRNRGDGPFGLLDLVDERCGGEFDDIDDVVPELERNAFM
FT                   AGYKAAAGFAIEQLNTAPPTIPAGARVTAAVDAV"
FT                   /protein_id="YP_003635416.1"
FT   misc_feature    complement(340848..342038)
FT                   /note="hypothetical protein; Provisional; Region: PRK07538"
FT                   /db_xref="CDD:168999"
FT                   /locus_tag="Cfla_0298"
FT   misc_feature    complement(<341106..342002)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="Cfla_0298"
FT   gene            complement(342106..342570)
FT                   /db_xref="GeneID:9144165"
FT                   /locus_tag="Cfla_0299"
FT   CDS_pept        complement(342106..342570)
FT                   /locus_tag="Cfla_0299"
FT                   /gene_family="HOG000078987" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Saro_2237"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: nar:Saro_2237 hypothetical protein"
FT                   /db_xref="GI:296128167"
FT                   /db_xref="GeneID:9144165"
FT                   /translation="MLALQPPNVQPFCTLEVELAPIMDLGLGRFAQRRIVPIVGGRVTG
FT                   RVTGTILDLGADWQTVAHDGVAELDARYAFETPDGAIVEVRNTGFRYGPPEVMARLAAG
FT                   EPTPPESYVMRSTARLESGHPDYRWLNRMVFVGTGARDANAVQIDLYSVG"
FT                   /protein_id="YP_003635417.1"
FT   misc_feature    complement(342109..>342417)
FT                   /note="Protein of unknown function (DUF3237); Region:
FT                   DUF3237; cl07905"
FT                   /db_xref="CDD:158145"
FT                   /locus_tag="Cfla_0299"
FT   gene            complement(342650..343105)
FT                   /db_xref="GeneID:9144166"
FT                   /locus_tag="Cfla_0300"
FT   CDS_pept        complement(342650..343105)
FT                   /locus_tag="Cfla_0300"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08922"
FT                   /codon_start="1"
FT                   /product="Domain of unknown function DUF1905"
FT                   /transl_table="11"
FT                   /note="PFAM: Domain of unknown function DUF1905; KEGG:
FT                   bcv:Bcav_4116 domain of unknown function DUF1905"
FT                   /db_xref="GI:296128168"
FT                   /db_xref="InterPro:IPR015018"
FT                   /db_xref="GeneID:9144166"
FT                   /translation="MELRFSGEVIWWRGPAPYHFVVLPEPEAERLRAVASRVTYGWGCI
FT                   PATVTLGGTTFTTSIFPKDGGFRVPLKTAPRRAEGVEPGDDVTLVVVVTDPDAPDSTNR
FT                   TDVPRDHEVGATAPPRTRPRHDPADDDDYYDPADDPPTGTAALPPSG"
FT                   /protein_id="YP_003635418.1"
FT   misc_feature    complement(342854..343072)
FT                   /note="Domain of unknown function (DUF1905); Region:
FT                   DUF1905; pfam08922"
FT                   /db_xref="CDD:149858"
FT                   /locus_tag="Cfla_0300"
FT   gene            complement(343160..343702)
FT                   /db_xref="GeneID:9144167"
FT                   /locus_tag="Cfla_0301"
FT   CDS_pept        complement(343160..343702)
FT                   /locus_tag="Cfla_0301"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:JTY_3101"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mbt:JTY_3101 hypothetical protein"
FT                   /db_xref="GI:296128169"
FT                   /db_xref="GeneID:9144167"
FT                   /translation="MTPDPALTRDDIHRLLTEVGAYLHVRGWTATVYVAGGAAMSLLFD
FT                   GRTSTRDIDAVFRSDRGQLDAAVRDVATRHGLPIDWLNDRVARLTPTTADPGATELVVP
FT                   GLRVLVSSERHLLAMKMLAGRERDVPDLALLFERLGITTPAHAVAITEEVFGDTYPVDR
FT                   PPVEYLEALAADVLDAL"
FT                   /protein_id="YP_003635419.1"
FT   gene            complement(343699..344376)
FT                   /db_xref="GeneID:9144168"
FT                   /locus_tag="Cfla_0302"
FT   CDS_pept        complement(343699..344376)
FT                   /locus_tag="Cfla_0302"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:SMART:SM00418"
FT                   /codon_start="1"
FT                   /product="regulatory protein ArsR"
FT                   /transl_table="11"
FT                   /note="SMART: regulatory protein ArsR; KEGG: afo:Afer_0056
FT                   hypothetical protein"
FT                   /db_xref="GI:296128170"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="GeneID:9144168"
FT                   /translation="MAGAATLFRSDVQRDVLRDLVLSADGTRTAADLARSTGHPPSSVA
FT                   REVSRLVDAGLVRTTPRGRRHLLSVDYTDPFMAAVRDAFAAESVIAAERGRATRWWSTM
FT                   PEVAGRLRDALADGDTPWATRLLCDAVNQIPLVAALGGLDLMLAAPGTTGDERWDALLA
FT                   GAVRYRLRLLDLPAPAWTARDPLPAWWWPGGRGARAVLAMQSTPPELSRLGIWFDARNF
FT                   TTA"
FT                   /protein_id="YP_003635420.1"
FT   misc_feature    complement(344128..344358)
FT                   /note="Arsenical Resistance Operon Repressor and similar
FT                   prokaryotic, metal regulated homodimeric repressors. ARSR
FT                   subfamily of helix-turn-helix bacterial transcription
FT                   regulatory proteins (winged helix topology). Includes
FT                   several proteins that appear to...; Region: HTH_ARSR;
FT                   cd00090"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Cfla_0302"
FT   misc_feature    complement(order(344173..344181,344194..344202,
FT                   344218..344223,344227..344232,344239..344244,
FT                   344248..344259,344284..344292,344338..344346,
FT                   344356..344358))
FT                   /note="putative DNA binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Cfla_0302"
FT   misc_feature    complement(order(344128..344133,344137..344145,
FT                   344149..344154,344212..344214,344302..344304,
FT                   344320..344325,344332..344337,344344..344346,
FT                   344353..344355))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Cfla_0302"
FT   misc_feature    complement(order(344152..344154,344281..344283,
FT                   344290..344292))
FT                   /note="putative Zn2+ binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Cfla_0302"
FT   gene            complement(344445..345308)
FT                   /db_xref="GeneID:9144169"
FT                   /locus_tag="Cfla_0303"
FT   CDS_pept        complement(344445..345308)
FT                   /locus_tag="Cfla_0303"
FT                   /gene_family="HOG000250284" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /codon_start="1"
FT                   /product="aldo/keto reductase"
FT                   /transl_table="11"
FT                   /note="PFAM: aldo/keto reductase; KEGG: cai:Caci_2541
FT                   aldo/keto reductase"
FT                   /db_xref="GI:296128171"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="GeneID:9144169"
FT                   /translation="MQTRHIADVPVSAIGLGGMPMSIEGRPDRERSVATIHAALDAGVT
FT                   LIDTADAYHLHADEVGHNEELIAEALRTWSGDTSSVLVATKGGHLRPGDGSWTLDGRPE
FT                   YLKQAVQESARRLGVEAIGLYQFHRPDPAVPYEESVGAIADLLDAGTIRLAGISNANPE
FT                   QIRLAQDILGGRLASVQNQYSPAFRSSQPELDLCAELGIAFLPWSPLGGIAKAGELGAR
FT                   FGAFSEVADAHGVSPQQVALAWELAQADVVIPIPGASRPASIQDSVRAVELRLTSDELE
FT                   RLDAAG"
FT                   /protein_id="YP_003635421.1"
FT   misc_feature    complement(344451..345287)
FT                   /note="Aldo-keto reductases (AKRs) are a superfamily of
FT                   soluble NAD(P)(H) oxidoreductases whose chief purpose is to
FT                   reduce aldehydes and ketones to primary and secondary
FT                   alcohols. AKRs are present in all phyla and are of
FT                   importance to both health and...; Region: Aldo_ket_red;
FT                   cd06660"
FT                   /db_xref="CDD:119408"
FT                   /locus_tag="Cfla_0303"
FT   misc_feature    complement(order(344508..344513,344520..344522,
FT                   344535..344546,344595..344597,344673..344690,
FT                   344769..344771,344832..344837,344922..344927,
FT                   345051..345053,345150..345152,345165..345167,
FT                   345252..345260))
FT                   /note="active site"
FT                   /db_xref="CDD:119408"
FT                   /locus_tag="Cfla_0303"
FT   misc_feature    complement(order(344925..344927,345051..345053,
FT                   345150..345152,345165..345167))
FT                   /note="catalytic tetrad; other site"
FT                   /db_xref="CDD:119408"
FT                   /locus_tag="Cfla_0303"
FT   gene            345378..345830
FT                   /db_xref="GeneID:9144170"
FT                   /locus_tag="Cfla_0304"
FT   CDS_pept        345378..345830
FT                   /locus_tag="Cfla_0304"
FT                   /gene_family="HOG000053459" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:ROP_15950"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rop:ROP_15950 hypothetical protein"
FT                   /db_xref="GI:296128172"
FT                   /db_xref="GeneID:9144170"
FT                   /translation="MSNLSEVGDRDGWRCWLCDEPVDPDASVNSDLGPSVDAVVPARAS
FT                   KGKGKGAAVTERLAHRACNTRKGAVRPVVPWSPDLFVVDPAPIAETVERLRRKPGREVV
FT                   ARCPSRDDADQAAAWLVDRLSRFAPDLDVTTQVEPGGGQYLLAVRV"
FT                   /protein_id="YP_003635422.1"
FT   gene            complement(345911..346129)
FT                   /db_xref="GeneID:9144171"
FT                   /locus_tag="Cfla_0305"
FT   CDS_pept        complement(345911..346129)
FT                   /locus_tag="Cfla_0305"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: psp:PSPPH_1823 hypothetical protein"
FT                   /db_xref="GI:296128173"
FT                   /db_xref="GeneID:9144171"
FT                   /translation="MFVNVSYTHPVILVTYLALTIWALVSIWRHGRADTGQKVIWTIVV
FT                   VAAPYIGALVWAVLLAVGSRRRSTSGA"
FT                   /protein_id="YP_003635423.1"
FT   gene            complement(346411..347268)
FT                   /db_xref="GeneID:9144172"
FT                   /locus_tag="Cfla_0306"
FT   CDS_pept        complement(346411..347268)
FT                   /locus_tag="Cfla_0306"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: kra:Krad_4095 hypothetical protein"
FT                   /db_xref="GI:296128174"
FT                   /db_xref="GeneID:9144172"
FT                   /translation="MGWWSNLFGRTPERGPAPGAAARADAADVAATHVAATHMAATVRE
FT                   PGERPPTRVLGVTSSGVEVRGFDAPAGELVAWWHRLRAEHATTGLWPVLLGADAPTDMT
FT                   SALTPEDDYDDADALRRATAMTLRELQELRAERLARWREADSEDEDERPGDSAPHTVEH
FT                   REPVVTVAEEDGVIALVPAAHGWQVPVILGWQGGVNYELEPVDHGVVLRDWHERYGAEL
FT                   VAMSGDQVLELLVDRPPTTPAEALAVAREQYDYCGDVVDQGVGTIEALAREQAGSASWY
FT                   FWWD"
FT                   /protein_id="YP_003635424.1"
FT   gene            complement(347362..348498)
FT                   /db_xref="GeneID:9144173"
FT                   /locus_tag="Cfla_0307"
FT   CDS_pept        complement(347362..348498)
FT                   /locus_tag="Cfla_0307"
FT                   /gene_family="HOG000166536" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /codon_start="1"
FT                   /product="FAD dependent oxidoreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bcv:Bcav_0229 monooxygenase FAD-binding"
FT                   /db_xref="GI:296128175"
FT                   /db_xref="InterPro:IPR003042"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="GeneID:9144173"
FT                   /translation="MAPTAAPPSAAVVGAGIGGLAAAVALRRAGWEVTVHEQAPALRAL
FT                   GAGIVLSPNAVHALDALGLHDALRDHAALLATSAIRRPDGRTLATLDGARVATRHGAPL
FT                   LAVGRAELHTLLADALEPGVVRCGSQVADAAALTSTHDLVVAADGLRSPTRTAGWPAAS
FT                   APVYAGYTAWRALVRTDVPVTGASETWGHRERFGVVPVGDGRLYLFATATVPQGTHAPD
FT                   GATELAELRRRFGRWHAPVPALLDAVDPATVLRHDVHALPRVPATLHRGNLVLVGDAAH
FT                   AMEPNLGQGAGLALEDAVALADELARGGATTDALARWDAARRPRAARLLALSARLGRVT
FT                   QHVGPVAGALRDAAVRATPAAFALRGTDRTMGWRPQAR"
FT                   /protein_id="YP_003635425.1"
FT   misc_feature    complement(<347632..348408)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="Cfla_0307"
FT   gene            348559..349131
FT                   /db_xref="GeneID:9144174"
FT                   /locus_tag="Cfla_0308"
FT   CDS_pept        348559..349131
FT                   /locus_tag="Cfla_0308"
FT                   /gene_family="HOG000052584" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, TetR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG: TetR family
FT                   transcriptional regulator"
FT                   /db_xref="GI:296128176"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="GeneID:9144174"
FT                   /translation="MGSDRRRLVARHALAVLAEHGARGLTHRAVDQAAGLPPGSTSYYH
FT                   RTRAALLDACVDDLVRQDEAEIAAMAPLLQAADEEQLAGVLADVLHRWATTDRTRHLGR
FT                   YELFLESRRHPDLAESLHRGGLAVREAVAHVLAGLGAPEPHRRATWLVAAIEGALFERI
FT                   AGYLSSVPVDRDELLDLARWLVRSALA"
FT                   /protein_id="YP_003635426.1"
FT   misc_feature    348619..>348969
FT                   /note="Uncharacterized protein conserved in bacteria
FT                   [Function unknown]; Region: COG3226"
FT                   /db_xref="CDD:33039"
FT                   /locus_tag="Cfla_0308"
FT   gene            349227..349490
FT                   /db_xref="GeneID:9144175"
FT                   /locus_tag="Cfla_0309"
FT                   /pseudo
FT   gene            complement(349496..350914)
FT                   /db_xref="GeneID:9144176"
FT                   /locus_tag="Cfla_0310"
FT   CDS_pept        complement(349496..350914)
FT                   /locus_tag="Cfla_0310"
FT                   /gene_family="HOG000097794" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01637"
FT                   /codon_start="1"
FT                   /product="ATPase"
FT                   /transl_table="11"
FT                   /note="PFAM: ATPase; DUF234 DEXX-box ATPase; KEGG:
FT                   nfa:nfa47810 hypothetical protein"
FT                   /db_xref="GI:296128177"
FT                   /db_xref="InterPro:IPR004256"
FT                   /db_xref="InterPro:IPR011579"
FT                   /db_xref="GeneID:9144176"
FT                   /translation="MGFVGRERELEDLRAQLRAVETGARDARGTAVLVRGRRRVGKSRL
FT                   AEEFVDRTGVPHVTFQAARHAPVGQELAGIAEAIASSNLPGADLAAGNTPATLTAALTL
FT                   LAAALPDDRPSVVVLDEVPWLLEGVPGGAGELQRAWDRALSRKPVLLLLLGSDLAMMEH
FT                   LTQADQPFHGRAVEMILHALSPSDVARMTGLAGADAVDAYLITGGQPLVAQEWQHGETP
FT                   DAFLARSYASPLSALVASGTRVLDSEFPEGELSRRVLTAIGDGERTFSRIQAAAGGLQP
FT                   SSLHRVLTTLVTKRAVAIDSPLSAAPSRETRYRIADPALRFWLPFVEPALNEVDRGRPD
FT                   LARGRVARSFPAWRGRAVEPVVREAVHRLLVDTRWAGVHEVGGWWPRTNTPEIDLVGAD
FT                   ARPANRIAFVGTTKWRTNRPVSRSEIARLVADAQAVPGVTPDTPLVAVCPAGVEAGADV
FT                   AASWTAEDVLRAWP"
FT                   /protein_id="YP_003635427.1"
FT   misc_feature    complement(<350390..350908)
FT                   /note="Archaeal ATPase; Region: Arch_ATPase; pfam01637"
FT                   /db_xref="CDD:145008"
FT                   /locus_tag="Cfla_0310"
FT   misc_feature    complement(349670..349948)
FT                   /note="Archaea bacterial proteins of unknown function;
FT                   Region: DUF234; pfam03008"
FT                   /db_xref="CDD:145908"
FT                   /locus_tag="Cfla_0310"
FT   gene            complement(350995..351402)
FT                   /db_xref="GeneID:9144177"
FT                   /locus_tag="Cfla_0311"
FT   CDS_pept        complement(350995..351402)
FT                   /locus_tag="Cfla_0311"
FT                   /gene_family="HOG000267215" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /codon_start="1"
FT                   /product="Endoribonuclease L-PSP"
FT                   /transl_table="11"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: sen:SACE_3661
FT                   ribonuclease"
FT                   /db_xref="GI:296128178"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="GeneID:9144177"
FT                   /translation="MTAPAVTLVRSERLAAAPYAYAALTAPGGLVLTAGACPLDAEGRT
FT                   VAVGDVAGQARQVVANLVVALEAAGVGLTDVARTTIYVASSRREDLGAVWDVVSAAFGD
FT                   HDVPSTLLGVAVLGYEDQLVEVEAVAVRRPA"
FT                   /protein_id="YP_003635428.1"
FT   misc_feature    complement(351052..351321)
FT                   /note="YjgF, YER057c, and UK114 belong to a large family of
FT                   proteins present in bacteria, archaea, and eukaryotes with
FT                   no definitive function. The conserved domain is similar in
FT                   structure to chorismate mutase but there is no sequence
FT                   similarity and no...; Region: YjgF_YER057c_UK114_family;
FT                   cd00448"
FT                   /db_xref="CDD:100004"
FT                   /locus_tag="Cfla_0311"
FT   misc_feature    complement(order(351061..351075,351076..351081,
FT                   351109..351111,351118..351120,351157..351159,
FT                   351163..351165,351169..351174,351178..351180,
FT                   351298..351303,351307..351309,351313..351315))
FT                   /note="homotrimer interaction site; other site"
FT                   /db_xref="CDD:100004"
FT                   /locus_tag="Cfla_0311"
FT   gene            351520..352776
FT                   /db_xref="GeneID:9144178"
FT                   /locus_tag="Cfla_0312"
FT   CDS_pept        351520..352776
FT                   /locus_tag="Cfla_0312"
FT                   /gene_family="HOG000097445" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /codon_start="1"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cold-shock DNA-binding domain protein; PFAM:
FT                   Cold-shock protein DNA-binding; SMART: Cold shock protein"
FT                   /db_xref="GI:296128179"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016027"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="GeneID:9144178"
FT                   /translation="MPQATVRWFDAERGFGFLALGDDAEDLFVHASEIIGEPRVLREGQ
FT                   EVEYELGEGDRGPQARKVRVTGDVAADATLGQLGTVSWYEPAKGYGFLTPDGGGAEIFV
FT                   HSSAVVGGGVLHDGQRVAFLVVDGEKGPQADHLLPLGAQAAPAGQPAGDDGADGTVTWY
FT                   DAEKGFGFVAPDDGGEDVFAHAKSLVGGLSELVEGDRVTFDVVDGEKGPQARDIRLVGG
FT                   APRSAPAPRGGRPAGRPGGSAAPVRGGEGTVARYDADRGFGFIRPDAGGDDLFVHVSVV
FT                   RGDEPLEEGDRVRYEVRQSDRGPQADRVELVGAGGAPRGRGGYDAPRGGSRGGDRGGSY
FT                   GDRGGSRGGDGGGSYGGDRGGSRGGDSRGGGYRGGSQGGGYRGGSQGGGYRGGSQGGDS
FT                   RGGGPRGDRPSQDRRSDRW"
FT                   /protein_id="YP_003635429.1"
FT   misc_feature    351526..351714
FT                   /note="Cold-Shock Protein (CSP) contains an S1-like
FT                   cold-shock domain (CSD) that is found in eukaryotes,
FT                   prokaryotes, and archaea.  CSP's include the major
FT                   cold-shock proteins CspA and CspB in bacteria and the
FT                   eukaryotic gene regulatory factor Y-box protein...; Region:
FT                   CSP_CDS; cd04458"
FT                   /db_xref="CDD:88424"
FT                   /locus_tag="Cfla_0312"
FT   misc_feature    order(351541..351543,351568..351570,351601..351603,
FT                   351685..351687)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:88424"
FT                   /locus_tag="Cfla_0312"
FT   misc_feature    order(351559..351579,351598..351609)
FT                   /note="RNA-binding motif; other site"
FT                   /db_xref="CDD:88424"
FT                   /locus_tag="Cfla_0312"
FT   misc_feature    351754..351921
FT                   /note="Cold-Shock Protein (CSP) contains an S1-like
FT                   cold-shock domain (CSD) that is found in eukaryotes,
FT                   prokaryotes, and archaea.  CSP's include the major
FT                   cold-shock proteins CspA and CspB in bacteria and the
FT                   eukaryotic gene regulatory factor Y-box protein...; Region:
FT                   CSP_CDS; cd04458"
FT                   /db_xref="CDD:88424"
FT                   /locus_tag="Cfla_0312"
FT   misc_feature    order(351766..351768,351793..351795,351826..351828,
FT                   351907..351909)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:88424"
FT                   /locus_tag="Cfla_0312"
FT   misc_feature    order(351784..351804,351823..351834)
FT                   /note="RNA-binding motif; other site"
FT                   /db_xref="CDD:88424"
FT                   /locus_tag="Cfla_0312"
FT   misc_feature    351994..352176
FT                   /note="Cold-Shock Protein (CSP) contains an S1-like
FT                   cold-shock domain (CSD) that is found in eukaryotes,
FT                   prokaryotes, and archaea.  CSP's include the major
FT                   cold-shock proteins CspA and CspB in bacteria and the
FT                   eukaryotic gene regulatory factor Y-box protein...; Region:
FT                   CSP_CDS; cd04458"
FT                   /db_xref="CDD:88424"
FT                   /locus_tag="Cfla_0312"
FT   misc_feature    order(352003..352005,352030..352032,352063..352065,
FT                   352147..352149)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:88424"
FT                   /locus_tag="Cfla_0312"
FT   misc_feature    order(352021..352041,352060..352071)
FT                   /note="RNA-binding motif; other site"
FT                   /db_xref="CDD:88424"
FT                   /locus_tag="Cfla_0312"
FT   misc_feature    352270..352452
FT                   /note="Cold-Shock Protein (CSP) contains an S1-like
FT                   cold-shock domain (CSD) that is found in eukaryotes,
FT                   prokaryotes, and archaea.  CSP's include the major
FT                   cold-shock proteins CspA and CspB in bacteria and the
FT                   eukaryotic gene regulatory factor Y-box protein...; Region:
FT                   CSP_CDS; cd04458"
FT                   /db_xref="CDD:88424"
FT                   /locus_tag="Cfla_0312"
FT   misc_feature    order(352282..352284,352309..352311,352342..352344,
FT                   352423..352425)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:88424"
FT                   /locus_tag="Cfla_0312"
FT   misc_feature    order(352300..352320,352339..352350)
FT                   /note="RNA-binding motif; other site"
FT                   /db_xref="CDD:88424"
FT                   /locus_tag="Cfla_0312"
FT   gene            352818..353336
FT                   /db_xref="GeneID:9144179"
FT                   /locus_tag="Cfla_0313"
FT   CDS_pept        352818..353336
FT                   /locus_tag="Cfla_0313"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ami:Amir_2314 hypothetical protein"
FT                   /db_xref="GI:296128180"
FT                   /db_xref="GeneID:9144179"
FT                   /translation="MRAVAVYLVSTALLALVAVPCVIWLVVMADEIAQENSKAAGLPSG
FT                   QLGWDFALMVGAPPVLGVAVATGVAAAVARRAHAGDWRVLLGAVVVVAAVVVRVVVAAL
FT                   AGSTATPTAAGWATAAVVAGALTVALAARNRRRSGATETPVAAASDEVAADAASPRPST
FT                   SSTTPGPDS"
FT                   /protein_id="YP_003635430.1"
FT   gene            353500..354093
FT                   /db_xref="GeneID:9144180"
FT                   /locus_tag="Cfla_0314"
FT   CDS_pept        353500..354093
FT                   /locus_tag="Cfla_0314"
FT                   /gene_family="HOG000049435" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Amir_4253"
FT                   /codon_start="1"
FT                   /product="galactoside O-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="KEGG: ami:Amir_4253 galactoside O-acetyltransferase"
FT                   /db_xref="GI:296128181"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="GeneID:9144180"
FT                   /translation="MVRDYFAGDPRTNRERMLAGDLYIADDPDSERIAKEALRLTYEYL
FT                   RAEAAGEPDARAHLVALLGELGEGAYVKPPLFVDYGENIRIGARTFVNSNLTALDVAAI
FT                   TIGEDCQIGPNVQLLTPTHPVDPEPRRDKLEAAEPITLGDNVWLGGGVIVCPGVTIGDN
FT                   TVVGAGAVVTKDLPADVVAVGNPARVVRQIGEQA"
FT                   /protein_id="YP_003635431.1"
FT   misc_feature    353533..354078
FT                   /note="maltose O-acetyltransferase; Provisional; Region:
FT                   PRK10092"
FT                   /db_xref="CDD:137682"
FT                   /locus_tag="Cfla_0314"
FT   misc_feature    353563..354069
FT                   /note="Maltose O-acetyltransferase (MAT) and Galactoside
FT                   O-acetyltransferase (GAT): MAT and GAT catalyze the
FT                   CoA-dependent acetylation of the 6-hydroxyl group of their
FT                   respective sugar substrates. MAT acetylates maltose and
FT                   glucose exclusively at the C6...; Region: LbH_MAT_GAT;
FT                   cd03357"
FT                   /db_xref="CDD:100047"
FT                   /locus_tag="Cfla_0314"
FT   misc_feature    order(353572..353574,353599..353601,353734..353736,
FT                   353770..353772,353776..353778,353794..353796,
FT                   353800..353802,353830..353832,353836..353838,
FT                   353854..353856,353860..353862,353866..353868,
FT                   353872..353874,353893..353898,353902..353904,
FT                   353938..353940,353944..353949,353962..353964,
FT                   353998..354003,354010..354012,354016..354021,
FT                   354046..354057,354061..354063)
FT                   /note="active site"
FT                   /db_xref="CDD:100047"
FT                   /locus_tag="Cfla_0314"
FT   misc_feature    order(353572..353574,353599..353601,353734..353736,
FT                   353770..353772,353776..353778,353794..353796,
FT                   353800..353802,353830..353832,353860..353862,
FT                   353866..353868,353893..353898,353902..353904)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:100047"
FT                   /locus_tag="Cfla_0314"
FT   misc_feature    order(353602..353604,353611..353613,353623..353625,
FT                   353644..353646,353722..353724,353728..353733,
FT                   353779..353784,353824..353826,353830..353832,
FT                   353842..353844,353848..353850,353854..353856,
FT                   353866..353868,353872..353880,353884..353889,
FT                   353905..353907,353911..353913,353932..353934,
FT                   353938..353940,353947..353955,353962..353964,
FT                   353986..353988,353992..353994,354001..354006,
FT                   354016..354018,354052..354054)
FT                   /note="trimer interface; other site"
FT                   /db_xref="CDD:100047"
FT                   /locus_tag="Cfla_0314"
FT   misc_feature    order(353854..353856,353860..353862,353866..353868,
FT                   353872..353874,353938..353940,353944..353949,
FT                   353962..353964,353998..354003,354016..354021,
FT                   354046..354051,354055..354057)
FT                   /note="CoA binding site; other site"
FT                   /db_xref="CDD:100047"
FT                   /locus_tag="Cfla_0314"
FT   gene            complement(354165..354971)
FT                   /db_xref="GeneID:9144181"
FT                   /locus_tag="Cfla_0315"
FT   CDS_pept        complement(354165..354971)
FT                   /locus_tag="Cfla_0315"
FT                   /gene_family="HOG000261986" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01784"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF34"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF34; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="GI:296128182"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="GeneID:9144181"
FT                   /translation="MTITARQVVERLDARIGAPGRETTVDGFLAGDPDAPVRGVAVTMM
FT                   ATLDVLRTAAERGLDLVLTHEPLYFDHHGASDATFEAEGDPVYAAKKAFVAEHGLVVHH
FT                   QHDAVHDREPDGILTGTARALGWLDAERAGDPGIYDLPATTLGELAAHVARSLGARALR
FT                   YVGEPGTPVSTVGLQPGFWGFELNRHLLARPDVDAVVVGEAHEWETVEHAVDAVAAGLS
FT                   AGLVVVGHVPSEQEGMVELAGWLAEAVPEVPVEMVRTADPFRTVTS"
FT                   /protein_id="YP_003635432.1"
FT   misc_feature    complement(354351..354893)
FT                   /note="NIF3 (NGG1p interacting factor 3); Region: NIF3;
FT                   cl01309"
FT                   /db_xref="CDD:174611"
FT                   /locus_tag="Cfla_0315"
FT   gene            355104..356210
FT                   /db_xref="GeneID:9144182"
FT                   /locus_tag="Cfla_0316"
FT   CDS_pept        355104..356210
FT                   /locus_tag="Cfla_0316"
FT                   /gene_family="HOG000092011" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03067"
FT                   /codon_start="1"
FT                   /product="chitin-binding domain 3 protein"
FT                   /transl_table="11"
FT                   /note="KEGG: chitin-binding domain 3 protein; PFAM:
FT                   chitin-binding domain 3 protein; cellulose- binding family
FT                   II; SMART: cellulose-binding family II"
FT                   /db_xref="GI:296128183"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR004302"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR018366"
FT                   /db_xref="GeneID:9144182"
FT                   /translation="MSRISPLRRVAAACGALAIGAATVVGSIALAAPASAHGAVSDPPS
FT                   RIYGCWERWASNFTDPAMATSDPQCWDAWQSEPQAMWNWNGMFKEGAAGQHEQSIPDGK
FT                   LCSADNPLYAAADDPGPWRTTPVDHDFRLTLHDPSNHGADYLKIYVTKQGYDARSEALT
FT                   WADLELVKTTGRYATSSPYVTDVSVPRDRTGHHVVFTIWQASHLDQPYYQCSDVTFGGG
FT                   GTPTTSPTTPAPTPTTPAPTTPAPTPTTPAPTTPAPTTPAPTTPAPTTPAPTQPADGAC
FT                   TAAIEVVSAWQGGYQATVTVTAGSGGLDGWTVTVPGATITQAWNGTATGSTITAAGWNG
FT                   TVAAGGTAGVGFLGSGSPDGLTATCAAA"
FT                   /protein_id="YP_003635433.1"
FT   misc_feature    355212..355757
FT                   /note="Chitin binding domain; Region: Chitin_bind_3;
FT                   pfam03067"
FT                   /db_xref="CDD:145950"
FT                   /locus_tag="Cfla_0316"
FT   misc_feature    355944..>356078
FT                   /note="Cellulose binding domain; Region: CBM_2; cl02709"
FT                   /db_xref="CDD:155069"
FT                   /locus_tag="Cfla_0316"
FT   gene            356377..357243
FT                   /db_xref="GeneID:9144183"
FT                   /locus_tag="Cfla_0317"
FT   CDS_pept        356377..357243
FT                   /locus_tag="Cfla_0317"
FT                   /gene_family="HOG000253537" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /codon_start="1"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /transl_table="11"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: sgr:SGR_1000
FT                   putative hydrolase"
FT                   /db_xref="GI:296128184"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="GeneID:9144183"
FT                   /translation="MTETRTLEVPGASIVYDVRGPLPPADGQPPLVLIGQPMDASGFGT
FT                   LASYLADRTVVTYDPRGLGRSTRTDGSTAQDPRVQAEDLHALVGELGGGPVDLFGSSGG
FT                   AITALAWVTAHPQDVRTVVAHEPPLIEVLPDAAEARAASARVDAAYAERGWGWGMAAFI
FT                   AFTSWQGPFPADFLTELPDPATFGMPGDDDGSRDDPLLSDASDQVVAYEPDVEALRSSA
FT                   TRVVLAAGIESEGIVTWRTTHALAERLGTQVAVFPSNHGGFLGDEFGMPGQPEAFAARL
FT                   REVLAGS"
FT                   /protein_id="YP_003635434.1"
FT   misc_feature    356383..357240
FT                   /note="Predicted hydrolases or acyltransferases (alpha/beta
FT                   hydrolase superfamily) [General function prediction only];
FT                   Region: MhpC; COG0596"
FT                   /db_xref="CDD:30941"
FT                   /locus_tag="Cfla_0317"
FT   misc_feature    356533..>356778
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176620"
FT                   /locus_tag="Cfla_0317"
FT   gene            complement(357290..357973)
FT                   /db_xref="GeneID:9144184"
FT                   /locus_tag="Cfla_0318"
FT   CDS_pept        complement(357290..357973)
FT                   /locus_tag="Cfla_0318"
FT                   /gene_family="HOG000221683" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /codon_start="1"
FT                   /product="Phosphoglycerate mutase"
FT                   /transl_table="11"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: mab:MAB_3936c
FT                   phosphoglycerate mutase"
FT                   /db_xref="GI:296128185"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="GeneID:9144184"
FT                   /translation="MTDAFPAPPVPGVVPPRVRTLSVVTHPEATHHVDGLVGGQFDSGL
FT                   TPRGERQAAAIAAALRDRVAPGASVAVVTSDLRRTRRTAEVVADVLGVAPVLDPRLREK
FT                   SYGEAGGRPQAWLDARFVPPPAVGDRLGHHDGPAGSETRLDVAVRAYRATTDALGLDVD
FT                   ELVVVTHGFTAGLVVAAWIGMPVEAAGHVAFPVPSGSITTLREDGFFHNRAVVTVGDVR
FT                   HLASA"
FT                   /protein_id="YP_003635435.1"
FT   misc_feature    complement(357347..357907)
FT                   /note="Histidine phosphatase domain found in
FT                   phosphoglycerate mutases and related proteins, mostly
FT                   phosphatases; contains a His residue which is
FT                   phosphorylated during the reaction; Region: HP_PGM_like;
FT                   cd07067"
FT                   /db_xref="CDD:132718"
FT                   /locus_tag="Cfla_0318"
FT   misc_feature    complement(order(357461..357466,357737..357739,
FT                   357896..357901))
FT                   /note="catalytic core; other site"
FT                   /db_xref="CDD:132718"
FT                   /locus_tag="Cfla_0318"
FT   gene            complement(358003..358434)
FT                   /db_xref="GeneID:9144185"
FT                   /locus_tag="Cfla_0319"
FT   CDS_pept        complement(358003..358434)
FT                   /locus_tag="Cfla_0319"
FT                   /gene_family="HOG000247776" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /codon_start="1"
FT                   /product="Rhodanese domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cmi:CMM_0307 putative sulfurtransferase; PFAM:
FT                   Rhodanese domain protein; SMART: Rhodanese domain protein"
FT                   /db_xref="GI:296128186"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="GeneID:9144185"
FT                   /translation="MDAMQTSITARDFFAAKLTYETDPADLAADRAAGRAPVVVDVRSE
FT                   AGWRQGRIPGAVHVPGAELSARARDLLPDLDADVVVYCWGPGCNGSTWGAYALAELGYT
FT                   RVRELVGGFEYWAREGFAIVTDDGRTRRDPDPLTAPAGR"
FT                   /protein_id="YP_003635436.1"
FT   misc_feature    complement(358069..358398)
FT                   /note="Rhodanese Homology Domain (RHOD); an alpha beta fold
FT                   domain found duplicated in the rhodanese protein. The
FT                   cysteine containing enzymatically active version of the
FT                   domain is also found in the Cdc25 class of protein
FT                   phosphatases and a variety of proteins...; Region: RHOD;
FT                   cl00125"
FT                   /db_xref="CDD:174003"
FT                   /locus_tag="Cfla_0319"
FT   misc_feature    complement(358186..358188)
FT                   /note="active site residue"
FT                   /db_xref="CDD:29073"
FT                   /locus_tag="Cfla_0319"
FT   gene            358520..358978
FT                   /db_xref="GeneID:9144186"
FT                   /locus_tag="Cfla_0320"
FT   CDS_pept        358520..358978
FT                   /locus_tag="Cfla_0320"
FT                   /gene_family="HOG000115327" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /transl_table="11"
FT                   /note="KEGG: kra:Krad_0221 putative transcriptional
FT                   regulator, AsnC family; PFAM: Transcription regulator,
FT                   AsnC-type-like; SMART: Transcription regulator, AsnC-type"
FT                   /db_xref="GI:296128187"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="GeneID:9144186"
FT                   /translation="MPPIPRIDLDATDHRILEHLQRDGRVSIADLARAVSLSPSATADR
FT                   VRRLTDAGVITGYAATVDPEALGYPIMAFVRLAYPSGNYRPFHELVDTTPEVVEAHHVT
FT                   GVDCFVIKVIARSMPDLERITGKLATLGGITTSVVYSTTVPRRNLLPA"
FT                   /protein_id="YP_003635437.1"
FT   misc_feature    358532..358972
FT                   /note="Transcriptional regulators [Transcription]; Region:
FT                   Lrp; COG1522"
FT                   /db_xref="CDD:31711"
FT                   /locus_tag="Cfla_0320"
FT   misc_feature    358544..358864
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Cfla_0320"
FT   gene            359119..359793
FT                   /db_xref="GeneID:9144187"
FT                   /locus_tag="Cfla_0321"
FT   CDS_pept        359119..359793
FT                   /locus_tag="Cfla_0321"
FT                   /gene_family="HOG000076872" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Bcav_2086"
FT                   /codon_start="1"
FT                   /product="pterin-4-alpha-carbinolamine dehydratase"
FT                   /transl_table="11"
FT                   /note="KEGG: bcv:Bcav_2086 pterin-4-alpha-carbinolamine
FT                   dehydratase"
FT                   /db_xref="GI:296128188"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="GeneID:9144187"
FT                   /translation="MDALFGDELERAALVDWRPLAQGLHARYLVDDFGAAVRFVAALGE
FT                   AGDALGHHPRVTIGRGFVDLKVVSDDATFRDGDTVHVVQWVTQRDLDLARSITDVAAAQ
FT                   ALTADPASVSQVELGLDTARSATIAPVWAVLLTGDPAGQGLGSPSDEVRDPKGRLPNLW
FT                   FGDATGEPQRFHVEVYVPAEVRDERLAAVVAAGGTVVDDSRAPGLTVVADQDGNTGILC
FT                   VA"
FT                   /protein_id="YP_003635438.1"
FT   misc_feature    359188..359418
FT                   /note="PCD_DCoH: The bifunctional protein
FT                   pterin-4alpha-carbinolamine dehydratase (PCD), also known
FT                   as DCoH  (dimerization cofactor of hepatocyte nuclear
FT                   factor-1), is both a transcription activator and a
FT                   metabolic enzyme.  DCoH stimulates gene expression by...;
FT                   Region: PCD_DCoH; cl00942"
FT                   /db_xref="CDD:174472"
FT                   /locus_tag="Cfla_0321"
FT   misc_feature    order(359215..359217,359227..359229,359275..359277,
FT                   359284..359286,359359..359361)
FT                   /note="aromatic arch; other site"
FT                   /db_xref="CDD:48348"
FT                   /locus_tag="Cfla_0321"
FT   misc_feature    order(359215..359217,359227..359229,359239..359241,
FT                   359260..359262,359275..359298)
FT                   /note="DCoH dimer interaction site; other site"
FT                   /db_xref="CDD:48348"
FT                   /locus_tag="Cfla_0321"
FT   misc_feature    order(359218..359223,359239..359244,359251..359253,
FT                   359260..359265)
FT                   /note="DCoH /HNF-1 dimer interaction site; other site"
FT                   /db_xref="CDD:48348"
FT                   /locus_tag="Cfla_0321"
FT   misc_feature    order(359218..359220,359239..359244,359251..359253,
FT                   359263..359265)
FT                   /note="DCoH tetramer interaction site; other site"
FT                   /db_xref="CDD:48348"
FT                   /locus_tag="Cfla_0321"
FT   misc_feature    order(359269..359277,359353..359355,359359..359364)
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:48348"
FT                   /locus_tag="Cfla_0321"
FT   gene            359830..360690
FT                   /db_xref="GeneID:9144188"
FT                   /locus_tag="Cfla_0322"
FT   CDS_pept        359830..360690
FT                   /locus_tag="Cfla_0322"
FT                   /gene_family="HOG000115924" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00756"
FT                   /codon_start="1"
FT                   /product="putative esterase"
FT                   /transl_table="11"
FT                   /note="PFAM: putative esterase; KEGG: rba:RB6145
FT                   hypothetical protein"
FT                   /db_xref="GI:296128189"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="GeneID:9144188"
FT                   /translation="MPYRPLPLDDAPVVYAHGPDSSPRPGVPAGTTLELALDDSTAYPG
FT                   TSRRVWVHVPAHDGPPPPAAVMVFNDGWWYLDPDGEVRGGIVLDNLVHAGDVPFTIGVF
FT                   VDPGVRSGPSTGAPADAAPPRHRNVEYDAFDDRYVTFLLDEVMPLVTQRFAVTDDPERW
FT                   GVCGGSSGGNAAFTAAWLRPDRFRRAVCFLSSFAQMPGGNPYPDLLARTPRRPLRVFLQ
FT                   AGHRDLGWNAPVRNWLAENLRVAAALAEAGYDVRLVVGDGGHSPNHGGVLLPDALRWAL
FT                   REERA"
FT                   /protein_id="YP_003635439.1"
FT   misc_feature    359947..360684
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176620"
FT                   /locus_tag="Cfla_0322"
FT   misc_feature    359950..360666
FT                   /note="Putative esterase; Region: Esterase; pfam00756"
FT                   /db_xref="CDD:144380"
FT                   /locus_tag="Cfla_0322"
FT   gene            360687..361052
FT                   /db_xref="GeneID:9144189"
FT                   /locus_tag="Cfla_0323"
FT   CDS_pept        360687..361052
FT                   /locus_tag="Cfla_0323"
FT                   /gene_family="HOG000251567" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:AAur_1002"
FT                   /codon_start="1"
FT                   /product="putative RNase H"
FT                   /transl_table="11"
FT                   /note="KEGG: aau:AAur_1002 putative RNase H"
FT                   /db_xref="GI:296128190"
FT                   /db_xref="GeneID:9144189"
FT                   /translation="MSDGVSEGDLREVVVGEQRLLDPQVRARPAQVEALLHPDFVEFGA
FT                   NGQVYTRDFIVAALAADPGVSGEGTDYATTVLADDVVLLAYRVVGPPASLRSSVWVRDA
FT                   GAWRMRFHQGTRVPAGS"
FT                   /protein_id="YP_003635440.1"
FT   misc_feature    360735..361037
FT                   /note="Uncharacterized protein conserved in bacteria
FT                   [Function unknown]; Region: COG4994"
FT                   /db_xref="CDD:34599"
FT                   /locus_tag="Cfla_0323"
FT   gene            complement(361084..362067)
FT                   /db_xref="GeneID:9144190"
FT                   /locus_tag="Cfla_0324"
FT   CDS_pept        complement(361084..362067)
FT                   /locus_tag="Cfla_0324"
FT                   /gene_family="HOG000250533" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF10094"
FT                   /codon_start="1"
FT                   /product="protein of unknown function UCP012608"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function UCP012608; KEGG:
FT                   kse:Ksed_01400 uncharacterized conserved protein (DUF2332)"
FT                   /db_xref="GI:296128191"
FT                   /db_xref="InterPro:IPR011200"
FT                   /db_xref="GeneID:9144190"
FT                   /translation="MDPAIHRGESAVADAYRAFAEQEARGVSATYEAWALGISADPELV
FT                   DLVAALPPGKRQPNLVLAAARRHGAAGGYDALRSTLLTCWPQVRATVLSHATQTNEANR
FT                   CAVLLPFLAALPQPLALLEVGASAGLCLLPDRYSYRYDDGTALDPADGSSDVVLPCALG
FT                   PGTTAPGRLPEVVWRAGVDLDPIDVHDADRCAWLEALVWPEHDDRRARLRAALDVARRD
FT                   PPRVVAGDLLDVLPSLAAEAPRDATLVVLHSAVLAYLPATARAAFVDLVGTLPGHWLSY
FT                   EGARVLPATTPHASADATRSFVVSVDGVPRALADPHGRALDAIGGA"
FT                   /protein_id="YP_003635441.1"
FT   misc_feature    complement(361102..362034)
FT                   /note="Uncharacterized protein conserved in bacteria
FT                   (DUF2332); Region: DUF2332; cl01837"
FT                   /db_xref="CDD:154617"
FT                   /locus_tag="Cfla_0324"
FT   gene            complement(362128..363135)
FT                   /db_xref="GeneID:9144191"
FT                   /locus_tag="Cfla_0325"
FT   CDS_pept        complement(362128..363135)
FT                   /locus_tag="Cfla_0325"
FT                   /gene_family="HOG000256377" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08279"
FT                   /codon_start="1"
FT                   /product="Helix-turn-helix type 11 domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sgr:SGR_6958 DeoR family transcriptional
FT                   regulator; PFAM: Helix-turn-helix type 11 domain protein;
FT                   SMART: regulatory protein DeoR"
FT                   /db_xref="GI:296128192"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="GeneID:9144191"
FT                   /translation="MLVDVRADRLVATLLLLQRRGRVTAAEVARELEVSERTARRDLDA
FT                   LAVAGVPLYSSQGRGGGWRLVGGARTDLSGLTATEARALFLVAGPAAPATPAVRTALRK
FT                   LVHALPATFRDEAEVAAAAQVTDADGWDGPAPPDPPGALDDLRDAVVRRVQVHLGYVDA
FT                   QGCATARTVHPLGVVAKGRAWYLVAGTDAGRRTFRVDRVTSVEPTGDPTQHPPDFDLAA
FT                   VWREITDEVELRRSPAQATAWCTADGLVVLRRAFGSRLAVGAAADDGRTEVVVRGRDPQ
FT                   VLAGELAALVAWVEVTGPPEVRTHLATLGATLVERYGAGVVTPTTPDREEWSDR"
FT                   /protein_id="YP_003635442.1"
FT   misc_feature    complement(362965..363093)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Cfla_0325"
FT   misc_feature    complement(362179..>362673)
FT                   /note="Predicted transcriptional regulator [Transcription];
FT                   Region: COG2378"
FT                   /db_xref="CDD:32525"
FT                   /locus_tag="Cfla_0325"
FT   gene            363187..364122
FT                   /db_xref="GeneID:9144192"
FT                   /locus_tag="Cfla_0326"
FT   CDS_pept        363187..364122
FT                   /locus_tag="Cfla_0326"
FT                   /gene_family="HOG000028073" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /codon_start="1"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /transl_table="11"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: rer:RER_36260
FT                   epoxide hydrolase"
FT                   /db_xref="GI:296128193"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="GeneID:9144192"
FT                   /translation="MTQIPFPPSTLVPVGRVELEVHEAGRENGGPAVVLCHGFPELAYS
FT                   WRHQLPALVAAGYHVIVPTQRGCGRSSRPTDVEAYDVTRLTGDLVGLLDHLGIEDATFV
FT                   GHDWGAMLVWWLALLHPQRVRSVVALSVPYVERGDVPWVEAMATWFGDEHYFVHLDRRP
FT                   GVADAVLDADPARFLRNLYRTPPASPTPGMMLLDVARDEHPRGEPVMSDADLAVYVDAF
FT                   RRTGFTGALSWYRNLDRDWQLLADVDPVVRQPALMVYGAQDTVVRGQDLARYVPHVEEV
FT                   TLDCGHWVQQERPEEVTRLLLEWLGRQGVA"
FT                   /protein_id="YP_003635443.1"
FT   misc_feature    363241..364107
FT                   /note="Predicted hydrolases or acyltransferases (alpha/beta
FT                   hydrolase superfamily) [General function prediction only];
FT                   Region: MhpC; COG0596"
FT                   /db_xref="CDD:30941"
FT                   /locus_tag="Cfla_0326"
FT   misc_feature    363358..364095
FT                   /note="Esterases and lipases (includes fungal lipases,
FT                   cholinesterases, etc.)  These enzymes act on carboxylic
FT                   esters (EC: 3.1.1.-). The catalytic apparatus involves
FT                   three residues (catalytic triad): a serine, a glutamate or
FT                   aspartate and a histidine.These...; Region:
FT                   Esterase_lipase; cl12031"
FT                   /db_xref="CDD:176620"
FT                   /locus_tag="Cfla_0326"
FT   gene            364199..364633
FT                   /db_xref="GeneID:9144193"
FT                   /locus_tag="Cfla_0327"
FT   CDS_pept        364199..364633
FT                   /locus_tag="Cfla_0327"
FT                   /gene_family="HOG000061063" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01230"
FT                   /codon_start="1"
FT                   /product="histidine triad (HIT) protein"
FT                   /transl_table="11"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   sen:SACE_7317 histidine triad (HIT) protein"
FT                   /db_xref="GI:296128194"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR011151"
FT                   /db_xref="GeneID:9144193"
FT                   /translation="MTHETAGCIFCEIVAGRAEVSLVHEDETVVAWMDLNPVVRGHLLV
FT                   VPRRHAVGLEDLDVATGAHMWEVAHELSRTLRRSELRCDGINLLLCDGVVAFQTVFHVH
FT                   LHVIPRHEGDGWTLNHTAHERARALLDEDARIVRDALERR"
FT                   /protein_id="YP_003635444.1"
FT   misc_feature    364220..364528
FT                   /note="HIT family: HIT (Histidine triad) proteins, named
FT                   for a motif related to the sequence HxHxH/Qxx (x, a
FT                   hydrophobic amino acid), are a superfamily of nucleotide
FT                   hydrolases and transferases, which act on the
FT                   alpha-phosphate of ribonucleotides. On the...; Region:
FT                   HIT_like; cl00228"
FT                   /db_xref="CDD:174049"
FT                   /locus_tag="Cfla_0327"
FT   misc_feature    order(364292..364294,364298..364300,364322..364324,
FT                   364328..364330,364469..364471,364496..364498,
FT                   364508..364510,364514..364516)
FT                   /note="nucleotide binding site/active site; other site"
FT                   /db_xref="CDD:29586"
FT                   /locus_tag="Cfla_0327"
FT   misc_feature    order(364502..364504,364508..364510,364514..364522)
FT                   /note="HIT family signature motif; other site"
FT                   /db_xref="CDD:29586"
FT                   /locus_tag="Cfla_0327"
FT   misc_feature    364508..364510
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:29586"
FT                   /locus_tag="Cfla_0327"
FT   gene            364690..365058
FT                   /db_xref="GeneID:9144194"
FT                   /locus_tag="Cfla_0328"
FT   CDS_pept        364690..365058
FT                   /locus_tag="Cfla_0328"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:SMART:SM00507"
FT                   /codon_start="1"
FT                   /product="HNH nuclease"
FT                   /transl_table="11"
FT                   /note="SMART: HNH nuclease; KEGG: msm:MSMEG_4691 HNH
FT                   nuclease"
FT                   /db_xref="GI:296128195"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="GeneID:9144194"
FT                   /translation="MAGATRRVRVARRRRRRLALVDNDLTDLQWEALRAAWGGCAYCGA
FT                   TDRPLQRDCVLPISRGGRYTLGNVVPACGPCNASKCNAEVVSWLRRKKLDERTFLLRHV
FT                   EVRAVLTPTGTPHTDSAP"
FT                   /protein_id="YP_003635445.1"
FT   misc_feature    364774..364920
FT                   /note="HNH nucleases; HNH endonuclease signature which is
FT                   found in viral, prokaryotic, and eukaryotic proteins. The
FT                   alignment includes members of the large group of homing
FT                   endonucleases, yeast intron 1 protein, MutS, as well as
FT                   bacterial colicins, pyocins...; Region: HNHc; cl00083"
FT                   /db_xref="CDD:153501"
FT                   /locus_tag="Cfla_0328"
FT   gene            365179..366045
FT                   /db_xref="GeneID:9144195"
FT                   /locus_tag="Cfla_0329"
FT   CDS_pept        365179..366045
FT                   /locus_tag="Cfla_0329"
FT                   /gene_family="HOG000085330" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06445"
FT                   /codon_start="1"
FT                   /product="transcription activator effector binding protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sen:SACE_4993 AraC family transcriptional
FT                   regulator; PFAM: transcription activator effector binding;
FT                   SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="GI:296128196"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="GeneID:9144195"
FT                   /translation="MIASLNRLVDLVEQDLAADVDLARAAAGLGTTEYHLRRMFSSLAG
FT                   MPFSEYVRRRRMTVAAADVVAGAELLDVAVRHGYGSAEAFGRAFRAVHGVAPAQVRRDG
FT                   GPLRSQARLVFRLTVEGARPMDVRIASRPAVRLVGHAARVPLVHEGVNPAIQQHVASLD
FT                   PAEHQRLKDLADTEPGGMLAVSTDLEPDRREGTELTYLHGVAVTDAVDVPADLDVIDVP
FT                   AGDWAVFRATGPYPAALQALWADTATTWFPSNPWRLRQGPEVVAVLDRAADLSTATVEL
FT                   WLPVEAG"
FT                   /protein_id="YP_003635446.1"
FT   misc_feature    365266..365481
FT                   /note="helix_turn_helix, arabinose operon control protein;
FT                   Region: HTH_ARAC; smart00342"
FT                   /db_xref="CDD:128636"
FT                   /locus_tag="Cfla_0329"
FT   misc_feature    365554..366036
FT                   /note="Bacterial transcription activator, effector binding
FT                   domain; Region: AraC_E_bind; cl01368"
FT                   /db_xref="CDD:174621"
FT                   /locus_tag="Cfla_0329"
FT   gene            366065..366490
FT                   /db_xref="GeneID:9144196"
FT                   /locus_tag="Cfla_0330"
FT   CDS_pept        366065..366490
FT                   /locus_tag="Cfla_0330"
FT                   /gene_family="HOG000162557" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /codon_start="1"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related FMN-
FT                   binding; KEGG: krh:KRH_13990 hypothetical protein"
FT                   /db_xref="GI:296128197"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="GeneID:9144196"
FT                   /translation="MVPDPADPAALAAFVRAHPTAVLATRGDDGHPQAALLGVAALDDG
FT                   TLVVDSAEHARKVANVRRDPRVAVALGLDGDVTVQVEGDARVAEGDERVRLAAAYEAQL
FT                   PGSRALAEGYVVVAVTPRWVRVYDASAPTPVVREARW"
FT                   /protein_id="YP_003635447.1"
FT   misc_feature    366104..366340
FT                   /note="Pyridoxine 5'-phosphate (PNP) oxidase-like proteins;
FT                   Region: PNPOx_like; cl00381"
FT                   /db_xref="CDD:174160"
FT                   /locus_tag="Cfla_0330"
FT   gene            complement(366587..367108)
FT                   /db_xref="GeneID:9144197"
FT                   /locus_tag="Cfla_0331"
FT   CDS_pept        complement(366587..367108)
FT                   /locus_tag="Cfla_0331"
FT                   /gene_family="HOG000240344" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sen:SACE_0740 acetyltransferase"
FT                   /db_xref="GI:296128198"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="GeneID:9144197"
FT                   /translation="MRAESLVLRPLTTADEHEAWQAHAELAREGFDFLLDARPGDWPGY
FT                   LRRLADDRAGVDLPPRYVPATFLVADVGGVIVGRVHVRHALTEALARVGGHIGYQVRPA
FT                   HRRRGYATAMLAAALDVARAAGVEDALVTCDDDNVASARTIERCGGVLQDVVPAAGRSA
FT                   TRRYRVPTSR"
FT                   /protein_id="YP_003635448.1"
FT   misc_feature    complement(366608..367099)
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:176420"
FT                   /locus_tag="Cfla_0331"
FT   gene            complement(367105..367728)
FT                   /db_xref="GeneID:9144198"
FT                   /locus_tag="Cfla_0332"
FT   CDS_pept        complement(367105..367728)
FT                   /locus_tag="Cfla_0332"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: RNA polymerase, sigma-24 subunit, ECF
FT                   subfamily"
FT                   /db_xref="GI:296128199"
FT                   /db_xref="GeneID:9144198"
FT                   /translation="MTRQDAPGAALTRRTPALVALGRAALVMAPVLWGFGVVLGPDPAG
FT                   PDPGKAYVVTALCLGFVSPWLLLPVGTTSHTTLRGSTLSVVTVLGTRHVDLDDLHRIGA
FT                   LTVHWKTGRDRYAYLRGPGLRVAWVLLEDSSSLAGRVRGHLVRTSMARPGVVTARGRAL
FT                   LGVDPVPGRLRRLAQESCAFAVGFPLVVCWAGAVAYVLTRGVAL"
FT                   /protein_id="YP_003635449.1"
FT   gene            367772..368101
FT                   /db_xref="GeneID:9144199"
FT                   /locus_tag="Cfla_0333"
FT   CDS_pept        367772..368101
FT                   /locus_tag="Cfla_0333"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dal:Dalk_4666 CheA signal transduction
FT                   histidine kinase"
FT                   /db_xref="GI:296128200"
FT                   /db_xref="GeneID:9144199"
FT                   /translation="MPNLVVEIHVPMTPSPDVAGDEDPFFWIDDVEDRLAELEEDEELE
FT                   VFDDGEEVDEEYVFFVTGAPRDRLLRAASDIALGVGMPTGVYAVLSTDDADEIGVGERV
FT                   DLPVR"
FT                   /protein_id="YP_003635450.1"
FT   gene            complement(368133..368954)
FT                   /db_xref="GeneID:9144200"
FT                   /locus_tag="Cfla_0334"
FT   CDS_pept        complement(368133..368954)
FT                   /locus_tag="Cfla_0334"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /codon_start="1"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /transl_table="11"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; KEGG: alkyl hydroperoxide
FT                   reductase/thiol specific antioxidant/Mal   allergen"
FT                   /db_xref="GI:296128201"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="GeneID:9144200"
FT                   /translation="MAPTRTRPADNDYRFDVLRTRHVLDDLRYRPTDPGPGDLVPPFDL
FT                   PTLDGGRFRHDDLGPRPVLLVVGSQTCPVTRSAAPRLDALHATYGDRVRFVLVQTREAH
FT                   PGEHLPQPRTDEEKTAHAVAMRDDLRVTYEVAVDDVDGTLHRALGPKPNSAYVLRPDGT
FT                   IVARVHWANDTAGVRAALDDALDGRPPRHRRGRMLLPLMTAVGHLPDVVHRAGPRAERD
FT                   VWRAAAPLALLARATRLLGALATDRRGPVVAAGLAVVVAATVVAVVIGAAG"
FT                   /protein_id="YP_003635451.1"
FT   misc_feature    complement(368451..368831)
FT                   /note="TlpA-like family; composed of  TlpA, ResA, DsbE and
FT                   similar proteins. TlpA, ResA and DsbE are bacterial protein
FT                   disulfide reductases with important roles in cytochrome
FT                   maturation. They are membrane-anchored proteins with a
FT                   soluble TRX domain containing...; Region: TlpA_like_family;
FT                   cd02966"
FT                   /db_xref="CDD:48515"
FT                   /locus_tag="Cfla_0334"
FT   misc_feature    complement(order(368730..368732,368739..368741))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:48515"
FT                   /locus_tag="Cfla_0334"
FT   gene            complement(369030..369623)
FT                   /db_xref="GeneID:9144201"
FT                   /locus_tag="Cfla_0335"
FT   CDS_pept        complement(369030..369623)
FT                   /locus_tag="Cfla_0335"
FT                   /gene_family="HOG000161263" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, TetR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG: tbd:Tbd_1255
FT                   TetR family transcriptional regulator"
FT                   /db_xref="GI:296128202"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="GeneID:9144201"
FT                   /translation="MARDTRERIVTTARDLVHAATYADVGVDDVCRAAGVNKGSLYHFF
FT                   PSKQALGLAVLDRNWELMRGLLDEAFDAEAPPLDRLDAFLTAYASMMRTMREHLGATPG
FT                   CPLGNLAAELSAHEPDMRARIAEVLTAWTDRVASVVRDAQARGDVDPSFDATEAARGVV
FT                   ALVQGYGVLAKADDDPTALDALRPLVRRLLPAPH"
FT                   /protein_id="YP_003635452.1"
FT   misc_feature    complement(369087..369620)
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   AcrR; COG1309"
FT                   /db_xref="CDD:31500"
FT                   /locus_tag="Cfla_0335"
FT   misc_feature    complement(369459..369599)
FT                   /note="Bacterial regulatory proteins, tetR family; Region:
FT                   TetR_N; pfam00440"
FT                   /db_xref="CDD:144144"
FT                   /locus_tag="Cfla_0335"
FT   gene            369680..370459
FT                   /db_xref="GeneID:9144202"
FT                   /locus_tag="Cfla_0336"
FT   CDS_pept        369680..370459
FT                   /locus_tag="Cfla_0336"
FT                   /gene_family="HOG000012413" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /codon_start="1"
FT                   /product="Methyltransferase type 11"
FT                   /transl_table="11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG:
FT                   bfa:Bfae_11980 methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /db_xref="GI:296128203"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="GeneID:9144202"
FT                   /translation="MVTRERPAGDVDYERQGRGYAALRRTEPRIAARVHAALGDARTVL
FT                   DVGAGSGSYEPADRWVLAVEPSAAMRAQRPAGAAPALDATAEHLPFDDDAFDAAMAMVT
FT                   IHQWPDVDRGLRELRRVSRGPVVVLTHDAPALRRFWLAEYFPDVVALDETRFPTIDHVV
FT                   DVLAAAGGTVRVDVVPIPRDCVDGFGEAFWARPEAYLRAEVRGATSGFVLADQAAVQRG
FT                   VERLAADLESGAWDRAHGHLREQDEYAGAMRLVVATP"
FT                   /protein_id="YP_003635453.1"
FT   misc_feature    <369938..>370189
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:176836"
FT                   /locus_tag="Cfla_0336"
FT   gene            370595..370846
FT                   /db_xref="GeneID:9144203"
FT                   /locus_tag="Cfla_0337"
FT   CDS_pept        370595..370846
FT                   /locus_tag="Cfla_0337"
FT                   /gene_family="HOG000225392" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, XRE family"
FT                   /transl_table="11"
FT                   /note="KEGG: kra:Krad_2888 putative transcriptional
FT                   regulator, XRE family; PFAM: helix-turn-helix domain
FT                   protein; SMART: helix-turn-helix domain protein"
FT                   /db_xref="GI:296128204"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="GeneID:9144203"
FT                   /translation="MSEHDDPAPHRVVSRLGALLEARGLTLVQLAELTGVTVANLSVLK
FT                   NGRARAIRFSTLTAVCDALGCRPGDLLDVEPAPTTRRP"
FT                   /protein_id="YP_003635454.1"
FT   misc_feature    370634..370807
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cd00093"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Cfla_0337"
FT   misc_feature    order(370643..370645,370655..370657,370730..370732)
FT                   /note="non-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Cfla_0337"
FT   misc_feature    order(370652..370654,370727..370729)
FT                   /note="salt bridge; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Cfla_0337"
FT   misc_feature    order(370673..370678,370709..370711,370718..370720,
FT                   370730..370735)
FT                   /note="sequence-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="Cfla_0337"
FT   gene            complement(370882..372246)
FT                   /db_xref="GeneID:9144204"
FT                   /locus_tag="Cfla_0338"
FT   CDS_pept        complement(370882..372246)
FT                   /locus_tag="Cfla_0338"
FT                   /gene_family="HOG000101852" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00553"
FT                   /codon_start="1"
FT                   /product="cellulose-binding family II"
FT                   /transl_table="11"
FT                   /note="KEGG: cai:Caci_4285 cellulose-binding family II;
FT                   PFAM: cellulose-binding family II; SMART: cellulose-binding
FT                   family II"
FT                   /db_xref="GI:296128205"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="GeneID:9144204"
FT                   /translation="MSALGKVRPVSRALAVLAAGAALVAAQSLAGPSADAVPPGAESEP
FT                   VTGSATWFDNLGAPYGGCGLPQDQLETQNWIALNVYDTPGDYAMYPRPMAADDPKVGMF
FT                   DNGRNCGRWVRVTIDDYCTGVNDGAPGQAFCRNGGWVEDEYNGATLDMLVADSCGDPNA
FT                   WCRDDPYHLDLAHASLNLFEKDGAPVGDMDPNHWGNRKVTWEFIEAPDYSGDIEIGFIQ
FT                   GSEKWWAGVSINHLPNGIHGVEHFADGAWVTTPMNVDMGQSFLVKPTTTGGTDYRIRVT
FT                   DVDDEYVFGGREYAFSLPESCGGKCSAPRTVVEYTTTEGDGSTPTPTPTPTPDVTPTPE
FT                   VTVTPTPDVTPTPTPTTGHGVTACTATFRATSTWPGGYQGEVVVTAGEAALTTWTVTLP
FT                   GVSVGSLWNGVPTAAGSGVTVTNAPYNGSLTPGGTVSFGFIGAGTPGDAAPSCSA"
FT                   /protein_id="YP_003635455.1"
FT   misc_feature    complement(371398..>371724)
FT                   /note="Endoglucanase C-terminal domain/subunit and related
FT                   proteins [Carbohydrate transport and metabolism]; Region:
FT                   COG4305"
FT                   /db_xref="CDD:34027"
FT                   /locus_tag="Cfla_0338"
FT   misc_feature    complement(370894..371157)
FT                   /note="Cellulose binding domain; Region: CBM_2; cl02709"
FT                   /db_xref="CDD:155069"
FT                   /locus_tag="Cfla_0338"
FT   gene            complement(372379..372945)
FT                   /db_xref="GeneID:9144205"
FT                   /locus_tag="Cfla_0339"
FT   CDS_pept        complement(372379..372945)
FT                   /locus_tag="Cfla_0339"
FT                   /gene_family="HOG000078798" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01872"
FT                   /codon_start="1"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: sen:SACE_6341 deaminase-reductase domain-
FT                   containing protein"
FT                   /db_xref="GI:296128206"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="GeneID:9144205"
FT                   /translation="MGKLVYAANTSLDGYLEDASGAFDFSVPTAEVHQFWNDHERGIGT
FT                   SLYGRRMYETMRVWEDDDWLVDQPEVVREYAGIWRDADKVVYSTTLDAAPTSRTRLERT
FT                   FDPDAVRRLKEGSERDLSVGGAILGAEAFRHGLVDEVVLMLCPVAVGGGKPALPLGVRL
FT                   GLELREQRGFGDGTVLVRYAVRGGA"
FT                   /protein_id="YP_003635456.1"
FT   misc_feature    complement(372409..372939)
FT                   /note="Dihydrofolate reductase (DHFR). Reduces
FT                   7,8-dihydrofolate to 5,6,7,8-tetrahydrofolate with NADPH as
FT                   a cofactor. This is an essential step in the biosynthesis
FT                   of deoxythymidine phosphate since 5,6,7,8-tetrahydrofolate
FT                   is required to regenerate 5,10-...; Region: DHFR; cl00161"
FT                   /db_xref="CDD:174011"
FT                   /locus_tag="Cfla_0339"
FT   gene            373062..373637
FT                   /db_xref="GeneID:9144206"
FT                   /locus_tag="Cfla_0340"
FT   CDS_pept        373062..373637
FT                   /locus_tag="Cfla_0340"
FT                   /gene_family="HOG000078519" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   sco:SCO1624 acetyltransferase"
FT                   /db_xref="GI:296128207"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="GeneID:9144206"
FT                   /translation="MPLIPEPVVPAGVWGARVQPTLAAGSLVLRPWCAGDAPAVRAAYD
FT                   DDAIRTWHARTMRDDDEARAWIDGKNAAWRQERAAEWAVVEEGEVVGRVALTRLNLYEG
FT                   GGALAYWVVPAVRGRRVAVRAGTEALRWAFEDLGLQRVEVEHSTRNPASCRVAELLGCR
FT                   AEGVRRGHALHADGHHDMHLHARLRTDA"
FT                   /protein_id="YP_003635457.1"
FT   misc_feature    <373443..373631
FT                   /note="Acetyltransferases, including N-acetylases of
FT                   ribosomal proteins [Translation, ribosomal structure and
FT                   biogenesis]; Region: RimL; COG1670"
FT                   /db_xref="CDD:31856"
FT                   /locus_tag="Cfla_0340"
FT   gene            373722..374729
FT                   /db_xref="GeneID:9144207"
FT                   /locus_tag="Cfla_0341"
FT   CDS_pept        373722..374729
FT                   /locus_tag="Cfla_0341"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: hau:Haur_1275 hypothetical protein"
FT                   /db_xref="GI:296128208"
FT                   /db_xref="GeneID:9144207"
FT                   /translation="MTGNIQGGDIQALRDLRLSMLAFVGDLAGCTATTTSTLDRLQWTG
FT                   QDRNRFREDWEQLYRPAMRRVQDAVAFAADELEAHADEQEVVSSAPGVGPATSVAAATT
FT                   GPVTVASTPAPAGAAVPAATPAAEPAHEHTLGSLSARYESNGDPGAVSTGRGDHGGVSY
FT                   GMYQFSSTQGSAQEFVDGLRDTHPEYHAALDGLTPGTPEFGEAWRELAARDPEGFAAAQ
FT                   HDAIERSHYEPQLRATEARLPGIDIANRSDAVRDVLWSTAVQHGGRTDDIVERAVAGRD
FT                   VTTMTDAELVRAIYAERGRDDGAAYFGRSSEAVREGVMNRFRNEERDALRMLGE"
FT                   /protein_id="YP_003635458.1"
FT   gene            complement(374734..375486)
FT                   /db_xref="GeneID:9144208"
FT                   /locus_tag="Cfla_0342"
FT   CDS_pept        complement(374734..375486)
FT                   /locus_tag="Cfla_0342"
FT                   /gene_family="HOG000240081" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09844"
FT                   /codon_start="1"
FT                   /product="Protein of unknown function DUF2071"
FT                   /transl_table="11"
FT                   /note="PFAM: Protein of unknown function DUF2071; KEGG:
FT                   cms:CMS_0091 hypothetical protein"
FT                   /db_xref="GI:296128209"
FT                   /db_xref="InterPro:IPR018644"
FT                   /db_xref="GeneID:9144208"
FT                   /translation="MSAVPDPVTTTAPALTGRPITRQSWRDLTFVHWRVPPDVVAPLLP
FT                   PGTRPDVHDGTSWVGLVPFRMVGVGAGVGPGIPWLGTFPETNVRLYSVDEQGRRGVVFR
FT                   TLEAARLAFVLGTRAVFALPYTWARMRVTEADGVVTYTSRRRWPGPRDATTRVAVRPGP
FT                   ALDADDEAAFLTARWGLHTRAYGRTLYVPNRHEPWPLQTAELLALDDRLVAACGVPGTA
FT                   RPPDSVLFSRGVRTDFGAPVDVRSPRTA"
FT                   /protein_id="YP_003635459.1"
FT   misc_feature    complement(374779..375423)
FT                   /note="Uncharacterized conserved protein (COG2071); Region:
FT                   DUF2071; cl01329"
FT                   /db_xref="CDD:154337"
FT                   /locus_tag="Cfla_0342"
FT   gene            complement(375483..376703)
FT                   /db_xref="GeneID:9144209"
FT                   /locus_tag="Cfla_0343"
FT   CDS_pept        complement(375483..376703)
FT                   /locus_tag="Cfla_0343"
FT                   /gene_family="HOG000223821" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /codon_start="1"
FT                   /product="cytochrome P450"
FT                   /transl_table="11"
FT                   /note="PFAM: cytochrome P450; KEGG: bfa:Bfae_19760
FT                   cytochrome P450"
FT                   /db_xref="GI:296128210"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="GeneID:9144209"
FT                   /translation="MSEHSPSDELSADDHLATGRAPHDSAGRTPTADWDPRDPRVQQDP
FT                   LGAYDAMRSGCPVARGPDGAWTLFAHRDVVATALDPATFSNAVSRHLQVPNGMDGPAHA
FT                   AYRAVVDRYFTPARVRAVEPVVRQVADDLVATLAAPAHVDAVALGALFAVRAQSAWLGW
FT                   PQDLEGELLAWVAENRDATRSRDSTRTAAVAEHFRRLVASLTAARRGDDAPDDVTTELV
FT                   RDQVDGRPLTDAEVVSVLRNWTGGDLGSMALCAGVVLAHLADHPDLQARLRAGVDDDEL
FT                   DRTLDEVLRVDDPFVSNRRIATRDAEVGGRRIAAGDQVLLHWTAANRDPEVFGDAFDPG
FT                   AHAADNLVWGIGPHVCPGRPLALLELRTLVRALLAATTAIEPDPERAREREQPPAGGWA
FT                   AVPLVLR"
FT                   /protein_id="YP_003635460.1"
FT   misc_feature    complement(375630..376640)
FT                   /note="Cytochrome P450; Region: p450; cl12078"
FT                   /db_xref="CDD:176837"
FT                   /locus_tag="Cfla_0343"
FT   gene            complement(376760..377188)
FT                   /db_xref="GeneID:9144210"
FT                   /locus_tag="Cfla_0344"
FT   CDS_pept        complement(376760..377188)
FT                   /locus_tag="Cfla_0344"
FT                   /gene_family="HOG000218078" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:ROP_37910"
FT                   /codon_start="1"
FT                   /product="rifampin ADP-ribosyl transferase"
FT                   /transl_table="11"
FT                   /note="KEGG: rop:ROP_37910 rifampin ADP-ribosyl
FT                   transferase"
FT                   /db_xref="GI:296128211"
FT                   /db_xref="GeneID:9144210"
FT                   /translation="MPDVPVPFEAHPSGAYLHGTRADLRVGDLLAPGRRSNYGAGREAA
FT                   FVYVTRTLDAATWGAELAVGDGPGRIYVVEPTGDLEDDPNVTDQRFPGNPTLSYRTREP
FT                   LRVVGEIEDWAGHPPEQVATMRAHLAELAHDGVEAIED"
FT                   /protein_id="YP_003635461.1"
FT   misc_feature    complement(376847..377146)
FT                   /note="DNA/RNA tunnel of bacterial DNA dependent RNA
FT                   polymerase; Region: RNApol_Rpb2_rif; pfam12120"
FT                   /db_xref="CDD:152555"
FT                   /locus_tag="Cfla_0344"
FT   gene            complement(377253..377996)
FT                   /db_xref="GeneID:9144211"
FT                   /locus_tag="Cfla_0345"
FT   CDS_pept        complement(377253..377996)
FT                   /locus_tag="Cfla_0345"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, MerR family"
FT                   /transl_table="11"
FT                   /note="KEGG: nfa:nfa53700 putative transcriptional
FT                   regulator; PFAM: regulatory protein MerR; SMART: regulatory
FT                   protein MerR"
FT                   /db_xref="GI:296128212"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="GeneID:9144211"
FT                   /translation="MSRRMLRHWEQLGLIEPASVDPATGYRRYADSQAGRVRAVASLRA
FT                   VGSGLEQIVDLLGPGLTQGRLVELLRERAQELERTITEESARLVEVRSRLAALERGSGT
FT                   VMSTLELGPLPALRLRAVSVAVRDETEIPDAVRDVSTRLRACLSPADRDAEVVCLYDGT
FT                   SDESITVTAGTAATADAGALGVVEVPAVAAGVSVTFEQSPGSVADAWITLDAALAERGL
FT                   RTTGVHRHVTATAGPVTLQAPVRTA"
FT                   /protein_id="YP_003635462.1"
FT   misc_feature    complement(<377826..377993)
FT                   /note="Helix-Turn-Helix DNA binding domain of transcription
FT                   regulators from the MerR superfamily; Region: HTH_MerR-SF;
FT                   cl02600"
FT                   /db_xref="CDD:155005"
FT                   /locus_tag="Cfla_0345"
FT   misc_feature    complement(order(377916..377924,377976..377978))
FT                   /note="DNA binding residues"
FT                   /db_xref="CDD:133389"
FT                   /locus_tag="Cfla_0345"
FT   gene            complement(378076..378894)
FT                   /db_xref="GeneID:9144212"
FT                   /locus_tag="Cfla_0346"
FT   CDS_pept        complement(378076..378894)
FT                   /locus_tag="Cfla_0346"
FT                   /gene_family="HOG000094311" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Arth_4384"
FT                   /codon_start="1"
FT                   /product="ATP-binding protein"
FT                   /transl_table="11"
FT                   /note="KEGG: art:Arth_4384 ATP-binding protein"
FT                   /db_xref="GI:296128213"
FT                   /db_xref="GeneID:9144212"
FT                   /translation="MSECFAVTKEHRRFTEFADSVRRGRTIGLCFGPAGVGKTVSARRY
FT                   AHWDQAHELLTDWGPRCDDDAKIYAALAKNRTALYTPGVLTTPRLLREDLDRIITRTSI
FT                   CIQQHLEVPGRIPVDRWGTRRTTNDVQLVIVDESERLSPTALELLRDRYDRDQIALILI
FT                   GMPGLEKQFSHYPQFYSRVGFAHQYRPLSTDEMLFVLQRHWRSLGKTLNPDDFTDAQTI
FT                   AAISRITRGNFRLLERLFPQIERVLKINELQTITNDVVEAAASTLVIGVN"
FT                   /protein_id="YP_003635463.1"
FT   misc_feature    complement(378085..378894)
FT                   /note="Uncharacterized ATPase, putative transposase
FT                   [General function prediction only]; Region: COG2842"
FT                   /db_xref="CDD:32670"
FT                   /locus_tag="Cfla_0346"
FT   gene            complement(378891..380293)
FT                   /db_xref="GeneID:9144213"
FT                   /locus_tag="Cfla_0347"
FT                   /pseudo
FT   gene            complement(380301..380930)
FT                   /db_xref="GeneID:9144214"
FT                   /locus_tag="Cfla_0348"
FT   CDS_pept        complement(380301..380930)
FT                   /locus_tag="Cfla_0348"
FT                   /gene_family="HOG000275578" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00239"
FT                   /codon_start="1"
FT                   /product="Resolvase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Resolvase domain; Resolvase helix-turn-helix
FT                   domain protein; KEGG: art:Arth_4386 resolvase"
FT                   /db_xref="GI:296128214"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="GeneID:9144214"
FT                   /translation="MSDGFRYGRRVGPLLGYARVSTTDQDASLQVDALTKAGCYRVFVD
FT                   TGSGSLQHRPELDKLLDQLRPGDTLVVWRLDRLGRSIRHLIDQLQVLADRGVGFRSLQE
FT                   TIDTTSPGGRLVFHVFAALAEFERDLIRERTNAGLAAARARGRSGGRPSALSADQVRAA
FT                   RRIYEQKDMTVAQIGQVLGVSRTTIYRALNRAPAAAAPSRRATSAV"
FT                   /protein_id="YP_003635464.1"
FT   misc_feature    complement(380526..380891)
FT                   /note="Serine Recombinase (SR) family, Resolvase and
FT                   Invertase subfamily, catalytic domain; members contain a
FT                   C-terminal DNA binding domain. Serine recombinases catalyze
FT                   site-specific recombination of DNA molecules by a
FT                   concerted, four-strand cleavage and...; Region: SR_ResInv;
FT                   cd03768"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Cfla_0348"
FT   misc_feature    complement(380364..380885)
FT                   /note="multiple promoter invertase; Provisional; Region:
FT                   mpi; PRK13413"
FT                   /db_xref="CDD:172040"
FT                   /locus_tag="Cfla_0348"
FT   misc_feature    complement(order(380691..380693,380700..380705,
FT                   380868..380870,380874..380876))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Cfla_0348"
FT   misc_feature    complement(380868..380870)
FT                   /note="catalytic nucleophile; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Cfla_0348"
FT   misc_feature    complement(order(380550..380552,380562..380567,
FT                   380571..380576,380706..380708))
FT                   /note="Presynaptic Site I dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Cfla_0348"
FT   misc_feature    complement(order(380544..380546,380553..380555,
FT                   380562..380567,380574..380579,380586..380588,
FT                   380670..380675,380688..380690))
FT                   /note="Synaptic Antiparallel dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Cfla_0348"
FT   misc_feature    complement(order(380529..380531,380541..380543,
FT                   380550..380552,380562..380564,380571..380576,
FT                   380583..380588,380613..380621))
FT                   /note="Synaptic Flat tetramer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Cfla_0348"
FT   misc_feature    complement(order(380529..380531,380541..380543,
FT                   380550..380552,380562..380564,380571..380573,
FT                   380619..380621))
FT                   /note="Synaptic Site I dimer interface; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Cfla_0348"
FT   misc_feature    complement(order(380526..380531,380547..380549))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="Cfla_0348"
FT   misc_feature    complement(380364..380459)
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cd00569"
FT                   /db_xref="CDD:119388"
FT                   /locus_tag="Cfla_0348"
FT   gene            381083..381442
FT                   /db_xref="GeneID:9144215"
FT                   /locus_tag="Cfla_0349"
FT   CDS_pept        381083..381442
FT                   /locus_tag="Cfla_0349"
FT                   /gene_family="HOG000144506" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /transl_table="11"
FT                   /note="KEGG: mlu:Mlut_20650 transcriptional regulator, ArsR
FT                   family; PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR"
FT                   /db_xref="GI:296128215"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9144215"
FT                   /translation="MLSIATRLDVMNRLGRAMADPTRSRLLMALLERPAYPAELARDLG
FT                   LTRSNVSNHLACLRDCGIVVAEPEGRQTRYEIADPHLARALNALVEVTLTVNENAPCID
FT                   PACPVPGCANAEPDA"
FT                   /protein_id="YP_003635465.1"
FT   misc_feature    381125..381355
FT                   /note="Arsenical Resistance Operon Repressor and similar
FT                   prokaryotic, metal regulated homodimeric repressors. ARSR
FT                   subfamily of helix-turn-helix bacterial transcription
FT                   regulatory proteins (winged helix topology). Includes
FT                   several proteins that appear to...; Region: HTH_ARSR;
FT                   cd00090"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Cfla_0349"
FT   misc_feature    order(381125..381130,381134..381136,381143..381145,
FT                   381152..381157,381164..381169,381176..381178,
FT                   381266..381268,381323..381328,381332..381340,
FT                   381344..381352)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Cfla_0349"
FT   misc_feature    order(381128..381133,381143..381151,381188..381196,
FT                   381221..381232,381236..381241,381248..381253,
FT                   381257..381262,381278..381286,381299..381307)
FT                   /note="putative DNA binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Cfla_0349"
FT   misc_feature    order(381188..381190,381197..381199,381323..381325)
FT                   /note="putative Zn2+ binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Cfla_0349"
FT   gene            381439..382038
FT                   /db_xref="GeneID:9144216"
FT                   /locus_tag="Cfla_0350"
FT   CDS_pept        381439..382038
FT                   /locus_tag="Cfla_0350"
FT                   /gene_family="HOG000099674" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03596"
FT                   /codon_start="1"
FT                   /product="cadmium resistance transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: cadmium resistance transporter; KEGG:
FT                   mva:Mvan_3241 cadmium resistance transporter"
FT                   /db_xref="GI:296128216"
FT                   /db_xref="InterPro:IPR004676"
FT                   /db_xref="GeneID:9144216"
FT                   /translation="MIVSSVLQAIGLFVATNIDDIIVLSLFFARGAGQRGTTARITAGQ
FT                   YLGFAGILGTAVLVSLGAGAFLPEEAIPYFGLIPLALGLWAAWRAWRGSDDDDDDAKVE
FT                   GKNVGVLTVAAVTFANGGDNIGVYVPVFLNVGPVAVVAYCVVFLLLVAILVMLAKFIAT
FT                   RRPIAEVLERWEHVLFPIVLIGLGIVILVSGGAFGL"
FT                   /protein_id="YP_003635466.1"
FT   misc_feature    381475..381963
FT                   /note="Cadmium resistance transporter; Region: Cad;
FT                   cl04177"
FT                   /db_xref="CDD:141807"
FT                   /locus_tag="Cfla_0350"
FT   gene            382610..382846
FT                   /db_xref="GeneID:9144217"
FT                   /locus_tag="Cfla_0351"
FT   CDS_pept        382610..382846
FT                   /locus_tag="Cfla_0351"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF09851"
FT                   /codon_start="1"
FT                   /product="Protein of unknown function DUF2078, membrane"
FT                   /transl_table="11"
FT                   /note="PFAM: Protein of unknown function DUF2078, membrane;
FT                   KEGG: ace:Acel_1653 hypothetical protein"
FT                   /db_xref="GI:296128217"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="GeneID:9144217"
FT                   /translation="MPWCVDLGVGGWLVLASSLAVLGMAVWAVTRLFPAAPEPDAVTLL
FT                   DARLAAGQIDVDTYRRLHAELAGPVPARSEGLR"
FT                   /protein_id="YP_003635467.1"
FT   misc_feature    382631..382807
FT                   /note="Predicted membrane protein (DUF2078); Region:
FT                   DUF2078; cl01373"
FT                   /db_xref="CDD:154360"
FT                   /locus_tag="Cfla_0351"
FT   gene            382843..383088
FT                   /db_xref="GeneID:9144218"
FT                   /locus_tag="Cfla_0352"
FT   CDS_pept        382843..383088
FT                   /locus_tag="Cfla_0352"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: rpt:Rpal_4078 protein of unknown function
FT                   DUF81"
FT                   /db_xref="GI:296128218"
FT                   /db_xref="GeneID:9144218"
FT                   /translation="MKSHLKGMVVAAAAVLVVALAAGVRPGAALAPALACPLMMIAMMV
FT                   WMHRRGHTGQPHHGAHDVTADAPVTSPPHSAAPGAR"
FT                   /protein_id="YP_003635468.1"
FT   gene            complement(383091..384089)
FT                   /db_xref="GeneID:9144219"
FT                   /locus_tag="Cfla_0353"
FT   CDS_pept        complement(383091..384089)
FT                   /locus_tag="Cfla_0353"
FT                   /gene_family="HOG000223177" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /codon_start="1"
FT                   /EC_number="2.7.13.3"
FT                   /transl_table="11"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   response regulator receiver; histidine kinase A domain
FT                   protein; KEGG: kse:Ksed_04930 signal transduction histidine
FT                   kinase; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein"
FT                   /db_xref="GI:296128219"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009082"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="GeneID:9144219"
FT                   /translation="MKVPDRRPSAADNGQVTPTPDTTTTTARRAVVVDDEQALARLVAG
FT                   YLERDGFEVSVTHDGSQAVGVLREVDPDVVVSRVPAAGLGAEFDDLAESFNAMAARLQE
FT                   AERLRARLLADVAHEVRTPVATIAGYLEAVEDGLQPMDEPTMAVLRDQSARLTRLARDL
FT                   AAVTRAEAGDLVLTLEPLAPDELLAATTGTWRERATAAGVDVRVQVDPELGHVRVDRQR
FT                   MGQVLDNLVANALRHTPAGGTITLRATGGYQRVALHVSDTGAGIAPEHLPHLFERFYRA
FT                   DTARDRTHGGSGIGLAICKALTEAHGGTITATSDGPGAGASFTVTLPVPPG"
FT                   /product="response regulator receiver sensor signal
FT                   transduction histidine kinase"
FT                   /protein_id="YP_003635469.1"
FT   misc_feature    complement(383862..383987)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cl09944"
FT                   /db_xref="CDD:175054"
FT                   /locus_tag="Cfla_0353"
FT   misc_feature    complement(<383661..383747)
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Cfla_0353"
FT   misc_feature    complement(383736..383738)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Cfla_0353"
FT   misc_feature    complement(383109..383423)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Cfla_0353"
FT   misc_feature    complement(order(383121..383123,383127..383132,
FT                   383148..383150,383154..383156,383202..383213,
FT                   383292..383297,383301..383303,383307..383309,
FT                   383313..383315,383382..383384,383391..383393,
FT                   383403..383405))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Cfla_0353"
FT   misc_feature    complement(383391..383393)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Cfla_0353"
FT   misc_feature    complement(order(383205..383207,383211..383213,
FT                   383295..383297,383301..383303))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Cfla_0353"
FT   gene            384178..384474
FT                   /db_xref="GeneID:9144220"
FT                   /locus_tag="Cfla_0354"
FT   CDS_pept        384178..384474
FT                   /locus_tag="Cfla_0354"
FT                   /gene_family="HOG000101837" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05768"
FT                   /codon_start="1"
FT                   /product="glutaredoxin 2"
FT                   /transl_table="11"
FT                   /note="PFAM: glutaredoxin 2; KEGG: nca:Noca_3783
FT                   glutaredoxin 2"
FT                   /db_xref="GI:296128220"
FT                   /db_xref="InterPro:IPR008554"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="GeneID:9144220"
FT                   /translation="MSTIEPADPPVLVTVVHAPACHFCHDAEEALAALAGDFPLVVRSV
FT                   GIDTDEGRALVAEHRPPMNPLVLVDGEFFSAGRLPRKKLTKVLHSRRTAAVGA"
FT                   /protein_id="YP_003635470.1"
FT   gene            384476..385459
FT                   /db_xref="GeneID:9144221"
FT                   /locus_tag="Cfla_0355"
FT   CDS_pept        384476..385459
FT                   /locus_tag="Cfla_0355"
FT                   /gene_family="HOG000223991" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02683"
FT                   /codon_start="1"
FT                   /product="cytochrome c biogenesis protein transmembrane
FT                   region"
FT                   /transl_table="11"
FT                   /note="PFAM: cytochrome c biogenesis protein transmembrane
FT                   region; KEGG: nca:Noca_3784 cytochrome c biogenesis
FT                   protein, transmembrane region"
FT                   /db_xref="GI:296128221"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="GeneID:9144221"
FT                   /translation="MGSELLTTGSILAAFFAGGVALFAPCCIVFLAPSYLAGAVKNARW
FT                   RLLPLTFVFAAGLAVVLVPITLGMSLLAGAIARYHAPLYWAGGLLMIALAGLALSGRMW
FT                   SLPSFLRTPDTTGGDTASFFSLGVFSGIASSCCAPVLAGVMTLSILSGSPIGGLALGLA
FT                   YVFGMVFPLFVMALVWDKARLGERKLFQARTVRLPVAGRTLVTNTLNIAVAVGFTVMGV
FT                   FVIALAGSKDMTGGSAFQDAASRTLTDVFAAVQDFLSPVPEPLQGLALLAVAAAFIWAT
FT                   LVDRRRPARSKSAAPATTTAAAGPSDGPAVPVPSCHATPTTEEVTR"
FT                   /protein_id="YP_003635471.1"
FT   misc_feature    <384788..>385009
FT                   /note="Thiol:disulfide interchange protein
FT                   [Posttranslational modification, protein turnover,
FT                   chaperones / Energy production and conversion]; Region:
FT                   COG4232"
FT                   /db_xref="CDD:33957"
FT                   /locus_tag="Cfla_0355"
FT   gene            385456..386082
FT                   /db_xref="GeneID:9144222"
FT                   /locus_tag="Cfla_0356"
FT   CDS_pept        385456..386082
FT                   /locus_tag="Cfla_0356"
FT                   /gene_family="HOG000223992" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /codon_start="1"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /transl_table="11"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; KEGG: nca:Noca_3785 redoxin
FT                   domain-containing protein"
FT                   /db_xref="GI:296128222"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR017936"
FT                   /db_xref="GeneID:9144222"
FT                   /translation="MTSGTATRRLAERQQALQEVQAAQAGQARRRQRISWAAWGAGLLI
FT                   VATLIAAALITSQPTTSSDVRVAPDFTLPASDGSTVSLADFRGGPVVLYFNEGAGCDSC
FT                   LLQMAEIEKDPAFAETGITVLPIVMNTAEQINTDRQRLGVQAPFLLDDGTVSAAYDTLG
FT                   KGMHEGLPGHGFVLVDADGNQLWHGNYPSMWLAPADLLKEVTSRL"
FT                   /protein_id="YP_003635472.1"
FT   misc_feature    385657..386004
FT                   /note="Protein Disulfide Oxidoreductases and Other Proteins
FT                   with a Thioredoxin fold; Region: Thioredoxin_like; cl00388"
FT                   /db_xref="CDD:176818"
FT                   /locus_tag="Cfla_0356"
FT   gene            386300..386926
FT                   /db_xref="GeneID:9144223"
FT                   /locus_tag="Cfla_0357"
FT   CDS_pept        386300..386926
FT                   /locus_tag="Cfla_0357"
FT                   /gene_family="HOG000098555" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03713"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF305"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF305; KEGG:
FT                   kra:Krad_4586 hypothetical protein"
FT                   /db_xref="GI:296128223"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="GeneID:9144223"
FT                   /translation="MTSTTRRRLAATTAALALAATLTACSTGDEPTPEPPAAQESSSSE
FT                   DAEAATEHNAADVEFAQMMIVHHQGALEMAELAVERASTDEVRALAERIAAAQGPEIEL
FT                   MSGWLETWDEELPAEAEHGGMDHGGMEMDGMDQEEAMSTLAEFEGVAFDRRFLELMVAH
FT                   HRGAVEMAQAQIGEGADPDALALARTIRDDQNIEITEMENLLRSL"
FT                   /protein_id="YP_003635473.1"
FT   misc_feature    386468..386626
FT                   /note="Domain of unknown function (DUF305); Region: DUF305;
FT                   pfam03713"
FT                   /db_xref="CDD:146378"
FT                   /locus_tag="Cfla_0357"
FT   misc_feature    386756..386914
FT                   /note="Domain of unknown function (DUF305); Region: DUF305;
FT                   pfam03713"
FT                   /db_xref="CDD:146378"
FT                   /locus_tag="Cfla_0357"
FT   gene            387626..388027
FT                   /db_xref="GeneID:9144224"
FT                   /locus_tag="Cfla_0358"
FT   CDS_pept        387626..388027
FT                   /locus_tag="Cfla_0358"
FT                   /gene_family="HOG000099005" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03860"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF326"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF326; KEGG:
FT                   sco:SCO3281 hypothetical protein"
FT                   /db_xref="GI:296128224"
FT                   /db_xref="InterPro:IPR005560"
FT                   /db_xref="GeneID:9144224"
FT                   /translation="MKTTQMLDTYPATINLDRQLLARVIESLVACSQACTACADACLSE
FT                   EMVADLRKCIRSNLDCADSCAATARILSRHTGYDANITRAHLEACIAACRACGDECEQH
FT                   AGMHEHCRICAEACRDCETACAELLAAIR"
FT                   /protein_id="YP_003635474.1"
FT   misc_feature    387686..388000
FT                   /note="Cysteine-rich 4 helical bundle widely conserved in
FT                   bacteria; Region: DUF326; cd08026"
FT                   /db_xref="CDD:153434"
FT                   /locus_tag="Cfla_0358"
FT   misc_feature    order(387791..387796,387800..387805,387812..387817,
FT                   387824..387826,387833..387838,387854..387859,
FT                   387878..387880,387890..387892,387899..387904)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:153434"
FT                   /locus_tag="Cfla_0358"
FT   gene            388169..388705
FT                   /db_xref="GeneID:9144225"
FT                   /locus_tag="Cfla_0359"
FT   CDS_pept        388169..388705
FT                   /locus_tag="Cfla_0359"
FT                   /gene_family="HOG000027112" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03713"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF305"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF305; KEGG:
FT                   jde:Jden_0287 protein of unknown function DUF305"
FT                   /db_xref="GI:296128225"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="GeneID:9144225"
FT                   /translation="MKGMYLRFAAMILTAMAVMYFVMFVGSWELDHVRFSQSRVFMTVT
FT                   MGGTMGLIMLAWMLNMYRNAKANLAVVAISVLLLTGGVILDRSQATVGDTAFMRAMIPH
FT                   HSLAITRSERAQIDDVRVCELAVEIIEAQQREIAEMDWLIEDIERKGIAATAAEADARP
FT                   VPDFEGTALRSCPTP"
FT                   /protein_id="YP_003635475.1"
FT   gene            388836..391118
FT                   /db_xref="GeneID:9144226"
FT                   /locus_tag="Cfla_0360"
FT   CDS_pept        388836..391118
FT                   /locus_tag="Cfla_0360"
FT                   /gene_family="HOG000250397" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01511"
FT                   /codon_start="1"
FT                   /product="copper-translocating P-type ATPase"
FT                   /transl_table="11"
FT                   /note="KEGG: mgi:Mflv_2852 copper-translocating P-type
FT                   ATPase; TIGRFAM: copper-translocating P-type ATPase; heavy
FT                   metal translocating P-type ATPase; ATPase, P-type
FT                   (transporting), HAD superfamily, subfamily IC; PFAM: E1-E2
FT                   ATPase-associated domain protein; Haloacid dehalogenase
FT                   domain protein hydrolase"
FT                   /db_xref="GI:296128226"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006403"
FT                   /db_xref="InterPro:IPR006416"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="GeneID:9144226"
FT                   /translation="MSNAHQGHDVHGERRSSASQRHELSVEDTDPLAHDRHGGHDAGQM
FT                   EHEGHHMPAHVDGHDAEHRPSASHHGEHMGAEGDHGGHGAHGGGHGDHVALFRRLFWIN
FT                   LALAVPTVLLSGMFADLLGYALPDVPGLTWVAPALGTVIYLWGGRPFLTGAVAEFRARK
FT                   PGMMLLIGMAITVAFVASWGATLGVLSHELDFWWELALLVVIMLLGHWLEMRSLAQTSS
FT                   ALDSLAALLPDEAEKVDGDSVVTVAPSSLALGDVVIVRPGGRVPADGQVVEGAADVDES
FT                   MITGESRPVFRTVGDQVVAGTVSTDSALRVRVDAVGDSTVLAGIRRLVAQAQSSTTRAQ
FT                   LLADRAAGWLFWFALIAAVITVAIWSAVGTPDFAIIRAITVLVIACPHALGLAIPLVVS
FT                   ISTERAAWGGVLVKDRAALERMRVVDTVLFDKTGTLTKGEPAVHDVATTGIGDDELLAL
FT                   AAAAEADSEHPLARAITAAAHHRGLTVPRAEDFQASTAVGVSVTVDGRWVAVGGPNLLA
FT                   EQGLDPLPVTQPWSDRGQIVLHVVVDGRVAGALGLADEVRQESREAVDALHALGIRVMM
FT                   ITGDAEPVAKAVGTELGIDQVFAGVRPEDKSSTVASLQGEGRTVAMVGDGVNDAPALAQ
FT                   ADVGVAIGAGTDVAIASAGVILASDDPRSVLSVIQLSREGYRKMKQNLWWAAGYNIAAV
FT                   PLAAGVLAPVGFVLPMEIGAILMSLSTVVVAANAQLLRRLDLSPQALTAAAHGAQRVGP
FT                   RTAVPAA"
FT                   /protein_id="YP_003635476.1"
FT   misc_feature    389124..391034
FT                   /note="Cation transport ATPase [Inorganic ion transport and
FT                   metabolism]; Region: ZntA; COG2217"
FT                   /db_xref="CDD:32399"
FT                   /locus_tag="Cfla_0360"
FT   misc_feature    389436..390095
FT                   /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
FT                   /db_xref="CDD:143896"
FT                   /locus_tag="Cfla_0360"
FT   misc_feature    390465..>390755
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cl11391"
FT                   /db_xref="CDD:175233"
FT                   /locus_tag="Cfla_0360"
FT   gene            391203..391751
FT                   /db_xref="GeneID:9144227"
FT                   /locus_tag="Cfla_0361"
FT   CDS_pept        391203..391751
FT                   /locus_tag="Cfla_0361"
FT                   /gene_family="HOG000002795" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:CE0276"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cef:CE0276 hypothetical protein"
FT                   /db_xref="GI:296128227"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="GeneID:9144227"
FT                   /translation="MRSRLRLAAVVVAATAVLAGCSATSDDDVLADLGLDGLTGQEIVT
FT                   RLDTSTDSRPLNFTASVREDEVLVGDGTAEVAVPLDEGEFYVSIAPYIETTHECYFHSL
FT                   ATCQGELVDEPVEVTITDADGVVLVEESATTYSNGFVGYWLPEDVEGTIEITQGDLSGN
FT                   VPFSTTEGSPTCVTTLQLT"
FT                   /protein_id="YP_003635477.1"
FT   gene            complement(392199..392471)
FT                   /db_xref="GeneID:9144228"
FT                   /locus_tag="Cfla_0362"
FT   CDS_pept        complement(392199..392471)
FT                   /locus_tag="Cfla_0362"
FT                   /gene_family="HOG000023915" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02583"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF156"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   nca:Noca_0141 hypothetical protein"
FT                   /db_xref="GI:296128228"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="GeneID:9144228"
FT                   /translation="MELDPEQMAKVSNRLKRAQGQLAAVIRMIDEGTGCEDVVTQLAAV
FT                   SKALDRAGFAIIASGMQQCLTRPQDADEEPTLDVAKLEKLFLSLA"
FT                   /protein_id="YP_003635478.1"
FT   misc_feature    complement(392214..392444)
FT                   /note="Uncharacterized BCR, COG1937; Region: DUF156;
FT                   cl00846"
FT                   /db_xref="CDD:174421"
FT                   /locus_tag="Cfla_0362"
FT   gene            complement(392509..392628)
FT                   /db_xref="GeneID:9144229"
FT                   /locus_tag="Cfla_0363"
FT   CDS_pept        complement(392509..392628)
FT                   /locus_tag="Cfla_0363"
FT                   /gene_family="HOG000246110" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Mvan_5833"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mva:Mvan_5833 hypothetical protein"
FT                   /db_xref="GI:296128229"
FT                   /db_xref="GeneID:9144229"
FT                   /translation="MCYPALCPTCRKTTWDGCGMHADDVMASVPQDQRCTCAR"
FT                   /protein_id="YP_003635479.1"
FT   gene            complement(392652..394358)
FT                   /db_xref="GeneID:9144230"
FT                   /locus_tag="Cfla_0364"
FT   CDS_pept        complement(392652..394358)
FT                   /locus_tag="Cfla_0364"
FT                   /gene_family="HOG000276710" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /codon_start="1"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase"
FT                   /transl_table="11"
FT                   /note="KEGG: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; PFAM: FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; Rhodanese domain
FT                   protein; pyridine nucleotide-disulphide oxidoreductase
FT                   dimerisation region; Carbamoyl-phosphate synthetase large
FT                   chain oligomerisation; SMART: Rhodanese domain protein"
FT                   /db_xref="GI:296128230"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="GeneID:9144230"
FT                   /translation="MTSSPTATTPGRRIVVVGGVAGGMSAAARARRLDETASIVVLEQS
FT                   EYVSFANCGLPYHLSGEIESRDALLLHTPQSLRAALALDVRTGSRVTAIDRAARTVTVT
FT                   HADGTYELPYDALLLAPGAVAVRPPVEGLDHPAVHALRTIPDLDALTARVAALPADGPR
FT                   RAVVVGAGFIGLEAVEALAARGLEVALVELADHVLPPLDAELAPLLADELRAHGVALHL
FT                   GVSASAVTSTDDGAALVTLSDGTRLPADVVVVNVGVRPASDLARDAGLELGARGAIKVD
FT                   ADQRTSDPYVWAVGDAVEVTQAVTGDTGPVPLAGPANRQGRRAADAMLGRRTTPQAPVL
FT                   GTAIVRVFGLTAAVTGASQATLARAGVEHETVRIHAGHHAGYFPGAEQVHLVASFAPDG
FT                   RLLGAQAVGREGVDKRIDVLATALRAGMTADDLAELELAYAPPYGAAKDPVNMLGFVAQ
FT                   NVLDGTMPQWTVAEVDAVMASHLVLDVRSRAEFAGGHLEGALNVPHTELRDRLDEVRDA
FT                   ADGRPVAVHCASGVRAHIATRVVLAAGLDARNLSGGWISLVTTRPDLTRTR"
FT                   /protein_id="YP_003635480.1"
FT   misc_feature    complement(392997..394262)
FT                   /note="CoA-disulfide reductase; Region: CoA_CoA_reduc;
FT                   TIGR03385"
FT                   /db_xref="CDD:163244"
FT                   /locus_tag="Cfla_0364"
FT   misc_feature    complement(393642..393869)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="Cfla_0364"
FT   misc_feature    complement(393075..393335)
FT                   /note="Pyridine nucleotide-disulphide oxidoreductase,
FT                   dimerization domain; Region: Pyr_redox_dim; pfam02852"
FT                   /db_xref="CDD:145812"
FT                   /locus_tag="Cfla_0364"
FT   misc_feature    complement(392700..392960)
FT                   /note="Rhodanese Homology Domain (RHOD); an alpha beta fold
FT                   domain found duplicated in the rhodanese protein. The
FT                   cysteine containing enzymatically active version of the
FT                   domain is also found in the Cdc25 class of protein
FT                   phosphatases and a variety of proteins...; Region: RHOD;
FT                   cl00125"
FT                   /db_xref="CDD:174003"
FT                   /locus_tag="Cfla_0364"
FT   misc_feature    complement(392778..392780)
FT                   /note="active site residue"
FT                   /db_xref="CDD:29073"
FT                   /locus_tag="Cfla_0364"
FT   gene            complement(394466..395233)
FT                   /db_xref="GeneID:9144231"
FT                   /locus_tag="Cfla_0365"
FT   CDS_pept        complement(394466..395233)
FT                   /locus_tag="Cfla_0365"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: deb:DehaBAV1_0979 Ig domain-containing
FT                   protein"
FT                   /db_xref="GI:296128231"
FT                   /db_xref="GeneID:9144231"
FT                   /translation="MSAPRRGRTRARRTAGWWSVAVLVLVGLVLGAAPPATAGGRAPAP
FT                   TLRLSAPAHVVAGVPFDVTVTVRQAGRPYVGTVRFATDDALVRSLPADYTFTRADRGTH
FT                   RFEGVTLVGTGRHRLTVRDTRHRGLQDTDPVRVANARAAVRGTVLSTMDPIYGPSTVTV
FT                   YDAVTGKALRSGRTDDQGDEYLITGLPAGDVKVGAVCDGIPPEYLYEPGFANNQDTLAE
FT                   ADVFHLRPGRTLEQSWGLEPYFGPYLDLDRIWP"
FT                   /protein_id="YP_003635481.1"
FT   gene            395524..396645
FT                   /db_xref="GeneID:9144232"
FT                   /locus_tag="Cfla_0366"
FT   CDS_pept        395524..396645
FT                   /locus_tag="Cfla_0366"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: saq:Sare_3177 peptidase"
FT                   /db_xref="GI:296128232"
FT                   /db_xref="InterPro:IPR001316"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="GeneID:9144232"
FT                   /translation="MFQHVRRSVLPVVIACVAVVPLGLAAHADPGRPGRGGLDDAGRVA
FT                   QEQRATRGQNAFNDLVARTVAAHPTEVVDFSWDGARGRVVVADGADALARELTAAGTVV
FT                   GTAAPGAVPYGSRSAVELAAIEQLQAAGVESVAARYDAPTHSVQVTAWTDAPAATAERV
FT                   DEALGGPTTFAASSQPAVVVTYEPARDVPQESSTQGGEVYGGCTGGFMATRGSAYGITT
FT                   SAHCTSKPTRYDGDTTGSTYVASDRRDVRFTALSGDTAQNKFRIDSTTLRTINATGIVS
FT                   TGSLLFKYGKTTGYGSSTVESYKGCVTFTSGNVWCNLYYTKDSVTAGGDSGGPWFVANT
FT                   GYGFTTGQNSGGSYVTPIAYVASISGTVKVKTS"
FT                   /protein_id="YP_003635482.1"
FT   gene            396645..397025
FT                   /db_xref="GeneID:9144233"
FT                   /locus_tag="Cfla_0367"
FT   CDS_pept        396645..397025
FT                   /locus_tag="Cfla_0367"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: fra:Francci3_0851 hypothetical protein"
FT                   /db_xref="GI:296128233"
FT                   /db_xref="GeneID:9144233"
FT                   /translation="MTTTRAAWVPAAVVAALAVGASACAGQVDGTPGTTTADVPSATAP
FT                   EQPDAAYTDLELAVLDALADDPHQKAARYEADEDRVVVTVWTQGGTLDADALRDLEQRA
FT                   EQVTDGVDVVVETTDEDAPTEG"
FT                   /protein_id="YP_003635483.1"
FT   gene            complement(397059..397934)
FT                   /db_xref="GeneID:9144234"
FT                   /locus_tag="Cfla_0368"
FT   CDS_pept        complement(397059..397934)
FT                   /locus_tag="Cfla_0368"
FT                   /gene_family="HOG000128096" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, XRE family"
FT                   /transl_table="11"
FT                   /note="KEGG: kra:Krad_2579 helix-turn-helix domain protein;
FT                   PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="GI:296128234"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="GeneID:9144234"
FT                   /translation="MGRDRAALAEFLRSRRDRLTPRQAGITPSPGERRVPGLRRQELAQ
FT                   LAGLSVDYYNRLEQGRQANISREVLDALARALRLDDVERAHLDDLAAPASPRARATTER
FT                   PQRPDPGLLRVTSMLDHLPVVVIGRRGTVLARNALFSAVYGHPMEPGTCYTRYLLLDPD
FT                   ARDRIIDWEACARAAVAGLRREVARRPQDHRLRQQIDELCRADADVARWWDDHRVSEYS
FT                   SAPRRIRHPVAGDLSFDVELLVAPQEPDQHLVLYTVEPHSRTARTLPLLAAGGAGPAAG
FT                   VVVTDDAGET"
FT                   /protein_id="YP_003635484.1"
FT   gene            398085..398855
FT                   /db_xref="GeneID:9144235"
FT                   /locus_tag="Cfla_0369"
FT   CDS_pept        398085..398855
FT                   /locus_tag="Cfla_0369"
FT                   /gene_family="HOG000055568" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bam:Bamb_5753 GCN5-related N- acetyltransferase"
FT                   /db_xref="GI:296128235"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="GeneID:9144235"
FT                   /translation="MALPTDPSASFVTAYASTMADLAAATTGRTRRAPGGTVLAVSGAP
FT                   VAALNAVISPTRPADVDEVVALASQEAPRDLPWSIQVRGVPDPVLVAAAARLGLTRAER
FT                   QPLMVRRADAGSPDAPAVDGLRVRAVAADELALYARTVAEGFGAPHGVLAVLAEPALAA
FT                   VDGMAFFLAERDGVPVGTGMTATSGGVTGLYNVTTLPAVRRRGHGRAITLELVRAADAA
FT                   GAGTCYLYASELGEPVYRLLGFRTVEDLTVLTAA"
FT                   /protein_id="YP_003635485.1"
FT   misc_feature    398589..398774
FT                   /note="N-Acyltransferase superfamily: Various enzymes that
FT                   characteristically catalyze the transfer of an acyl group
FT                   to a substrate; Region: NAT_SF; cd04301"
FT                   /db_xref="CDD:173926"
FT                   /locus_tag="Cfla_0369"
FT   misc_feature    order(398670..398678,398706..398711)
FT                   /note="Coenzyme A binding pocket; other site"
FT                   /db_xref="CDD:173926"
FT                   /locus_tag="Cfla_0369"
FT   gene            complement(398870..399280)
FT                   /db_xref="GeneID:9144236"
FT                   /locus_tag="Cfla_0370"
FT   CDS_pept        complement(398870..399280)
FT                   /locus_tag="Cfla_0370"
FT                   /gene_family="HOG000267215" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01042"
FT                   /codon_start="1"
FT                   /product="Endoribonuclease L-PSP"
FT                   /transl_table="11"
FT                   /note="PFAM: Endoribonuclease L-PSP; KEGG: kra:Krad_2820
FT                   endoribonuclease L-PSP"
FT                   /db_xref="GI:296128236"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR013813"
FT                   /db_xref="GeneID:9144236"
FT                   /translation="MTVQLSSPEGLLQPVPYHHVAIATGTRQVHVAGQVARAADGTTLA
FT                   PGDLAGQVAHSLRNVGAALAGVGAGFGDVVRLTFYVPGWSPEKIEDLMSGVQEVADELG
FT                   LPVPLPPATLVGVAALFEPDVLVEVEATAVIA"
FT                   /protein_id="YP_003635486.1"
FT   misc_feature    complement(398882..399232)
FT                   /note="YjgF, YER057c, and UK114 belong to a large family of
FT                   proteins present in bacteria, archaea, and eukaryotes with
FT                   no definitive function. The conserved domain is similar in
FT                   structure to chorismate mutase but there is no sequence
FT                   similarity and no...; Region: YjgF_YER057c_UK114_family;
FT                   cd00448"
FT                   /db_xref="CDD:100004"
FT                   /locus_tag="Cfla_0370"
FT   misc_feature    complement(order(398885..398887,398891..398893,
FT                   398897..398899,398930..398953,398981..398983,
FT                   398990..398992,399041..399043,399047..399049,
FT                   399053..399058,399062..399064,399182..399187,
FT                   399191..399193,399203..399205,399212..399214,
FT                   399218..399220,399227..399232))
FT                   /note="homotrimer interaction site; other site"
FT                   /db_xref="CDD:100004"
FT                   /locus_tag="Cfla_0370"
FT   misc_feature    complement(order(398897..398899,398945..398947,
FT                   398990..398992,399002..399004,399230..399232))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:100004"
FT                   /locus_tag="Cfla_0370"
FT   gene            399312..399779
FT                   /db_xref="GeneID:9144237"
FT                   /locus_tag="Cfla_0371"
FT   CDS_pept        399312..399779
FT                   /locus_tag="Cfla_0371"
FT                   /gene_family="HOG000293549" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /transl_table="11"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   fal:FRAAL3543 putative transcriptional regulator"
FT                   /db_xref="GI:296128237"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="GeneID:9144237"
FT                   /translation="MGTWWWTGTSTRLGVVTDTDGDGRDRLTITATHRELLDQVLDKWS
FT                   LDVLNELCERPLRFSGLRRAIPAVTQKSLTATLRRLERNGIVERVVLGTRPVAVEYRIT
FT                   PLGKTLRPPVDAVLHWAAVHMPSIDAARDRYDREVDGQRPVGEDRASYDPS"
FT                   /protein_id="YP_003635487.1"
FT   misc_feature    399411..399728
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Cfla_0371"
FT   gene            399795..400892
FT                   /db_xref="GeneID:9144238"
FT                   /locus_tag="Cfla_0372"
FT   CDS_pept        399795..400892
FT                   /locus_tag="Cfla_0372"
FT                   /gene_family="HOG000274120" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00367"
FT                   /codon_start="1"
FT                   /product="Na+/Ca+ antiporter, CaCA family"
FT                   /transl_table="11"
FT                   /note="KEGG: rrs:RoseRS_1116 CaCA family Na(+)/Ca(+)
FT                   antiporter; TIGRFAM: Na+/Ca+ antiporter, CaCA family; PFAM:
FT                   sodium/calcium exchanger membrane region"
FT                   /db_xref="GI:296128238"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="GeneID:9144238"
FT                   /translation="MTATVALLVVGLVLLVGGGELLVRGGSGIGRALGLSPLVIGLTVV
FT                   AFATSAPELAVSVDAALSGAPGVAVGNVVGSNISNVLLVLGLAALVLPVAVRSQLVRVD
FT                   VPVMIGFSVVALLVAWDGTVSLPEGGGLLAALVGYVVMSVRLARRTGTPDPTPDPTDGD
FT                   SPARPPRPLRDAGLVLAGVALLVLGARLLVGSATTIAQAVGLSDLVIGLTVVAIGTSLP
FT                   EVATSVIAALRGEREIALGNVLGSNIFNIGAVLGLTALVAPGGVPVADAAVRFDLPVMV
FT                   VAALVVLPVVFTGAEISRWEAVAFLAYFVAYIAYLLLAAAEHDALPVLSTALLWFVLPM
FT                   TALLLVLLTVQEVRVRRRDAGPAGG"
FT                   /protein_id="YP_003635488.1"
FT   misc_feature    399879..400574
FT                   /note="K+-dependent Na+/Ca+ exchanger related-protein;
FT                   Region: TIGR00367"
FT                   /db_xref="CDD:129464"
FT                   /locus_tag="Cfla_0372"
FT   misc_feature    399879..>399980
FT                   /note="Sodium/calcium exchanger protein; Region: Na_Ca_ex;
FT                   pfam01699"
FT                   /db_xref="CDD:145053"
FT                   /locus_tag="Cfla_0372"
FT   misc_feature    400377..>400574
FT                   /note="Sodium/calcium exchanger protein; Region: Na_Ca_ex;
FT                   pfam01699"
FT                   /db_xref="CDD:145053"
FT                   /locus_tag="Cfla_0372"
FT   gene            complement(400958..401626)
FT                   /db_xref="GeneID:9144239"
FT                   /locus_tag="Cfla_0373"
FT   CDS_pept        complement(400958..401626)
FT                   /locus_tag="Cfla_0373"
FT                   /gene_family="HOG000043729" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /codon_start="1"
FT                   /product="Methyltransferase type 11"
FT                   /transl_table="11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: saq:Sare_0198
FT                   methyltransferase type 11"
FT                   /db_xref="GI:296128239"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="GeneID:9144239"
FT                   /translation="MTTPSTTTAGERPARREHLPPMGRAWLLPLYDPFSRLVGAERLHR
FT                   RLLDQAALRPGERVLEIGCGTGNLLLLAHGVAPGVVTTGLDPDAAALARAARKARRRGT
FT                   DVRLDLGYADALPYPDASVDVVLSSLMLHHLPEEVKVAALREARRVLRPGGRLHVLDVA
FT                   GRSHGHGLAAHRGRRAARRQGTPGVDTIPALVRAAGLDVGGVTPVQTRLGPFVLVAGSR
FT                   "
FT                   /protein_id="YP_003635489.1"
FT   misc_feature    complement(<401144..401542)
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:176836"
FT                   /locus_tag="Cfla_0373"
FT   gene            401703..402713
FT                   /db_xref="GeneID:9144240"
FT                   /locus_tag="Cfla_0374"
FT   CDS_pept        401703..402713
FT                   /locus_tag="Cfla_0374"
FT                   /gene_family="HOG000043740" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, AraC family"
FT                   /transl_table="11"
FT                   /note="KEGG: stp:Strop_0182 helix-turn-helix domain-
FT                   containing protein; PFAM: helix-turn-helix- domain
FT                   containing protein AraC type; AraC protein
FT                   arabinose-binding/dimerisation; SMART: Helix-turn-helix,
FT                   AraC domain"
FT                   /db_xref="GI:296128240"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="GeneID:9144240"
FT                   /translation="MTPERQQEDDLRVTTDPRPPAPATPTTRLLRHRPDGVPVYAWVGH
FT                   PGGPPVGTMWFGGPQPGGPAPAVDHRHAHDFLVVAYVERGTGLLRLGDAEHDVGAGDVL
FT                   VVPPGQVMGAAGDGLTRGFVRAVFFPPDAVEGRSPGALRSWRRHPLLLPFVGPGARSVR
FT                   RLHVPQADRPRWARRLTDLETEVAQGRRVGSAEAALAHLTLLLVDVARLADDPAAREAW
FT                   DDPLVAAVFDVLARRSAEQLSLRDVAAEVGRTPGHVTTVVRQRTGRTVQQWLVEHRMAA
FT                   ARRLLEGSDLLVGAVGARVGYPDPAYFARVFRRSHGMSPAAWRHASRGGARPAGG"
FT                   /protein_id="YP_003635490.1"
FT   misc_feature    401913..402200
FT                   /note="Cupin domain; Region: Cupin_2; cl09118"
FT                   /db_xref="CDD:175009"
FT                   /locus_tag="Cfla_0374"
FT   misc_feature    402369..402698
FT                   /note="AraC-type DNA-binding domain-containing proteins
FT                   [Transcription]; Region: AraC; COG2207"
FT                   /db_xref="CDD:32389"
FT                   /locus_tag="Cfla_0374"
FT   misc_feature    402567..402677
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="Cfla_0374"
FT   gene            402823..404733
FT                   /db_xref="GeneID:9144241"
FT                   /locus_tag="Cfla_0375"
FT   CDS_pept        402823..404733
FT                   /locus_tag="Cfla_0375"
FT                   /gene_family="HOG000243980" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00723"
FT                   /codon_start="1"
FT                   /product="glycoside hydrolase 15-related protein"
FT                   /transl_table="11"
FT                   /note="PFAM: glycoside hydrolase 15-related; KEGG:
FT                   jde:Jden_1584 glycoside hydrolase 15-related"
FT                   /db_xref="GI:296128241"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="GeneID:9144241"
FT                   /translation="MSTPLEDYALLSDLRTGPLVSRDGSVDWLCLPRFDSAAVFCAILG
FT                   GPDDGRWKVSAVDGEVVERRYLPQTFVLETTWRTPTGAVRVTDFLPPGTGRDDLVRRVE
FT                   CLEGTVEVEHDLRLRFDYARATPWVRVVEHHGSPALLSLAGPDGLLVTGPLLTWAGTHG
FT                   DGKAEAGHGAAEQPGAFGSAQDGQGGEGGEGAGARAPRLTGTFRLEQGDVLDWDLAWFP
FT                   SWADLPDPVDADHALAETMEYWADWSSRLTVHADHTPVVLRSLLVLRALTHEETGGIVA
FT                   APTASLPEGLGGERNWDYRYVWLRDAALTIEVAIAHGLTGGARLWRDWLLRAVAGDAHD
FT                   IKIMYGVGGERELDEKELGHLAGYEESRPVRIGNGAADQYQADVVGEVMIALAMLRDAG
FT                   VADDEYSWGLQKSLLEFCEANYDREDHGIWEMRGDLHHFTHGRAMMWAAFDRGVRAVED
FT                   HGLDGPVDRWRELRDRLREEVLERGFDTGVDSFTQTYDNTEVDASLLQLPHTGLVAYDD
FT                   PRMLGTVARIESELRDEHGLLHRYRTDTGMDGLEGEEHPFLICCFWLVEQYAMSGRLDD
FT                   AQALMDQLVGYANDVGLLSEEYDPQAGRLIGNFPQAFSHLGLIRAADALAAARGRAGSP
FT                   G"
FT                   /protein_id="YP_003635491.1"
FT   misc_feature    402823..404667
FT                   /note="Glucoamylase and related glycosyl hydrolases
FT                   [Carbohydrate transport and metabolism]; Region: SGA1;
FT                   COG3387"
FT                   /db_xref="CDD:33194"
FT                   /locus_tag="Cfla_0375"
FT   misc_feature    403648..404667
FT                   /note="Glycosyl hydrolases family 15; Region:
FT                   Glyco_hydro_15; pfam00723"
FT                   /db_xref="CDD:144356"
FT                   /locus_tag="Cfla_0375"
FT   gene            405016..406503
FT                   /db_xref="GeneID:9144242"
FT                   /locus_tag="Cfla_0376"
FT   CDS_pept        405016..406503
FT                   /locus_tag="Cfla_0376"
FT                   /gene_family="HOG000019847" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:3.2.1.8"
FT                   /codon_start="1"
FT                   /EC_number="3.2.1.8"
FT                   /transl_table="11"
FT                   /note="PFAM: glycoside hydrolase family 10; Ricin B lectin;
FT                   KEGG: ami:Amir_3214 endo-1,4-beta-xylanase; SMART:
FT                   glycoside hydrolase family 10; Ricin B lectin"
FT                   /db_xref="GI:296128242"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR001000"
FT                   /db_xref="InterPro:IPR008997"
FT                   /db_xref="InterPro:IPR013781"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="GeneID:9144242"
FT                   /translation="MITTSPRHRRARRVVSLLTTAGLVATAAVALAAPAHAGTTLGQSA
FT                   AERGRYFGVAIAAGRMNDGTYMGIVDREFDSIVAENEMKMDATEPNRNQFNFSNGDRIV
FT                   NYALGKGKKVRGHTLAWHAQQPGWMQNMSGQSLRDALLNHVSRVASYYRGKIHSWDVVN
FT                   EAFADDGRGSRRDSNLQRTGNDWIEAAFRAARSADPGAKLCYNDYNTDGVNAKSTGVYN
FT                   MVRDFKARGVPIDCVGFQSHLGTTVPSDYQANLQRFADLGVDVQITELDIQQGSNQANA
FT                   YRQVVQACLAVSRCTGITVWGVRDTDSWRTGANPLLFDGSGNKKAAYAAVLEALNAGGG
FT                   NGGGNNGGGSSSVDTNAWYVLVNRNSGKALDVYNLSTADGADIVQWSRNNGNQQQWQFV
FT                   SSGNGSYRLKSRLSSKVLDVYAKSTANGAEVVQWPDNNGANQQWNVSISNGYATLLNRN
FT                   SGKALEVQGASTADGGNVVQYSAWNGANQQWQLVKVG"
FT                   /product="Endo-1,4-beta-xylanase"
FT                   /protein_id="YP_003635492.1"
FT   misc_feature    405166..405981
FT                   /note="Glycosyl hydrolase family 10; Region:
FT                   Glyco_hydro_10; cl01495"
FT                   /db_xref="CDD:154432"
FT                   /locus_tag="Cfla_0376"
FT   misc_feature    406108..406482
FT                   /note="Ricin-type beta-trefoil; Carbohydrate-binding domain
FT                   formed from presumed gene triplication. The domain is found
FT                   in a variety of molecules serving diverse functions such as
FT                   enzymatic activity, inhibitory toxicity and signal
FT                   transduction. Highly...; Region: RICIN; cd00161"
FT                   /db_xref="CDD:29101"
FT                   /locus_tag="Cfla_0376"
FT   misc_feature    order(406126..406128,406165..406167,406171..406173,
FT                   406192..406197,406267..406269,406306..406308,
FT                   406312..406314,406333..406338,406405..406407,
FT                   406444..406446,406450..406452,406474..406476)
FT                   /note="putative sugar binding sites; other site"
FT                   /db_xref="CDD:29101"
FT                   /locus_tag="Cfla_0376"
FT   misc_feature    order(406195..406203,406336..406344,406474..406482)
FT                   /note="Q-X-W motif; other site"
FT                   /db_xref="CDD:29101"
FT                   /locus_tag="Cfla_0376"
FT   gene            406737..408308
FT                   /db_xref="GeneID:9144243"
FT                   /locus_tag="Cfla_0377"
FT   CDS_pept        406737..408308
FT                   /locus_tag="Cfla_0377"
FT                   /gene_family="HOG000251512" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /codon_start="1"
FT                   /product="glycosyl transferase family 2"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   cgt:cgR_1123 hypothetical protein"
FT                   /db_xref="GI:296128243"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="GeneID:9144243"
FT                   /translation="MPPTAANPPAATTTTLERAPIPTQRSAQVEELGLDPGTVRVAGRS
FT                   SGWLQRAVGVVVLLIAAGGAALLWYAVTSSDAGGRPPERGTLLGIWDVFYDTQLPSPRV
FT                   MLAAVAVAVLLAAGVALLEQRIANRSRRSSDVLTDPLAPKIVMARTRGVYAGPVTVTVL
FT                   IPAHNEQASLPATLASLLAQSHRPERVIVVADNCTDATVDVARAAGVEVVETVGNTRKK
FT                   AGALNQVLAGLLPGQGDNDVVMVMDADTTLDAGFLAVAVARMTSDRALMAVGGLFYGEE
FT                   GAGLLGQLQRNEYLRYGREMRRCRGRVLVLTGTASLFRPAALREVARLRGTALPGTRGD
FT                   VYDTTALTEDNELTLALKSLGALMVSPEQCTVVTEVMPTWRALWAQRLRWQRGALENLG
FT                   AYGTTPTTLRYWAQQLGIGYGVIALYSYLLLIALMLLSADGWVWFPFWMGLGVVFLAER
FT                   VVTVWSGGWRARLLAVTLLPELCFDAFLDLVYVKGVLDISLGRTATWKHVVHTPTGARL
FT                   EVGDAA"
FT                   /protein_id="YP_003635493.1"
FT   misc_feature    407220..407786
FT                   /note="CESA_like is  the cellulose synthase superfamily;
FT                   Region: CESA_like; cd06423"
FT                   /db_xref="CDD:133045"
FT                   /locus_tag="Cfla_0377"
FT   misc_feature    407475..407483
FT                   /note="DXD motif; other site"
FT                   /db_xref="CDD:133045"
FT                   /locus_tag="Cfla_0377"
FT   gene            408305..408586
FT                   /db_xref="GeneID:9144244"
FT                   /locus_tag="Cfla_0378"
FT   CDS_pept        408305..408586
FT                   /locus_tag="Cfla_0378"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cgt:cgR_1124 hypothetical protein"
FT                   /db_xref="GI:296128244"
FT                   /db_xref="GeneID:9144244"
FT                   /translation="MTPGVPAGAEALDAVLASPMTQSMPLRVLTAFVAINTVIYSVLAV
FT                   AKLLPRVYPSTWFRGRNRRVEDRSIDPAGAAAREPDGPGRAASGPPLR"
FT                   /protein_id="YP_003635494.1"
FT   gene            complement(408657..409640)
FT                   /db_xref="GeneID:9144245"
FT                   /locus_tag="Cfla_0379"
FT   CDS_pept        complement(408657..409640)
FT                   /locus_tag="Cfla_0379"
FT                   /gene_family="HOG000014596" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, MerR family"
FT                   /transl_table="11"
FT                   /note="KEGG: sco:SCO1180 DNA polymerase III beta chain;
FT                   PFAM: regulatory protein MerR; DNA polymerase III beta
FT                   chain; SMART: regulatory protein MerR"
FT                   /db_xref="GI:296128245"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="GeneID:9144245"
FT                   /translation="MDDDLLSIGALARAGGLPVSALRYYDAAGVLRPARVDPATGYRWY
FT                   TTGQVRTARVVAGLRQAGLPVAEMVAVLAAPEQARTVLARHRGRLEADLAAACAHLDAV
FT                   DDLLTRPARCSVTGADLVAAVAAVRHAVGDDPAWPGLAGVLMHLDATSLRLVGCDRSRL
FT                   AVATVPVRRPSGAEVRVVAPLAFLDDLASAELPADGPVVLGSRTLEVLGRHGEPLDAAY
FT                   PDYQQLLRSGGSRHVTVATVDLVEAVDGADEIVVVRLDGDRVALGAPGPDDALGFSRTF
FT                   LLDAVRAARAEHVALALEDERAVLSVSPAGRPGDVGLVMPVLLRHR"
FT                   /protein_id="YP_003635495.1"
FT   misc_feature    complement(409368..409625)
FT                   /note="Helix-Turn-Helix DNA binding domain of the BmrR
FT                   transcription regulator; Region: HTH_BmrR; cd01107"
FT                   /db_xref="CDD:133382"
FT                   /locus_tag="Cfla_0379"
FT   misc_feature    complement(order(409512..409520,409572..409574,
FT                   409614..409622))
FT                   /note="DNA binding residues"
FT                   /db_xref="CDD:133382"
FT                   /locus_tag="Cfla_0379"
FT   misc_feature    complement(409509..409511)
FT                   /note="drug binding residues; other site"
FT                   /db_xref="CDD:133382"
FT                   /locus_tag="Cfla_0379"
FT   misc_feature    complement(order(409380..409382,409392..409394,
FT                   409425..409427,409452..409457,409467..409469,
FT                   409476..409478))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:133382"
FT                   /locus_tag="Cfla_0379"
FT   misc_feature    complement(408675..>409226)
FT                   /note="Beta clamp domain.  The beta subunit (processivity
FT                   factor) of DNA polymerase III holoenzyme, refered to as the
FT                   beta clamp, forms a ring shaped dimer that encircles dsDNA
FT                   (sliding clamp) in bacteria.  The beta-clamp is
FT                   structurally similar to the...; Region: beta_clamp;
FT                   cl02940"
FT                   /db_xref="CDD:121678"
FT                   /locus_tag="Cfla_0379"
FT   misc_feature    complement(order(408675..408683,408807..408809,
FT                   409152..409163,409167..409169))
FT                   /note="beta-clamp/clamp loader binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Cfla_0379"
FT   misc_feature    complement(order(408675..408683,408798..408800,
FT                   408831..408836,408873..408875,408957..408959,
FT                   409158..409163,409167..409169))
FT                   /note="beta-clamp/translesion DNA polymerase binding
FT                   surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Cfla_0379"
FT   gene            complement(409674..410888)
FT                   /db_xref="GeneID:9144246"
FT                   /locus_tag="Cfla_0380"
FT   CDS_pept        complement(409674..410888)
FT                   /locus_tag="Cfla_0380"
FT                   /gene_family="HOG000269148" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /codon_start="1"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /transl_table="11"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   stp:Strop_3945 major facilitator transporter"
FT                   /db_xref="GI:296128246"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="GeneID:9144246"
FT                   /translation="MNVDAPARALPRPYLAWLGGFTVGRFGEAVLAFALGWAASGLGGT
FT                   TAALVLTLHGVPRLVLLVVGGAVADRVGARRLLVAGEAALLVATALLALTLARWGPATW
FT                   ALLTSSLVLGAVTALCLPASGSMPRRLVPDEQLPRALALRQGVGQVVLMAAAPLGGVLV
FT                   GATGLAAVAWGAAVLVGVSLVVLVAVRELPGPTTVATVGAPRLGLAEGWRVVVATPLLR
FT                   RALPLAGAGAALALPVPSLLVPLLGRASGWGPGPTGLVAGAVGVGAICAALHAARRRAP
FT                   AGAGTVASAATGLAVSAVGAALLTAGSGADGSALVVSVVGGATSGVGNGMFAARLAPVL
FT                   LGAAPRTHLARVQALVSLGQLVPALVTTTVLGALAERASPGWALGVVALGLASCATWAR
FT                   RSSTA"
FT                   /protein_id="YP_003635496.1"
FT   gene            complement(410922..412001)
FT                   /db_xref="GeneID:9144247"
FT                   /locus_tag="Cfla_0381"
FT   CDS_pept        complement(410922..412001)
FT                   /locus_tag="Cfla_0381"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Tcur_4207"
FT                   /codon_start="1"
FT                   /product="tetratricopeptide TPR_4"
FT                   /transl_table="11"
FT                   /note="KEGG: tetratricopeptide TPR_4"
FT                   /db_xref="GI:296128247"
FT                   /db_xref="GeneID:9144247"
FT                   /translation="MVTGADVREILRTASALPFGRSRTQLVEEAVRAAEDVGDAVLLTQ
FT                   ARLDLHEACHLGGERRKSLLPFSQVLRDYDAATHHFSRALTDRVLWQSKWAASTLTGFP
FT                   EVPLGHTEQLLEAMEARARAAGHGVQAVAWSRVNLTWRVHGAAAAQEQFRRWRTLPRDA
FT                   TSDCLACELSATAELLHDLGDDEAGLEVSARVRCRDVTCDTQPQRALGAALLPLVRTGR
FT                   LAEAADHHRRCLSGVRGRSLSHMVLAQNLLFLALTGNEARGVELLQSQIAAIDVITYQL
FT                   EAAVARLLSGATARTGDGIVLTLSDGEQMSAEDLARRSVDAARREGEKFDARNGTTTVS
FT                   ERIEQVLAASPLPHVPLPA"
FT                   /protein_id="YP_003635497.1"
FT   gene            complement(412045..412206)
FT                   /db_xref="GeneID:9144248"
FT                   /locus_tag="Cfla_0382"
FT   CDS_pept        complement(412045..412206)
FT                   /locus_tag="Cfla_0382"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:296128248"
FT                   /db_xref="GeneID:9144248"
FT                   /translation="MQHPADRRRTPPVPRARVIVPSDDDRRPVDLELSAEVHRSLGPFR
FT                   HQYCFENR"
FT                   /protein_id="YP_003635498.1"
FT   gene            complement(412249..413454)
FT                   /db_xref="GeneID:9144249"
FT                   /locus_tag="Cfla_0383"
FT   CDS_pept        complement(412249..413454)
FT                   /locus_tag="Cfla_0383"
FT                   /gene_family="HOG000097231" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00652"
FT                   /codon_start="1"
FT                   /product="Ricin B lectin"
FT                   /transl_table="11"
FT                   /note="KEGG: ami:Amir_3108 ricin B lectin; PFAM: Ricin B
FT                   lectin; lipolytic protein G-D-S-L family; SMART: Ricin B
FT                   lectin"
FT                   /db_xref="GI:296128249"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR008997"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="GeneID:9144249"
FT                   /translation="MHRLARGLLLAVTLGVALAGGVVAPSAPAAAESNGGTRVMPLGDS
FT                   ITEGIGMSGGGGYRVGLWQRLAQGGYTTDFVGSGFNGPSSLWDHDHEGHSGWRIDQIDA
FT                   NIVNWVRTYQPRTVLLHIGTNDISQNRDLGNAPNRLAGVIDKITSTSPQTDVFVATLIP
FT                   VSYAQSQVQAYNSAIPGIVSSRANAGKKVHLVNMNGAVPLSDMPDGVHPNAAGYDKMAA
FT                   VWYNALRSVPGSIGNPSGGTTPTPTPTPTPDPGTGQVDTSAWYTLVNRNSGKAIDVYNL
FT                   STADGARITQWSRNGGTQQQWQFVSVGNGYYQVKSRLSGKLLDVSGRSTTDGAAIHQWT
FT                   NHGGTNQQFSLQTIDGYVQLIARNSGKAVEVQGASTADGGNIVQYTDWNGTNQQWQLVK
FT                   VG"
FT                   /protein_id="YP_003635499.1"
FT   misc_feature    complement(412771..413343)
FT                   /note="SGNH_hydrolase subfamily, similar to Ruminococcus
FT                   flavefaciens XynB. Most likely a secreted hydrolase with
FT                   xylanase activity. SGNH hydrolases are a diverse family of
FT                   lipases and esterases. The tertiary fold of the enzyme is
FT                   substantially different from...; Region: XynB_like;
FT                   cd01833"
FT                   /db_xref="CDD:58510"
FT                   /locus_tag="Cfla_0383"
FT   misc_feature    complement(order(412822..412824,412831..412833,
FT                   413080..413082,413176..413178,413320..413322))
FT                   /note="active site"
FT                   /db_xref="CDD:58510"
FT                   /locus_tag="Cfla_0383"
FT   misc_feature    complement(order(412822..412824,412831..412833,
FT                   413320..413322))
FT                   /note="catalytic triad; other site"
FT                   /db_xref="CDD:58510"
FT                   /locus_tag="Cfla_0383"
FT   misc_feature    complement(order(413080..413082,413167..413169,
FT                   413320..413322))
FT                   /note="oxyanion hole; other site"
FT                   /db_xref="CDD:58510"
FT                   /locus_tag="Cfla_0383"
FT   misc_feature    complement(412270..412662)
FT                   /note="Ricin-type beta-trefoil; Carbohydrate-binding domain
FT                   formed from presumed gene triplication. The domain is found
FT                   in a variety of molecules serving diverse functions such as
FT                   enzymatic activity, inhibitory toxicity and signal
FT                   transduction. Highly...; Region: RICIN; cd00161"
FT                   /db_xref="CDD:29101"
FT                   /locus_tag="Cfla_0383"
FT   misc_feature    complement(order(412276..412278,412300..412302,
FT                   412306..412308,412345..412347,412411..412416,
FT                   412438..412440,412444..412446,412483..412485,
FT                   412555..412560,412579..412581,412585..412587,
FT                   412624..412626))
FT                   /note="putative sugar binding sites; other site"
FT                   /db_xref="CDD:29101"
FT                   /locus_tag="Cfla_0383"
FT   misc_feature    complement(order(412270..412278,412405..412413,
FT                   412549..412557))
FT                   /note="Q-X-W motif; other site"
FT                   /db_xref="CDD:29101"
FT                   /locus_tag="Cfla_0383"
FT   gene            complement(413611..413994)
FT                   /db_xref="GeneID:9144250"
FT                   /locus_tag="Cfla_0384"
FT   CDS_pept        complement(413611..413994)
FT                   /locus_tag="Cfla_0384"
FT                   /gene_family="HOG000144506" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /transl_table="11"
FT                   /note="KEGG: bcv:Bcav_2665 transcriptional regulator, ArsR
FT                   family; PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR"
FT                   /db_xref="GI:296128250"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="GeneID:9144250"
FT                   /translation="MHGKMAPVTADPLPPATPPATDACCAPLTRAAADPETARELARTF
FT                   KALGDPARVQLLSLVAAHQDGEACVCDLTGPVGLAQPTVSHHLKVLVDAGLLTREQRGR
FT                   WAYYSLAPGSLDHVAHGLRLVAR"
FT                   /protein_id="YP_003635500.1"
FT   misc_feature    complement(413614..413862)
FT                   /note="Arsenical Resistance Operon Repressor and similar
FT                   prokaryotic, metal regulated homodimeric repressors. ARSR
FT                   subfamily of helix-turn-helix bacterial transcription
FT                   regulatory proteins (winged helix topology). Includes
FT                   several proteins that appear to...; Region: HTH_ARSR;
FT                   cd00090"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Cfla_0384"
FT   misc_feature    complement(order(413617..413625,413629..413637,
FT                   413641..413646,413710..413712,413800..413802,
FT                   413818..413823,413830..413835,413842..413844,
FT                   413851..413853,413857..413862))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Cfla_0384"
FT   misc_feature    complement(order(413671..413679,413692..413700,
FT                   413716..413721,413725..413730,413737..413742,
FT                   413746..413757,413782..413790,413836..413844,
FT                   413854..413859))
FT                   /note="putative DNA binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Cfla_0384"
FT   misc_feature    complement(order(413644..413646,413779..413781,
FT                   413788..413790))
FT                   /note="putative Zn2+ binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Cfla_0384"
FT   gene            414056..415462
FT                   /db_xref="GeneID:9144251"
FT                   /locus_tag="Cfla_0385"
FT   CDS_pept        414056..415462
FT                   /locus_tag="Cfla_0385"
FT                   /gene_family="HOG000236827" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /codon_start="1"
FT                   /product="FAD dependent oxidoreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   bcv:Bcav_2664 FAD dependent oxidoreductase"
FT                   /db_xref="GI:296128251"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="GeneID:9144251"
FT                   /translation="MAEVVRAELPVVVIGAGPVGLAAAAHLLERGLEPLVLEAGEQAGA
FT                   AVASWEHVRLFSPWRYDVDAAARRLLEQTGWVAPDADALPTGGDLVRDYLAPLAATPAI
FT                   ASRLRTSTRVLAVARDGADKTRTLGRDRRGYRVRTLTPDGQVQDVLARAVVDASGTYAT
FT                   SNPLGASGLPAVGEREAAGFVTGPLPDVLGAQRERFAGRHTLVVGMGHSAANTLLSLVE
FT                   LAESEPGTTITWAIRGGSARRLFGGGTADELPARGLLGTRLKDAVDAGRLALLTRVSIE
FT                   RLVPGGDTVQVLGRARDEPLDLQVHAVVNATGFRPDLDMLREVRLDLDPVVESPARLAE
FT                   LIDPNFHSCGTVPPHGEALLSHPDDGFYLVGMKSYGRAPTFLLATGYEQVRSVAAALAG
FT                   DRAGADAVELDLPETGVCSTDLAADGGGCCGSAPEPQLLALGVGAPAGTGFATGVVHGR
FT                   SGDEPESGRA"
FT                   /protein_id="YP_003635501.1"
FT   misc_feature    414056..>415030
FT                   /note="Predicted flavoprotein involved in K+ transport
FT                   [Inorganic ion transport and metabolism]; Region: TrkA;
FT                   COG2072"
FT                   /db_xref="CDD:32255"
FT                   /locus_tag="Cfla_0385"
FT   misc_feature    414086..>414208
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="Cfla_0385"
FT   gene            415459..415980
FT                   /db_xref="GeneID:9144252"
FT                   /locus_tag="Cfla_0386"
FT   CDS_pept        415459..415980
FT                   /locus_tag="Cfla_0386"
FT                   /gene_family="HOG000078516" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.3.1.183"
FT                   /codon_start="1"
FT                   /product="Phosphinothricin acetyltransferase"
FT                   /transl_table="11"
FT                   /note="KEGG: ami:Amir_3361 GCN5-related N-
FT                   acetyltransferase; PFAM: GCN5-related N-acetyltransferase"
FT                   /db_xref="GI:296128252"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="GeneID:9144252"
FT                   /translation="MSVQVRAAADGDVAAVARIYDHYVATSTATFELEPPGEPVWRGRL
FT                   DTLTAAGWPFQVAVLDGQVAGFAYVGPWRPRPAYAHTVEDTIYLDPAATGRGVGTRLLT
FT                   SVLDAAGAAGAREVIAVVADGDTAASLALHRRAGFHTAGRLERVGRKFDRWLGTTLLQK
FT                   TLGQETLPGS"
FT                   /protein_id="YP_003635502.1"
FT   misc_feature    415513..415923
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:176420"
FT                   /locus_tag="Cfla_0386"
FT   gene            complement(416042..416494)
FT                   /db_xref="GeneID:9144253"
FT                   /locus_tag="Cfla_0387"
FT   CDS_pept        complement(416042..416494)
FT                   /locus_tag="Cfla_0387"
FT                   /gene_family="HOG000273093" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01451"
FT                   /codon_start="1"
FT                   /product="Protein-tyrosine phosphatase, low molecular
FT                   weight"
FT                   /transl_table="11"
FT                   /note="KEGG: jde:Jden_0366 protein-tyrosine phosphatase,
FT                   low molecular weight; PFAM: Protein-tyrosine phosphatase,
FT                   low molecular weight; SMART: Protein-tyrosine phosphatase,
FT                   low molecular weight"
FT                   /db_xref="GI:296128253"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="GeneID:9144253"
FT                   /translation="MTDIAPSTATDSATTRPSVLFVCVHNAGRSQMAAGWLRHLSGGAV
FT                   EVRSAGSMPADRINPAAVDAMLEEGVDIRAEQPKVLTHEAVEASDVVVTMGCGDACPFY
FT                   PGKRYEDWKLEDPAGQGLDAVRPIRDEIRTRVLTLLAELGVEPVHA"
FT                   /protein_id="YP_003635503.1"
FT   misc_feature    complement(416072..416446)
FT                   /note="Low molecular weight phosphatase family; Region:
FT                   LMWPc; cd00115"
FT                   /db_xref="CDD:29014"
FT                   /locus_tag="Cfla_0387"
FT   misc_feature    complement(416069..416443)
FT                   /note="Low molecular weight phosphotyrosine protein
FT                   phosphatase; Region: LMWPc; pfam01451"
FT                   /db_xref="CDD:144880"
FT                   /locus_tag="Cfla_0387"
FT   misc_feature    complement(order(416405..416413,416417..416422,
FT                   416426..416428))
FT                   /note="active site"
FT                   /db_xref="CDD:29014"
FT                   /locus_tag="Cfla_0387"
FT   gene            complement(416491..417540)
FT                   /db_xref="GeneID:9144254"
FT                   /locus_tag="Cfla_0388"
FT   CDS_pept        complement(416491..417540)
FT                   /locus_tag="Cfla_0388"
FT                   /gene_family="HOG000101831" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01451"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /transl_table="11"
FT                   /note="KEGG: bcv:Bcav_2662 transcriptional regulator, ArsR
FT                   family; PFAM: Protein-tyrosine phosphatase, low molecular
FT                   weight; regulatory protein ArsR; SMART: regulatory protein
FT                   ArsR; Protein-tyrosine phosphatase, low molecular weight"
FT                   /db_xref="GI:296128254"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="GeneID:9144254"
FT                   /translation="MSTLSADRPPGPSGSDCTPAPEAHAMGAQAAAQVATVLKALADPL
FT                   RLRMLSFIATSSTGEACVCDIASVADVSQPTVSHHLKVLKDVGVLTSDRRGTWVWYRIS
FT                   SDVRGAVTALLDSFAPAALDAAQHRSRPLSGLRDVDAVLTRVADELAPRFPGLDEDLVL
FT                   RTVRESYAALSRGAGVNAHLVPTARRFAVQRLADITRATRTDPPRVPQVLFVCVANAGR
FT                   SQLAAALLHHHAGAAVVVRSAGSAPAADVHAAVRPLLAELGTDAEAVFPKPLTDDAVRA
FT                   ADVVITMGCGDTCPVLPGKRYEDWVVGDPALASPEGVAAIRDDLDARVRALLADLLTTT
FT                   VDRPEEHPR"
FT                   /protein_id="YP_003635504.1"
FT   misc_feature    complement(417217..417414)
FT                   /note="Arsenical Resistance Operon Repressor and similar
FT                   prokaryotic, metal regulated homodimeric repressors. ARSR
FT                   subfamily of helix-turn-helix bacterial transcription
FT                   regulatory proteins (winged helix topology). Includes
FT                   several proteins that appear to...; Region: HTH_ARSR;
FT                   cd00090"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Cfla_0388"
FT   misc_feature    complement(order(417238..417246,417259..417267,
FT                   417283..417288,417292..417297,417304..417309,
FT                   417313..417324,417349..417357,417403..417411))
FT                   /note="putative DNA binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Cfla_0388"
FT   misc_feature    complement(order(417217..417219,417346..417348,
FT                   417355..417357))
FT                   /note="putative Zn2+ binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Cfla_0388"
FT   misc_feature    complement(416590..416916)
FT                   /note="Low molecular weight phosphatase family; Region:
FT                   LMWPc; cl00105"
FT                   /db_xref="CDD:174001"
FT                   /locus_tag="Cfla_0388"
FT   gene            complement(417537..418643)
FT                   /db_xref="GeneID:9144255"
FT                   /locus_tag="Cfla_0389"
FT   CDS_pept        complement(417537..418643)
FT                   /locus_tag="Cfla_0389"
FT                   /gene_family="HOG000112302" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00832"
FT                   /codon_start="1"
FT                   /product="arsenical-resistance protein"
FT                   /transl_table="11"
FT                   /note="KEGG: jde:Jden_0368 arsenical-resistance protein;
FT                   TIGRFAM: arsenical-resistance protein; PFAM: Bile
FT                   acid:sodium symporter"
FT                   /db_xref="GI:296128255"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="GeneID:9144255"
FT                   /translation="MTHTAAAPGSVGTPRLSTLDRWLPAWIGLAMLAGLALGRFVPALA
FT                   DVLARLEVGGISLPIGLGLLVMMYPVLAKVRYDRVGAVTGDTRLLVSSLALNWVLGPAL
FT                   MFALAWVFLPDLPEYRTGLIVVGLARCIAMVVIWNDLACGDREAAAVLVAINSVFQVVA
FT                   FSLLGWFYLTVLPGWLGLDTQGLDVSVGQIAVNVLVFLGIPLAAGFASRAIGERTRGRD
FT                   WYESRFVPRIGPWALYGLLFTIVLLFALQGDAVTRNPLDVARIALPLLVYFAVMWALGL
FT                   ATGKALRLGYARSTTLAFTAAGNNFELAIAVAIGTFGATSGQALAGVVGPLIEVPVLVG
FT                   LVYVSLWAARRWFATDPRATPHGQEVTS"
FT                   /protein_id="YP_003635505.1"
FT   misc_feature    complement(417609..418598)
FT                   /note="Membrane transport protein; Region: Mem_trans;
FT                   cl09117"
FT                   /db_xref="CDD:164125"
FT                   /locus_tag="Cfla_0389"
FT   gene            418740..419882
FT                   /db_xref="GeneID:9144256"
FT                   /locus_tag="Cfla_0390"
FT   CDS_pept        418740..419882
FT                   /locus_tag="Cfla_0390"
FT                   /gene_family="HOG000219690" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08541"
FT                   /codon_start="1"
FT                   /product="3-Oxoacyl-(acyl-carrier-protein (ACP)) synthase
FT                   III domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III domain protein; KEGG: bbr:BB0106
FT                   3-oxoacyl-(acyl carrier protein) synthase"
FT                   /db_xref="GI:296128256"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR016038"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="GeneID:9144256"
FT                   /translation="MTTTARAYLTGFGRYLPGPPVDNDGMAARLGGDDAVTARIRSSIL
FT                   ASNGIRQRHYALDEHGEPTELNEELAVKALTAALDDRGIAPSDLRMLATATTLGDVLVP
FT                   GFANMVHGRLGGGPMQLLSASGVCASSMAALDAVVSKVRLGDHPRGAVVASELPSRSLR
FT                   QRRYDGFRAGMDAHFLRWMLSDGAGAVVVEFQPHPTRLSLRVDWIRQVSLAHDHAVCMR
FT                   AGMSGDATHVGGTWQDVALADAQAAGMFVLRQDVGMLDDLAQAGIAQFEELVDIGLVDV
FT                   RHLDHVICHYSTNVFRDVAFDALRRRIPTLDTDRWFSNLETRGNTGSASIFIALEEAWR
FT                   TGRFQPGETVLLAVPESGRFSFAFAQLTVVAPTRPQGASS"
FT                   /protein_id="YP_003635506.1"
FT   misc_feature    418755..419849
FT                   /note="3-oxoacyl-(acyl carrier protein) synthase III;
FT                   Reviewed; Region: PRK06816"
FT                   /db_xref="CDD:168686"
FT                   /locus_tag="Cfla_0390"
FT   misc_feature    418758..419834
FT                   /note="'initiating' condensing enzymes are a subclass of
FT                   decarboxylating condensing enzymes, including beta-ketoacyl
FT                   [ACP] synthase, type III and polyketide synthases, type
FT                   III, which include chalcone synthase and related enzymes.
FT                   They are characterized by...; Region: init_cond_enzymes;
FT                   cd00827"
FT                   /db_xref="CDD:29414"
FT                   /locus_tag="Cfla_0390"
FT   misc_feature    order(419028..419030,419034..419036,419061..419063,
FT                   419070..419072,419094..419111,419136..419138,
FT                   419145..419150,419157..419162,419250..419252,
FT                   419373..419384,419418..419423,419811..419813)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29414"
FT                   /locus_tag="Cfla_0390"
FT   misc_feature    order(419121..419123,419604..419606,419712..419714)
FT                   /note="active site"
FT                   /db_xref="CDD:29414"
FT                   /locus_tag="Cfla_0390"
FT   gene            419879..420580
FT                   /db_xref="GeneID:9144257"
FT                   /locus_tag="Cfla_0391"
FT   CDS_pept        419879..420580
FT                   /locus_tag="Cfla_0391"
FT                   /gene_family="HOG000025430" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Cpin_2173"
FT                   /codon_start="1"
FT                   /product="3-oxoacyl-(acyl-carrier-protein (ACP)) synthase
FT                   III domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cpi:Cpin_2173 3-oxoacyl-(acyl-carrier-protein
FT                   (ACP)) synthase III domain protein"
FT                   /db_xref="GI:296128257"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="GeneID:9144257"
FT                   /translation="MTSATSTDSATDTAAGGASLLERLGDVWLELEDHLAKVPVLQRLD
FT                   DGTVTLEDYLRLLFNLRQQVIDGSLWIARAASNFDIDHFELRAAAIKHAEEEHRDHFLL
FT                   EADYVALGGSRAELRAGRKNVGSEALSGYLFTYASRPNPAGLLGAMFIIEGLGARRAAQ
FT                   WAARFQEVLGLADNQVHFMTYHQEADGAHTGDMEAILTSGLIDDATADEIVRCAQVVAR
FT                   LYALQLEELDR"
FT                   /protein_id="YP_003635507.1"
FT   misc_feature    419936..420574
FT                   /note="Heme oxygenase catalyzes the rate limiting step in
FT                   the degradation of heme to bilirubin, it is essential for
FT                   recycling of iron from heme. Heme is used as a substrate
FT                   and cofactor for its own degradation to biliverdin, iron,
FT                   and carbon monoxide. This...; Region: HemeO; cl00172"
FT                   /db_xref="CDD:174016"
FT                   /locus_tag="Cfla_0391"
FT   misc_feature    order(419951..419953,419960..419962,419972..419974,
FT                   420329..420331,420356..420358,420368..420370,
FT                   420455..420457,420539..420541)
FT                   /note="heme binding pocket; other site"
FT                   /db_xref="CDD:29310"
FT                   /locus_tag="Cfla_0391"
FT   misc_feature    419972..419974
FT                   /note="heme ligand; other site"
FT                   /db_xref="CDD:29310"
FT                   /locus_tag="Cfla_0391"
FT   gene            420582..421433
FT                   /db_xref="GeneID:9144258"
FT                   /locus_tag="Cfla_0392"
FT   CDS_pept        420582..421433
FT                   /locus_tag="Cfla_0392"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Daci_1689"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: dac:Daci_1689 hypothetical protein"
FT                   /db_xref="GI:296128258"
FT                   /db_xref="GeneID:9144258"
FT                   /translation="MAEFVRSDPSMWEAVFADPSVPLDRSVVRQIIDDQRRPSRRWLYP
FT                   FAMVLSRVLVTLIRILKRVLPFRWMPLGAMDFLCVWFLRRCVSPDAVDLLLRHFVIETN
FT                   LVNFIIRNTPVDMEPVRLRPESLSELGDQAVVEHDVNVYDVLIALDVVPLAARDTLDFQ
FT                   QLDVPPLDAERHRRRLLRLDIQTALCFMNIPFSLALSSEEYRRAVHSMRFDDSFLEILA
FT                   VITGDDHFRHWKLAGMSLWMDSNVDVPRMVYRHALVCEYAHAQLVKLAGGQYPRDTAVE
FT                   FD"
FT                   /protein_id="YP_003635508.1"
FT   gene            complement(421497..422402)
FT                   /db_xref="GeneID:9144259"
FT                   /locus_tag="Cfla_0393"
FT   CDS_pept        complement(421497..422402)
FT                   /locus_tag="Cfla_0393"
FT                   /gene_family="HOG000251320" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /codon_start="1"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   fal:FRAAL3884 putative aminoglycoside phosphotransferase"
FT                   /db_xref="GI:296128259"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="GeneID:9144259"
FT                   /translation="MSTTEITADLVRALLRDQHPDLAGLPLREVDGGWGNQMWRLGDEL
FT                   AVRIQRMDTEPDHQLKERRWLPLLAPRLPLPVPVPVRDGAPSARSGKLWTVMTWVPGEP
FT                   LDRASITRGEHAADTLAAFLRALHVHAPADAPASADRGAHPRDCTAGFEHFLGSLDTDA
FT                   IGPAAGDVRAVWDDAVAAPAWERPPVWVHGDLHPANVVVADGTLAGVVDFGDLFAGDPA
FT                   WDLAAAWLLLPSRATARFFDAYAQADEATIRRARGLAALKSLFLVLMGQNGDRGLPGGK
FT                   PAWGPAGRAALARVLHERLR"
FT                   /protein_id="YP_003635509.1"
FT   misc_feature    complement(421626..422327)
FT                   /note="Protein Kinases, catalytic domain; Region: PKc_like;
FT                   cl09925"
FT                   /db_xref="CDD:175044"
FT                   /locus_tag="Cfla_0393"
FT   misc_feature    complement(421635..422324)
FT                   /note="Phosphotransferase enzyme family; Region: APH;
FT                   pfam01636"
FT                   /db_xref="CDD:145007"
FT                   /locus_tag="Cfla_0393"
FT   misc_feature    complement(order(421710..421712,421767..421772,
FT                   421800..421802,421806..421811,421821..421823,
FT                   422103..422114,422169..422171,422259..422261,
FT                   422265..422267,422289..422291,422301..422303))
FT                   /note="active site"
FT                   /db_xref="CDD:88612"
FT                   /locus_tag="Cfla_0393"
FT   misc_feature    complement(order(421710..421712,421821..421823,
FT                   422301..422303))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:88612"
FT                   /locus_tag="Cfla_0393"
FT   misc_feature    complement(order(421767..421772,421800..421802,
FT                   421806..421811,421821..421823,422103..422114,
FT                   422169..422171,422259..422261,422265..422267,
FT                   422289..422291))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:88612"
FT                   /locus_tag="Cfla_0393"
FT   gene            complement(422459..423784)
FT                   /db_xref="GeneID:9144260"
FT                   /locus_tag="Cfla_0394"
FT   CDS_pept        complement(422459..423784)
FT                   /locus_tag="Cfla_0394"
FT                   /gene_family="HOG000233306" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /codon_start="1"
FT                   /product="FAD linked oxidase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   cai:Caci_1824 FAD linked oxidase domain protein"
FT                   /db_xref="GI:296128260"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="GeneID:9144260"
FT                   /translation="MTLSTSSDTLAATLRGRLLLPGSVAFDQAATPWNLAVRQPAAAVV
FT                   EAADADDVVTLVRHARAEGLAVAAQSTGHGATGDVAGTVLLRTGRLDAVTVDPAAGTAR
FT                   VGAGATWAAVQARTAPHGLTGLLGSAPGVGVTGYTLGGGLGWFSRVHGLAAHRVRSFDV
FT                   VGADGEPGTVTATSDPDLFWALRGGGGDLAIVTALEIDLVEVPALTGGGVVWPADRAGA
FT                   VLDAFREVTASAPRELSVWLTRVEPPGAPAMVVVRAAYLGDDVAARTLLRPFDAVGGAL
FT                   TGEVRPVALADVGSITADRPDPTAGLSHAELLTGVDDDALTRLLTSPVGPVTVVQLRHL
FT                   GGALAEADPDDGATGAITEPYLLYALGLAHAPGLAAAVRARLDRLPDDLAHLATGRRPA
FT                   TFLSPGERASAAYSPDALARLQGLKRSRDPHGTIRGAYPLIA"
FT                   /protein_id="YP_003635510.1"
FT   misc_feature    complement(423278..423622)
FT                   /note="FAD binding domain; Region: FAD_binding_4; cl10516"
FT                   /db_xref="CDD:158898"
FT                   /locus_tag="Cfla_0394"
FT   misc_feature    complement(<422927..423619)
FT                   /note="FAD/FMN-containing dehydrogenases [Energy production
FT                   and conversion]; Region: GlcD; COG0277"
FT                   /db_xref="CDD:30625"
FT                   /locus_tag="Cfla_0394"
FT   gene            423892..424746
FT                   /db_xref="GeneID:9144261"
FT                   /locus_tag="Cfla_0395"
FT   CDS_pept        423892..424746
FT                   /locus_tag="Cfla_0395"
FT                   /gene_family="HOG000220478" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /codon_start="1"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /transl_table="11"
FT                   /note="KEGG: sma:SAV_7424 ECF subfamily RNA polymerase
FT                   sigma factor; TIGRFAM: RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: sigma-70 region 2 domain protein;
FT                   Sigma-70 region 4 type 2"
FT                   /db_xref="GI:296128261"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="GeneID:9144261"
FT                   /translation="MTADVLAEQFETLRPHLRTVAHRVLGSAADADDAVQEAWLRAQAA
FT                   GTDGVENLGGWLTTIVGRVSLNLLRSRAARRETGWDTHVPDPVVTLDGPEQQAVASDEL
FT                   GAALLVVLDALTPAERVAFVLHDEFGVPFEDVAPVLEKSVAAARQLASRARRKVRDATP
FT                   VQDDLARRREVVAAYLAASQAADFDALLALLDPDVVLRLDYGTAGVSRLLRGAAAVVAQ
FT                   ARLHSGTVRFSRLAVVNGSAGLATVLDDGRLHAVLAFMVRDGRVAGIDILADPGRLARV
FT                   ELT"
FT                   /protein_id="YP_003635511.1"
FT   misc_feature    423892..424740
FT                   /note="RNA polymerase sigma factor SigJ; Provisional;
FT                   Region: PRK09636"
FT                   /db_xref="CDD:170026"
FT                   /locus_tag="Cfla_0395"
FT   misc_feature    423919..424074
FT                   /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
FT                   /db_xref="CDD:146937"
FT                   /locus_tag="Cfla_0395"
FT   gene            complement(424832..425209)
FT                   /db_xref="GeneID:9144262"
FT                   /locus_tag="Cfla_0396"
FT   CDS_pept        complement(424832..425209)
FT                   /locus_tag="Cfla_0396"
FT                   /gene_family="HOG000128541" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /codon_start="1"
FT                   /product="Rieske (2Fe-2S) iron-sulfur domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Rieske [2Fe-2S] iron-sulphur domain; KEGG:
FT                   nml:Namu_2246 Rieske (2Fe-2S) domain protein"
FT                   /db_xref="GI:296128262"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="GeneID:9144262"
FT                   /translation="MSAGTDAPAVAHVVGPLSEIPLGEGRAYAVDGRQVAVFRLRSGAL
FT                   RALDAVCPHRGGPLADGQIDAEVVVCPLHAHVFDLRSGACRSGQSDVASYDVHVEGDQV
FT                   VVVLPDHEAAVVSYPSGADAP"
FT                   /protein_id="YP_003635512.1"
FT   misc_feature    complement(<424961..425170)
FT                   /note="Rieske domain; a [2Fe-2S] cluster binding domain
FT                   commonly found in Rieske non-heme iron oxygenase (RO)
FT                   systems such as naphthalene and biphenyl dioxygenases, as
FT                   well as in plant/cyanobacterial chloroplast b6f and
FT                   mitochondrial cytochrome bc(1)...; Region: Rieske; cl00938"
FT                   /db_xref="CDD:174471"
FT                   /locus_tag="Cfla_0396"
FT   misc_feature    complement(order(424976..424978,424982..424984,
FT                   424988..424993,424997..424999,425045..425050,
FT                   425054..425056))
FT                   /note="iron-sulfur cluster; other site"
FT                   /db_xref="CDD:58538"
FT                   /locus_tag="Cfla_0396"
FT   misc_feature    complement(order(424982..424984,424988..424990,
FT                   424997..424999,425045..425050,425054..425056))
FT                   /note="[2Fe-2S] cluster binding site; other site"
FT                   /db_xref="CDD:58538"
FT                   /locus_tag="Cfla_0396"
FT   gene            complement(425206..427710)
FT                   /db_xref="GeneID:9144263"
FT                   /locus_tag="Cfla_0397"
FT   CDS_pept        complement(425206..427710)
FT                   /locus_tag="Cfla_0397"
FT                   /gene_family="HOG000196165" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02374"
FT                   /codon_start="1"
FT                   /product="nitrite reductase (NAD(P)H), large subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: art:Arth_3275 nitrite reductase (NAD(P)H),
FT                   large subunit; TIGRFAM: nitrite reductase [NAD(P)H], large
FT                   subunit; PFAM: nitrite and sulphite reductase 4Fe-4S
FT                   region; FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; BFD domain protein [2Fe-2S]-binding domain
FT                   protein; nitrite/sulfite reductase hemoprotein beta-
FT                   component ferrodoxin domain protein"
FT                   /db_xref="GI:296128263"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="GeneID:9144263"
FT                   /translation="MARRRRDDDGRRDLVVVGNGMAGARTVEEILERGGAEQFRITMFG
FT                   EEPYGNYNRIMLSNVLAGLESEDAIFLNSMAWYEENAITLHAGVRVARIDRHARTVRAV
FT                   DGSRTPYDALVLATGSSAFVPDIPGMRTAGRGFHQGVFRFRTLDDTRAMIRYARTHKQA
FT                   VVIGGGLLGLEAARGLQTHGVDVTVVHGPGHLMNQQLDAAGGYVLRRGVEALGISVVTS
FT                   ARTVRVLGEDEVTGVQLADGRVLPCDIVVVAAGIRANSSIAAASGFLVERGIVVDDQMH
FT                   ALDDQGTPDPTVFAVGECVQHRDQVYGLVAPLWEQARVLADVLTGTDPSAQYHGSRTAT
FT                   KLKVAGIDVASMGTTAPERPDDDHIVISEPRRGLYKSVVVRDDRLVGATLVGDLEKVAP
FT                   LIQAFDRGSPLPEDRIALLFDLGTAPAEVGVAELPDETTVCNCNGVSKGTIAACVRGGV
FT                   VSLTGVMDATRAGKGCGSCKTLVGQVVEWAADGAVEIDESASWYVPGVPYPKAELVALI
FT                   REQGLRSVSAVFAALAPGGVEDARSKMGLTSLLRTLWGAEVVDERDGRFINDRVHANIQ
FT                   RDGTFSVVPQMKGGVTSSDQLRRIADVADKHAIPLIKLTGGQRIDLLGVRKEDLPQVWA
FT                   DLDMPSGYAYGKSFRTVKTCVGSDFCRFGLGDSTALGIAIETRYQGLESPAKLKLAVSG
FT                   CPRNCAESYVKDVGVVAVDGGRWEIWVGGAAGAHIRKGDLLTTVDTPQEVMTLTGRFIQ
FT                   YYRETANWLERTYAWVPRLGIEHVRAVVVDDSEGIAAALDAAVQASVDAYRDPWQERDD
FT                   PAEPGQFRTALPLTVLPQVPVR"
FT                   /protein_id="YP_003635513.1"
FT   misc_feature    complement(425281..427671)
FT                   /note="NAD(P)H-nitrite reductase [Energy production and
FT                   conversion]; Region: NirB; COG1251"
FT                   /db_xref="CDD:31443"
FT                   /locus_tag="Cfla_0397"
FT   misc_feature    complement(426985..427224)
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="Cfla_0397"
FT   misc_feature    complement(426244..426402)
FT                   /note="BFD-like [2Fe-2S] binding domain; Region: Fer2_BFD;
FT                   cl01093"
FT                   /db_xref="CDD:174522"
FT                   /locus_tag="Cfla_0397"
FT   misc_feature    complement(425797..425985)
FT                   /note="Nitrite/Sulfite reductase ferredoxin-like half
FT                   domain; Region: NIR_SIR_ferr; pfam03460"
FT                   /db_xref="CDD:146216"
FT                   /locus_tag="Cfla_0397"
FT   gene            complement(427712..430300)
FT                   /db_xref="GeneID:9144264"
FT                   /locus_tag="Cfla_0398"
FT   CDS_pept        complement(427712..430300)
FT                   /locus_tag="Cfla_0398"
FT                   /gene_family="HOG000031440" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00384"
FT                   /codon_start="1"
FT                   /product="molybdopterin oxidoreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: nml:Namu_2244 molybdopterin
FT                   oxidoreductase"
FT                   /db_xref="GI:296128264"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="GeneID:9144264"
FT                   /translation="MRPELASPTAVPGTEPVRTVATHCPYCALQCGMQLHVTQRPGHEQ
FT                   PDVRLTPSDFPTNRGGLCAKGWSAADLLAHPERLTTPLVRTFAGDRSSALREATWDEAL
FT                   DAVAAAVRATQRRYGRDAVGCFGGGGLTNEKAYLLGKFARTVLRTRSIDYNGRWCMSSA
FT                   AAAATRTFGIDRGLPFPVADLALADVLLLVGANPAETMPPLVQHLEAGRERGARHVVVD
FT                   PRTTATARAAHLHLQPRPGTDAALANGLLHLVVRRGWVDEEYVATRTTGFETVRESVTG
FT                   YWPDRVERITGVPARDLEAVAELLGTAATAMVVTARGAEQHASGTATAQAFVNLALALG
FT                   LPGRPGSGYGTLTGQGNGQGGREHGQKADQLPGYRKLADRADRAHVAGVWGVDPTRLPG
FT                   PGVSATEMLRALGTSGGVRTLLLLASNVGVSAPDAGRVTDRLDALDFLVVADLFLSESA
FT                   ARADVVLPVAMWAEEDGTVTNLEGRVLRRRRALDPPPGVRTDLDVLTGIAERLGHGDLM
FT                   TTDAAAAFDELGRASSGGVADYGGITYDRIADEQGVFWPCPDPEHPGTPRLFATRFAHP
FT                   DGLARFFRAEYRDAAERTDAEFPYVLTTGRLMRQYQSGTQTRRVAALAGDEVGPDGSVL
FT                   PHAELHPDLARTCGVVDGEAVQLRTRRGTAVFRARLTTGIRTDTVFVPFHWGGASRANT
FT                   LTDDALDPVSRMPAFKACAVAVTPLAVPATPPTGPTTEHVRAPWPPARPKGLALDSHPT
FT                   FLQGVYALTGKGLAAPTLLDPGLTYTVPDGAVAQTVYFRGGNSADELVVVVLVRDGAPM
FT                   RYFPIGAKSDVHVPLRVVEDLEPGTTLEVHAAGAAGISGVVVVDLGLVEV"
FT                   /protein_id="YP_003635514.1"
FT   misc_feature    complement(428531..430240)
FT                   /note="NasA, and NarB catalyze the reduction of nitrate to
FT                   nitrite. Monomeric Nas is located in the cytoplasm and
FT                   participates in nitrogen assimilation. Dimeric Nap is
FT                   located in the periplasm and is coupled to quinol oxidation
FT                   via a membrane-anchored...; Region:
FT                   MopB_Nitrate-R-NapA-like; cd02754"
FT                   /db_xref="CDD:29450"
FT                   /locus_tag="Cfla_0398"
FT   misc_feature    complement(428171..430237)
FT                   /note="formate dehydrogenase, alpha subunit, archaeal-type;
FT                   Region: Fdh-alpha; TIGR01591"
FT                   /db_xref="CDD:130652"
FT                   /locus_tag="Cfla_0398"
FT   misc_feature    complement(order(429692..429694,430112..430114,
FT                   430208..430210,430220..430225,430229..430231))
FT                   /note="[4Fe-4S] binding site; other site"
FT                   /db_xref="CDD:29450"
FT                   /locus_tag="Cfla_0398"
FT   misc_feature    complement(order(428801..428803,428882..428884,
FT                   428894..428902,428945..428956,429011..429013,
FT                   429023..429028,429236..429241,429338..429340,
FT                   429347..429355,429572..429574,429578..429580,
FT                   429629..429637,429701..429706,429713..429724,
FT                   429824..429826,429836..429838,429911..429913,
FT                   430106..430108))
FT                   /note="molybdopterin cofactor binding site; other site"
FT                   /db_xref="CDD:29450"
FT                   /locus_tag="Cfla_0398"
FT   misc_feature    complement(428171..428515)
FT                   /note="This CD includes formate dehydrogenases (Fdh) H and
FT                   N; nitrate reductases, Nap and Nas; and other related
FT                   proteins. Formate dehydrogenase H is a component of the
FT                   anaerobic formate hydrogen lyase complex  and catalyzes the
FT                   reversible oxidation of...; Region: MopB_CT_Fdh-Nap-like;
FT                   cd00508"
FT                   /db_xref="CDD:30306"
FT                   /locus_tag="Cfla_0398"
FT   misc_feature    complement(order(428171..428176,428222..428224,
FT                   428249..428251,428462..428473,428477..428491))
FT                   /note="molybdopterin cofactor binding site; other site"
FT                   /db_xref="CDD:30306"
FT                   /locus_tag="Cfla_0398"
FT   gene            430487..430846
FT                   /db_xref="GeneID:9144265"
FT                   /locus_tag="Cfla_0399"
FT   CDS_pept        430487..430846
FT                   /locus_tag="Cfla_0399"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gvi:glr0080 putative alpha-mannosidase"
FT                   /db_xref="GI:296128265"
FT                   /db_xref="GeneID:9144265"
FT                   /translation="MGQGRIRAGAALVIALAPALVGCSGTVEGLPGRFVSVDDTGLGDN
FT                   PVEDGWIAALPGVLAEDLWPDVGPAPVPDLGYLDHRIERTDVDSSGGVLAPLGRGGRFG
FT                   LDVPPAPRWSATWRS"
FT                   /protein_id="YP_003635515.1"
FT   gene            431131..431712
FT                   /db_xref="GeneID:9144266"
FT                   /locus_tag="Cfla_0400"
FT   CDS_pept        431131..431712
FT                   /locus_tag="Cfla_0400"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: krh:KRH_20000 hypothetical protein"
FT                   /db_xref="GI:296128266"
FT                   /db_xref="GeneID:9144266"
FT                   /translation="MERRLASGFVLVVVAVMSACTAGAEPPGTTSPVPSAADVSPSPAV
FT                   AGSVTATSTPTVAGPVTAGPGPASTEELTCAAPDEHVLGWLRTRVREDLPASDVVVVEV
FT                   GPGDDPSRTWSVVAARSYSDSWGASEYNPVSYLTTAPDGAVDADWIAIGRALQAPKGSV
FT                   DWSKVSWTGDRLARGQQAQALALSCLDGPR"
FT                   /protein_id="YP_003635516.1"
FT   gene            431812..432036
FT                   /db_xref="GeneID:9144267"
FT                   /locus_tag="Cfla_0401"
FT   CDS_pept        431812..432036
FT                   /locus_tag="Cfla_0401"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN /