(data stored in ACNUC8465 zone)

HOGENOMDNA: CESYM1_1

ID   CESYM1_1; SV 1; empty ; DNA; empty ; UNC; 2045086 BP.
XX
AC   NC_014820;
XX
PR   Project:61411;
XX
DE   Cenarchaeum symbiosum A, complete genome.
XX
OS   Cenarchaeum symbiosum A
OC   Archaea; Thaumarchaeota; Cenarchaeales; Cenarchaeaceae; Cenarchaeum.
XX
RN   [1]
RP   1-2045086
RX   PUBMED; 17114289.
RA   Hallam,S.J., Konstantinidis,K.T., Putnam,N., Schleper,C., Watanabe,Y.,
RA   Sugahara,J., Preston,C., de la Torre,J., Richardson,P.M. and DeLong,E.F.;
RT   "Genomic analysis of the uncultivated marine crenarchaeote Cenarchaeum
RT   symbiosum";
RL   Proc. Natl. Acad. Sci. U.S.A. 103 (48), 18296-18301 (2006)
XX
RN   [2]
RP   1-2045086
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (23-DEC-2010) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-2045086
RA   Copeland,A., Lucas,S., Barry,K., Detter,J.C., Hammon,N., Dalin,E.,
RA   Tice,H., Pitluck,S. and Richardson,P.;
RT   "Direct Submission";
RL   Submitted (31-OCT-2006) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B100, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review.
CC   On Dec 30, 2010 this sequence version replaced gi:171906619.
CC   URL -- http://www.jgi.doe.gov
CC   Source DNA available from Ed DeLong (delong@MIT.EDU)
CC   Contacts: Ed DeLong (delong@MIT.EDU)
CC   Steven Hallam (shallam@interchange.ubc.ca)
CC   Paul Richardson (microbes@cuba.jgi-psf.org).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..2045086
FT                   /note="a-type ribosomal variant"
FT                   /mol_type="genomic DNA"
FT                   /environmental_sample
FT                   /isolation_source="10-20 meters below sea level off the
FT                   coast of Santa Barbara, CA, USA"
FT                   /db_xref="taxon:414004"
FT                   /host="Axinella mexicana, marine sponge"
FT                   /organism="Cenarchaeum symbiosum A"
FT   gene            42..650
FT                   /db_xref="GeneID:6372206"
FT                   /locus_tag="CENSYa_0001"
FT   CDS_pept        42..650
FT                   /locus_tag="CENSYa_0001"
FT                   /gene_family="HOG000104884" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="rieske iron sulfur protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575214"
FT                   /db_xref="GeneID:6372206"
FT                   /translation="MSAQEDQKTGGLSRRDFLKLMGAAGTGLAFAPFVPWGNFMPNPSS
FT                   AALEKVPVELPDGSHANINNYPINHAEVITYPKTGDRVLDEEAFRKWQFIRLPEELGGD
FT                   RQDVTAFRAYSMVCLHLWCLWKYWPNEGRKRGECPCHGSMYDPLTGIAFIGPASLQAPP
FT                   ANVLPQLSFEADTDGALWIAPPVWGVNQNGVVGFGRYIK"
FT                   /protein_id="YP_874957.1"
FT   gene            769..2397
FT                   /db_xref="GeneID:6370182"
FT                   /locus_tag="CENSYa_0002"
FT   CDS_pept        769..2397
FT                   /locus_tag="CENSYa_0002"
FT                   /gene_family="HOG000104895" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytochrome b subunit of the bc complex"
FT                   /transl_table="11"
FT                   /note="COG1290"
FT                   /db_xref="GI:118575215"
FT                   /db_xref="GeneID:6370182"
FT                   /translation="MLTFIVFVILGVSGALLMFYYEPILDRAWDSVEFINDEVPFGFHI
FT                   RNIHYHGSNAMVLLAILHMYYQYFSGRYKIRNEILWVTGVILGTVTILEAFTGYDIIFS
FT                   ERAELAISIAASLTNSIPVMGPTIRDAMFGSGFHDFVLRFYAQHVFILPLVMLGLMAVH
FT                   FPRFLVFDVPMIMAISGAILITGGVFPIDLGFKFEPTVPPGITVPEWYLTGLYAFLRTQ
FT                   YDKFVTGVLWPGIFIASLLLIPFLDRYKKFSWKDRPIVTSFGIVGIAQIIVTTYWGFYI
FT                   PPDVNIPLVERLVIDPIFLYLTMILLVPLGFGFSYMMILMARESERKAKLNKAKGPKKV
FT                   ATIDLSDKWINWVIVALIAFLVFLNIAAYNASITGFQNLSLFWVGLILFVFAAFFHVYR
FT                   YAMGKSRETPAAPPPVPVERPKEIAEPVAETPKLPEKAAEPPVAGKEPPKELIAEVPKA
FT                   KPAGVAGTGAAAPESAKTAPGPGTPDAPGTPDAPGKISADAGPGNQGTPDSPGKVSADA
FT                   GSKNQGTPDVPGKVEADANPENRGK"
FT                   /protein_id="YP_874958.1"
FT   gene            2443..2907
FT                   /db_xref="GeneID:6370183"
FT                   /locus_tag="CENSYa_0003"
FT   CDS_pept        2443..2907
FT                   /locus_tag="CENSYa_0003"
FT                   /gene_family="HOG000104906" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="copper binding protein, plastocyanin/azurin
FT                   family"
FT                   /transl_table="11"
FT                   /note="COG3794"
FT                   /db_xref="GI:118575216"
FT                   /db_xref="GeneID:6370183"
FT                   /translation="MSQVRTGNAYGVGIMTVIVGVTAGAVFYQGFYLPESLEVPSVDEH
FT                   ILHPTADRIIDILVGSALPDQEENFVPKLVDIQLGVDNLVTWTNTDETPHTVTPDHSYA
FT                   DGYSGKFGSDGVLKAGETYEFLFTEPAVIEYHCQPHPWMQGTLSITKQRF"
FT                   /protein_id="YP_874959.1"
FT   gene            complement(2904..3251)
FT                   /db_xref="GeneID:6370184"
FT                   /locus_tag="CENSYa_0004"
FT   CDS_pept        complement(2904..3251)
FT                   /locus_tag="CENSYa_0004"
FT                   /gene_family="HOG000104918" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575217"
FT                   /db_xref="GeneID:6370184"
FT                   /translation="MKEIEIVLGDKEIHAKAEIRGTVSVGYPDRYDGVVINAQIIGSNG
FT                   HVEYKTCNGANVSGNVARLFIDRKAMTDNKAEFTAEIGFEPEEEHDVKFRASIIEQHKE
FT                   VESDIFFGRFS"
FT                   /protein_id="YP_874960.1"
FT   gene            complement(3292..3366)
FT                   /db_xref="GeneID:6370185"
FT                   /locus_tag="CENSYa_0005"
FT   tRNA            complement(3292..3366)
FT                   /db_xref="GeneID:6370185"
FT                   /locus_tag="CENSYa_0005"
FT                   /product="tRNA-Arg"
FT   gene            complement(3428..4918)
FT                   /db_xref="GeneID:6370186"
FT                   /locus_tag="CENSYa_0006"
FT   CDS_pept        complement(3428..4918)
FT                   /locus_tag="CENSYa_0006"
FT                   /gene_family="HOG000104929" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hydrolase of the metallo-beta-lactamase
FT                   superfamily"
FT                   /transl_table="11"
FT                   /note="COG0595"
FT                   /db_xref="GI:118575218"
FT                   /db_xref="GeneID:6370186"
FT                   /translation="MTQLEFYGGIKEIGGNKILVEDKGTRVFLDFGMQMGRANDYFAEF
FT                   MKPRTLNGMGDLFEFDLLPQLDGIYRKDYAKHMGLKHWDSETSVDAVLLSHAHVDHCAY
FT                   IKYLRPEIPVYCTEATKMILQVFDDAGMGEEYITYKRNFGFHKKNGVGIKTIGKKRETK
FT                   PRDIRLIKNLEKFKVGNIEVEPIAIDHSLPGACGFLMHTSSGTLGYTADIRFHGRHPDD
FT                   SQKFVDRCGSEKPDCLLCEGTRIDVPKSDLTEIEIESKARTMMEDTKGLVVCSYPPRDL
FT                   DRMLSFYNAAKAAGRVLAIDTRQAYLLKLFDESEECRGLFPSPKDPSIRVYLSRKKWGL
FT                   IDKDPDYWTKKLVREDYKAWEHEFLSYDNAVDYRDISKKQNDYVFHCSDFKLQELIDVR
FT                   PDEGSRYIRSSTEPFDEEMELDQVRVKRWLGKFGLIGSDNKWETLHVSGHGTHDQIKGV
FT                   IDGSASKMLIPIHTNKEDHFDALHNNVRKVNLGDTLHL"
FT                   /protein_id="YP_874961.1"
FT   gene            complement(4974..5492)
FT                   /db_xref="GeneID:6370187"
FT                   /locus_tag="CENSYa_0007"
FT   CDS_pept        complement(4974..5492)
FT                   /locus_tag="CENSYa_0007"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="prefoldin, chaperonin cofactor"
FT                   /transl_table="11"
FT                   /note="COG1382"
FT                   /db_xref="GI:118575219"
FT                   /db_xref="GeneID:6370187"
FT                   /translation="MELFKQVDRASAPDNPYSDRRFTEFHVPSPYQRYKKTGYSTYSMS
FT                   AGQQVPPWLQEQIMKLQQTQQSLQSLQVQRQQLDMEKNETDKALEELEKTPEDGTVYKH
FT                   AGSVLIKSNKVDMMADLKERKELADTRAKVLEKQVQRVNESLKEQETKINEMIKGGGPG
FT                   GAPPPPPTL"
FT                   /protein_id="YP_874962.1"
FT   gene            5507..7354
FT                   /db_xref="GeneID:6370188"
FT                   /locus_tag="CENSYa_0008"
FT   CDS_pept        5507..7354
FT                   /locus_tag="CENSYa_0008"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575220"
FT                   /db_xref="GeneID:6370188"
FT                   /translation="MYGCAEASGAGVYVRRRLDGYHADRASAVLIISLGVLLASAGYSW
FT                   QQDSWLEGGAPSEAAWDSTPFVPGWAQAFGETIPQRMLDEPAATGDFGCDGRHYQYSDE
FT                   WFTAVLMYQYGEYLGVDPSFVDEHLLAVPGSKIVHSFQQQVGIGSEMNRLDRTMDEIDV
FT                   RLGKINTSIEQLDQDMAKLDARTDRHDSSIKSLDVKMKLLERDAEKIDAAFGEYGEYDR
FT                   IFGRYVIRPAFQDDPVDLRRAMALYVQINDTDKERGLLADEQKRIGDEQQGIIEEKDDL
FT                   NMGSYALTSEQNSLIAEYNLLAAEHDTMNTRYSCIGDTKVQDAHVTKPVAETTAAVQHP
FT                   RDGAHRIAYEDVPGFADGTIEVPALRQAISMWGAYNAGLEFLITESPDVTIVWEKTIPG
FT                   DAVGLHGPVHDGKDIVLRVQMGDYGCDGRYYLYSQDKLADTISHGLGHHLGLGHVITED
FT                   HLMFGANGVGPVAFDSLGYVVPARVEYDRFLLQEELDAVMGGIDRELVGISISLEGVNS
FT                   TLNEMRPEYEEMDAEYKRLSRLYSAYPSDIDEDDDIAYRAAMKLRDQLDDMKEEYERLA
FT                   EDIDGLEDTYDMNVEEQDALNDKHSLLAERHNCINLRET"
FT                   /protein_id="YP_874963.1"
FT   gene            7457..7954
FT                   /db_xref="GeneID:6370189"
FT                   /locus_tag="CENSYa_0009"
FT   CDS_pept        7457..7954
FT                   /locus_tag="CENSYa_0009"
FT                   /gene_family="HOG000104940" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575221"
FT                   /db_xref="GeneID:6370189"
FT                   /translation="MQSKMELITNVLKIRTYAMIAVVGAAGLGTLYYFLTMSMLHLHFG
FT                   PVMEISPWYITTSITLTVVISALAGVNFAMMAYKIRRARMMNSVKSNSSAILGGAFAAF
FT                   TPGCPACTAPLAVILGAVGGLSLFPMQGLELKFISVGALLFSVYWITRNMQNSCCKVKQ
FT                   DI"
FT                   /protein_id="YP_874964.1"
FT   gene            7982..8677
FT                   /db_xref="GeneID:6370190"
FT                   /locus_tag="CENSYa_0010"
FT   CDS_pept        7982..8677
FT                   /locus_tag="CENSYa_0010"
FT                   /gene_family="HOG000104951" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="helicase-associated endonuclease for
FT                   fork-structured DNA"
FT                   /EC_number="2.7.7.-"
FT                   /note="COG1948"
FT                   /db_xref="GI:118575222"
FT                   /db_xref="GeneID:6370190"
FT                   /translation="MRHRMDPPTHRIIVDERERRSGIPDLLKSVDINVEVKTLPIGDYI
FT                   VAHETVVERKSLPDLISSVFDGRLYDQCDRLRENFEHPIILMEGNVDEIDDIIENPLTF
FT                   YGAVSRIALDFKIPIIPTPSAAHTAKLLVSMCLKKDRAAGPFLKKIKKSNDVQKQQLSS
FT                   LSSLPGVGEKLAGRMLEKFGTPLRTFNASSAELSKVAGLGPSRAKKIRKMLDTKSSLHK
FT                   KGNQSTLQE"
FT                   /transl_table="11"
FT                   /protein_id="YP_874965.1"
FT   gene            complement(8668..9255)
FT                   /db_xref="GeneID:6370191"
FT                   /locus_tag="CENSYa_0011"
FT   CDS_pept        complement(8668..9255)
FT                   /locus_tag="CENSYa_0011"
FT                   /gene_family="HOG000223294" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nucleic acid-binding protein"
FT                   /transl_table="11"
FT                   /note="COG1439"
FT                   /db_xref="GI:118575223"
FT                   /db_xref="GeneID:6370191"
FT                   /translation="MCGGGRYLDNVTWVSREHIFKSVLGGVQNRRETATDMIKILDASS
FT                   FYAGVPFGTSDTYHTTPQVFEEVRHIRGRQGVLDTLVGMGRIVIREPGTESLGKARSAA
FT                   EKTGDVHELSAEDLSVLALSIETGGELLTDDFAVSNVAAILGIKIVPIMTAGIKRAGRW
FT                   IRYCPGCKKRFNGVTECPRCGNPLKKKLVSHS"
FT                   /protein_id="YP_874966.1"
FT   gene            9395..10531
FT                   /db_xref="GeneID:6370192"
FT                   /locus_tag="CENSYa_0012"
FT   CDS_pept        9395..10531
FT                   /locus_tag="CENSYa_0012"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575224"
FT                   /db_xref="GeneID:6370192"
FT                   /translation="MNNTILGLVLVATVFLLGNYFAYAQTGEQNSPWIKPFFEDYATGK
FT                   VSDSQMLDYISRLIRNGDVPVFTHGFHDNSAFIYPPEPDDDSDLTINTISWIDPGYAGT
FT                   GDAYNVGNMIEDRGDFYHTYDEHPNSPYPKHSSADTYLRDSKLFESKMDFINAAFRLPH
FT                   DIEISAEECEVENAFWRNGRIVICYELFYGILNDYQHHNFDQSTPQRIYLHDGLDYANT
FT                   VLYFIFYHELAHALIDVYDLPITGLEENAADQFAALIMTYTVDEDGNQIVGRNMLKTVG
FT                   SYYFDRHRYSTENCPVSSPTIHACFHPYWDTHAVDIQRHYNLLCYVYGSDPQNNQNLVD
FT                   LGYLPQDRARGCEHEYKRIDESWRVLLKNYAILPDRTS"
FT                   /protein_id="YP_874967.1"
FT   gene            10539..10727
FT                   /db_xref="GeneID:6370193"
FT                   /locus_tag="CENSYa_0013"
FT   CDS_pept        10539..10727
FT                   /locus_tag="CENSYa_0013"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575225"
FT                   /db_xref="GeneID:6370193"
FT                   /translation="MADRSAVSRIMQLINYELLFRDTCGMPNSIFEAILVLFERRHMPI
FT                   RISILYLLLDNNKLDLI"
FT                   /protein_id="YP_874968.1"
FT   gene            10855..11502
FT                   /db_xref="GeneID:6370194"
FT                   /locus_tag="CENSYa_0014"
FT   CDS_pept        10855..11502
FT                   /locus_tag="CENSYa_0014"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575226"
FT                   /db_xref="GeneID:6370194"
FT                   /translation="MLTIFLSAGSFEAHAQHGESIPSWVRTIFNSYAEDHITDEEMLNI
FT                   IGYLVQIGVIPISQSIIDPGNLYVTYYDNPNPRYDGVSGEVLRSSMILEREVDYINENF
FT                   RLPHDIQIITEECGKKTTYYNNREIVICYEFINDLFYTNFISNEDKYKRDHDSMLKFAA
FT                   TQATSMLTYVIYHELAHALIDMYELPIKNQESAADQFASLVLLHRYGNSGTM"
FT                   /protein_id="YP_874969.1"
FT   gene            11515..11823
FT                   /db_xref="GeneID:6370195"
FT                   /locus_tag="CENSYa_0015"
FT   CDS_pept        11515..11823
FT                   /locus_tag="CENSYa_0015"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575227"
FT                   /db_xref="GeneID:6370195"
FT                   /translation="MDDVIMFYIYKDHWTDFCEHDTQASEICIETYWSGHGSHAYRQSD
FT                   FSCYAYGADPVGNSFMIGYEITAERALECELIYPQIVSYWNHQLYGYTNEPIFVDNG"
FT                   /protein_id="YP_874970.1"
FT   gene            11923..12090
FT                   /db_xref="GeneID:6370196"
FT                   /locus_tag="CENSYa_0016"
FT   CDS_pept        11923..12090
FT                   /locus_tag="CENSYa_0016"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575228"
FT                   /db_xref="GeneID:6370196"
FT                   /translation="MASSPLHVYYLYCLHRKATGMANALWMQGRTAYSGYEMLLLMVVN
FT                   LSCRNRRILQ"
FT                   /protein_id="YP_874971.1"
FT   gene            12121..12525
FT                   /db_xref="GeneID:6370197"
FT                   /locus_tag="CENSYa_0017"
FT   CDS_pept        12121..12525
FT                   /locus_tag="CENSYa_0017"
FT                   /gene_family="HOG000104962" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575229"
FT                   /db_xref="GeneID:6370197"
FT                   /translation="MRTALIAALSVLMVSFGASAMAEDTPATETTSIDGIIGLEKTTLT
FT                   FSAPATNTLPWGYVEGTVDNHVQGHPVIIQMYAEGEATHFAQAGVAEDGSYEYKFRVRS
FT                   IDDGEIIRTFLGDYTVVIYKVVYLDTVSSA"
FT                   /protein_id="YP_874972.1"
FT   gene            complement(12522..13436)
FT                   /db_xref="GeneID:6370198"
FT                   /locus_tag="CENSYa_0018"
FT   CDS_pept        complement(12522..13436)
FT                   /locus_tag="CENSYa_0018"
FT                   /gene_family="HOG000008888" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Fe-S oxidoreductase"
FT                   /transl_table="11"
FT                   /note="COG1032"
FT                   /db_xref="GI:118575230"
FT                   /db_xref="GeneID:6370198"
FT                   /translation="MVGIKGGSIACCSMEYDYPLYRPPSEARSMIFQVTLGCSFNQCSF
FT                   CDMYRSKEYSERPWEQVRSEIDLMARQMPDTKRVFLADGDALNLDTDYMVKIVRHVKES
FT                   FPSLERISCYAMPMNILKKSDDELNRLREAGLDMLYLGVESGSDLVLKKVTKGATSSMI
FT                   SKAVNRGKGAGYVMSCMIILGLGGRTHSEEHIRGTAELINSCSPNYVGALTLYLENGIK
FT                   GEFLEKFGEEFIPVSDEEALRELQNLVGSIETEDSIVFRANHGSNAYNVKGTFPADKEE
FT                   MLKNISWMRSHPEVIRPKGLRGF"
FT                   /protein_id="YP_874973.1"
FT   gene            complement(13553..13798)
FT                   /db_xref="GeneID:6370199"
FT                   /locus_tag="CENSYa_0019"
FT   CDS_pept        complement(13553..13798)
FT                   /locus_tag="CENSYa_0019"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575231"
FT                   /db_xref="GeneID:6370199"
FT                   /translation="MCRGCSMRYICICRILCAVIPGVGARGRPPMPTCHRHLIRDPALF
FT                   HTTCTACRSSGGIQSNGGRCIWSWGKWEQMIFNMQL"
FT                   /protein_id="YP_874974.1"
FT   gene            13798..14151
FT                   /db_xref="GeneID:6370200"
FT                   /locus_tag="CENSYa_0020"
FT   CDS_pept        13798..14151
FT                   /locus_tag="CENSYa_0020"
FT                   /gene_family="HOG000104973" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribonuclease HI"
FT                   /transl_table="11"
FT                   /note="COG0328"
FT                   /db_xref="GI:118575232"
FT                   /db_xref="GeneID:6370200"
FT                   /translation="MAPTIYTDGSGGSESGFGYYIQETGHTFHEKKEGITSNQAEYHAI
FT                   LAVLKAADPAEPLVIYSDSKNTVSQLNHEFAINDNTLRNLAREAWPIMARFASLEIRWV
FT                   PRAENPAGKMLGS"
FT                   /protein_id="YP_874975.1"
FT   gene            14200..16305
FT                   /db_xref="GeneID:6370201"
FT                   /locus_tag="CENSYa_0021"
FT   CDS_pept        14200..16305
FT                   /locus_tag="CENSYa_0021"
FT                   /gene_family="HOG000220089" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acyl-CoA synthetase (NDP forming)"
FT                   /transl_table="11"
FT                   /note="COG1042"
FT                   /db_xref="GI:118575233"
FT                   /db_xref="GeneID:6370201"
FT                   /translation="MAESVFLSPASIAVIGASDKEGSVGRTITSNIMKGFTGTVYPISP
FT                   TRQEVFGKKAFKTVLDVPGNIDLAVIVIKNTFVPAVLEECGKKGIRGAIVITAGFKEVG
FT                   KEGAILEGQLRDIAAKHNMGIIGPNCLGVMNLDPKTMMNATFLKITPKTGHIALVSQSG
FT                   AICAALCEDASAQGIGFSAIISMGNKAAMTEIEVLKMLADHEQTRVIVMYLEDMGDGQE
FT                   FLRVARHITRELKKPILVLKSGRSPEGAKAAMSHTGALMGSDEIYDALLRQSGAIRVDT
FT                   MEELFDYATAFSKQPLPKDGLVIVSNAGGPAIISTDMCSKLGIKMADISSIQKEIDAVI
FT                   PPWGSSRNPVDIVGDADYNRFEGVLDKVLSHPSVGSVISMCTPSGTLDYDGLARVIVKM
FT                   SAKHKKTMLASLMGLDEGTTNRDILSEGGIPYYMYAEGAIQTLYAMLLFVHGTSAEHGS
FT                   IPDYPVDKEAAGKIIRDAIGEGRSSLLEEEGQAVLRAYGLPMPESAAASDPDKAVEAAK
FT                   KIGYPVVMKIISPQITHKSDAGGVKVGISNEQEARAAYSEIIENAKKYDQNAEIKGVLI
FT                   VEMVKGGREMIIGSKQEPGMGPVIMLGMGGIYVEVLKDVTFRLAPITDKEAEEMISGIK
FT                   MHRILDGVRGEKPSDKTALAECMLRLSRLASDFAEIRELDMNPVLVLENGRGCRVLDVR
FT                   IGLGPGE"
FT                   /protein_id="YP_874976.1"
FT   gene            16378..17901
FT                   /db_xref="GeneID:6370202"
FT                   /locus_tag="CENSYa_0022"
FT   CDS_pept        16378..17901
FT                   /locus_tag="CENSYa_0022"
FT                   /gene_family="HOG000016514" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="4-hydroxybutyryl-CoA dehydratase"
FT                   /EC_number="1.14.13.3"
FT                   /note="COG2368"
FT                   /db_xref="GI:118575234"
FT                   /db_xref="GeneID:6370202"
FT                   /translation="MQAITDGDTYIDSLRGRKMKVYLMGELIENYVDHPMIRPSINAVA
FT                   ETYDLAVREPELASVESKLTGRRINRFLHIVESPDDLVMQNKMQRKLGQNTGTCFQRCV
FT                   GMDALNALHSTTYEIDEKHGTTYHKKLLDFIKMIQGENAVIGGAMSDPKGDRSKGPSEQ
FT                   VDPDLYTHIVAKDDKGIYVSGAKAHQTGCINSHWIIIMPTMRLTEDDRDWAVVGAIPAD
FT                   AEGLTYIYGRQSCDTRSMEEGDIDDGNAKFSGQEAMIILDKVFVPWEHIFMNGEYEFAS
FT                   MLVERFTCYHRRSYVCKTGVGDVLIGAAGTIADYNGVPKVSHIREKMIEMTHLNETIYA
FT                   AGIASSYQAQKMKSGVYLNDDMLAQVCKHNVTKFPYEIARLTQDIAGGLMVTLPSEKDF
FT                   RNPETGPLLKKYLVGRKGVDVENRMRILRLIENMTMGRNAVGYLTESMHGAGSPQAQRI
FT                   QIQRQMQLGYKMNLAKNLAGITGDNNEPSEDASYFRRVFKIEKRPPPEE"
FT                   /transl_table="11"
FT                   /protein_id="YP_874977.1"
FT   gene            complement(17915..18889)
FT                   /db_xref="GeneID:6370203"
FT                   /locus_tag="CENSYa_0023"
FT   CDS_pept        complement(17915..18889)
FT                   /locus_tag="CENSYa_0023"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /note="COG0681"
FT                   /db_xref="GI:118575235"
FT                   /db_xref="GeneID:6370203"
FT                   /translation="MMGGKSLKREIIKDGAIFAVGLAIIWIGLPLVFGTQNPFYVVSSG
FT                   SMIPELEVYDVLIVNGNDPFSEVQVGDVIVFNRPSGQDRVIVHRVASIIDENPLTIRTK
FT                   GDANPASIPGTDFPITEEEYIGQVAYVIPQIGYVTRAVMPPINYIILAVIAAVVITQYY
FT                   LKSRKKKEVPEMADVPGPDTAGLFDGEAPRDDPYRDRAGEAGGTEGKEKGDSGWKTASE
FT                   LSGDTGGREKGDPGAKVEGDPEAKAAGESSGEPGVKAESDPGAKAAGESSGEPGVKAES
FT                   DPGAKAAGESSGDTGAKEKGDPGAKAAGESSDTATEDKAEEKR"
FT                   /transl_table="11"
FT                   /protein_id="YP_874978.1"
FT   gene            complement(18917..19720)
FT                   /db_xref="GeneID:6370204"
FT                   /locus_tag="CENSYa_0024"
FT   CDS_pept        complement(18917..19720)
FT                   /locus_tag="CENSYa_0024"
FT                   /gene_family="HOG000104984" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575236"
FT                   /db_xref="GeneID:6370204"
FT                   /translation="MSSEMRLKKLRGSGGYVMANVTDDQQRKANLGGPDLFLAPIGRLE
FT                   ADKITKYSCNTCEKEYEGSPKIEFENSKEEVAENLFLAERGQYICATCGSTIAEYREFE
FT                   KGDEGSDIGKAKPAEGYENVAQPEQQMQTQQGQIQMEPGQHTHPMQDQVEPQVLQEQAQ
FT                   LAQTPKPAPKPAKLTPISGMAVFDGSGVKVGTAGEVCVDQDQKAVLSVTGAAGELVAVE
FT                   WSRVKKIGEIILLGEPGAGSAGKCPGCGFSNKPDSKFCEQCGNQI"
FT                   /protein_id="YP_874979.1"
FT   gene            19871..20203
FT                   /db_xref="GeneID:6370205"
FT                   /locus_tag="CENSYa_0025"
FT   CDS_pept        19871..20203
FT                   /locus_tag="CENSYa_0025"
FT                   /gene_family="HOG000292977" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thiol-disulfide isomerase"
FT                   /transl_table="11"
FT                   /note="COG0526"
FT                   /db_xref="GI:118575237"
FT                   /db_xref="GeneID:6370205"
FT                   /translation="MGITQISDTKSWESDVMNSPTPVFVDFWAEWCGPCRMVTPVVEEL
FT                   ASDYEGKVSFVKVNVDEANELASRYNVFSIPTLALFSKGKIIGQQVGAASKEAYKKMID
FT                   SALEKA"
FT                   /protein_id="YP_874980.1"
FT   gene            20450..21001
FT                   /db_xref="GeneID:6370206"
FT                   /locus_tag="CENSYa_0026"
FT   CDS_pept        20450..21001
FT                   /locus_tag="CENSYa_0026"
FT                   /gene_family="HOG000104995" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575238"
FT                   /db_xref="GeneID:6370206"
FT                   /translation="MSFGEVDTLNMLMERLDTLFNESQGYYEGFLDANTLYKAGKLSDK
FT                   EFFAKMGDYIVAYSALEFLGIKVIFEIKKTLDKASGGATVPTVQSPGGMHGISLGGMAG
FT                   GMPGGMPGAQGQQPRMGTPEAPVGSPPGIVSAGEGFTQPGTLPAPDPSLLPRPQGGSCN
FT                   SCGGPLRENAKFCTKCGART"
FT                   /protein_id="YP_874981.1"
FT   gene            complement(21002..21361)
FT                   /db_xref="GeneID:6370207"
FT                   /locus_tag="CENSYa_0027"
FT   CDS_pept        complement(21002..21361)
FT                   /locus_tag="CENSYa_0027"
FT                   /gene_family="HOG000105006" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575239"
FT                   /db_xref="GeneID:6370207"
FT                   /translation="MEIFDGRKAAEEYMSAHTLTFSTPDLTLKRFAFWLGDMIPAPDNK
FT                   EVMKPRIYSFVEEKDFAPVNVVDEESFSPSGAVRHSSIYGGTGIDSGSDSKFCSECGGK
FT                   MSSVARFCPECGTTQ"
FT                   /protein_id="YP_874982.1"
FT   gene            complement(21381..21590)
FT                   /db_xref="GeneID:6370208"
FT                   /locus_tag="CENSYa_0028"
FT   CDS_pept        complement(21381..21590)
FT                   /locus_tag="CENSYa_0028"
FT                   /gene_family="HOG000097551" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG4895"
FT                   /db_xref="GI:118575240"
FT                   /db_xref="GeneID:6370208"
FT                   /translation="MTITERREVRYGALVSVVTKADQGTGSLTEGIVQDILTRSYSHPR
FT                   GIKVRLRDGRVGRVEKILNQNHYT"
FT                   /protein_id="YP_874983.1"
FT   gene            complement(21587..21718)
FT                   /db_xref="GeneID:6370209"
FT                   /locus_tag="CENSYa_0029"
FT   CDS_pept        complement(21587..21718)
FT                   /locus_tag="CENSYa_0029"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575241"
FT                   /db_xref="GeneID:6370209"
FT                   /translation="MAEGEGKDKFTGPCNSCGRVRWVYTFDDGKEGWCEECHERGGR"
FT                   /protein_id="YP_874984.1"
FT   gene            complement(21779..21853)
FT                   /db_xref="GeneID:6370210"
FT                   /locus_tag="CENSYa_0030"
FT   tRNA            complement(21779..21853)
FT                   /db_xref="GeneID:6370210"
FT                   /locus_tag="CENSYa_0030"
FT                   /product="tRNA-Ala"
FT   gene            21858..23306
FT                   /db_xref="GeneID:6370211"
FT                   /locus_tag="CENSYa_0031"
FT   CDS_pept        21858..23306
FT                   /locus_tag="CENSYa_0031"
FT                   /gene_family="HOG000219146" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.5"
FT                   /note="COG0044"
FT                   /db_xref="GI:118575242"
FT                   /db_xref="GeneID:6370211"
FT                   /translation="MVESPLFLFIYSRNNTPCAGAPAVTYDTVITGSRVALPSGAIQRN
FT                   IVIDEGRIVRITGELPACDEVIDGEGLVSLPGIIDPHMHYGVYSPIDRAAETESRVAAA
FT                   GGVTTMMRMLRLGGSYRESLGEQLEASAMHHHVDYAIHASIFNEQQVKEMEYCARGGAP
FT                   SFKLYMNLGSEAGHVYMDMPPGIDALVEERVEVGNKLVREVMKRAASLGCPVLVHAEDY
FT                   ESCSCGMREAREDGQDGLRAWSESRPPESEVLAISQASAAAREFDCTVYFVHIGSAAAL
FT                   SRIRAERALGTRIFVETCPHYMTLSNDKDGYLAKVMPPIRTSSDVDAVWAAITAGEIDT
FT                   IGTDHVANRLGRKLGDDVWDSLAGFPGAGTLLPLLLSEGVNKNRITLEGLASLTSASAA
FT                   RIFSMNSKGRLEPGADADITMVDLGLERSVSSGLFGGFSDYTVYEGRALKGWPVRTIVR
FT                   GETVSEGLKVTGKPGYGRPAARHM"
FT                   /transl_table="11"
FT                   /protein_id="YP_874985.1"
FT   gene            23631..24401
FT                   /db_xref="GeneID:6370212"
FT                   /locus_tag="CENSYa_0032"
FT   CDS_pept        23631..24401
FT                   /locus_tag="CENSYa_0032"
FT                   /gene_family="HOG000235782" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="serine/threonine protein phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="COG0631"
FT                   /db_xref="GI:118575243"
FT                   /db_xref="GeneID:6370212"
FT                   /translation="MDERAIGMLTDRGRVKDANEDSIKAIDIYPEAGCGPFKFLIVADG
FT                   MGGHATGDVASRMAVDSIFHAVQSRLSKGTPPASALKESIQEANQKLLEYAGRNPESAG
FT                   MGTTAVCALVKDRDVHVANIGDSRAYVINNEGIRQVTRDHSYVQELVDKGSITEEEARS
FT                   HPAKNVITKAIGIAAVAEPDMITLTMDDGESLLLCCDGVIAHLEDDEIREFMRGSGPQE
FT                   ACKRIVDTANKRGGTDNISLIAFSPMRSGPQDRA"
FT                   /transl_table="11"
FT                   /protein_id="YP_874986.1"
FT   gene            24575..25207
FT                   /db_xref="GeneID:6370213"
FT                   /locus_tag="CENSYa_0033"
FT   CDS_pept        24575..25207
FT                   /locus_tag="CENSYa_0033"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="copper binding protein, plastocyanin/azurin
FT                   family"
FT                   /transl_table="11"
FT                   /note="COG3794"
FT                   /db_xref="GI:118575244"
FT                   /db_xref="GeneID:6370213"
FT                   /translation="MVSTDKVAVFWTIALVAGLVAFTFMAAEEQSMRMSQPATMMERER
FT                   TMGSESTGSMMEESGMMDDSMMGDSMMDDMMGDSMMDDMMGDSMASGGNADMRDTMMDD
FT                   SMTGGSMMVISVSIPEGTSSPGCEVSGNCYIPSAISINRGDTVVWTNDDSGSHTVTSGD
FT                   TRNGPDGEFDSSLISGGDDYAVTFDTPGTYDYYCLVHPWQSGVVEVS"
FT                   /protein_id="YP_874987.1"
FT   gene            complement(25253..25930)
FT                   /db_xref="GeneID:6370214"
FT                   /locus_tag="CENSYa_0034"
FT   CDS_pept        complement(25253..25930)
FT                   /locus_tag="CENSYa_0034"
FT                   /gene_family="HOG000276369" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /note="COG0120"
FT                   /db_xref="GI:118575245"
FT                   /db_xref="GeneID:6370214"
FT                   /translation="MTALEDAFRAISADALNMVKDGQVIGLGSGRAAAVLVRELASRAR
FT                   SERMNITGVPTSLQIRLVAEECGISLRDPGDTDKIDIVFDGADQVDRQGNLIKGGGGAL
FT                   LTESILIGMADKVVIIADESKFAEHLDAPVPVEVHPAARRSAAESVMRLGGKPVLRLLD
FT                   RGFPLFTENRNLVLDCSFGTITDPSTLRDKLTDIPGVAEAGIITRRPDTTYRAKTDGGF
FT                   DAI"
FT                   /transl_table="11"
FT                   /protein_id="YP_874988.1"
FT   gene            complement(25927..26514)
FT                   /db_xref="GeneID:6370215"
FT                   /locus_tag="CENSYa_0035"
FT   CDS_pept        complement(25927..26514)
FT                   /locus_tag="CENSYa_0035"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575246"
FT                   /db_xref="GeneID:6370215"
FT                   /translation="MLSGRSRQEPAGRIRMLKMEADILAKSIARLHQHDTGLSPEKEDR
FT                   LIARYRAQLRTASGEIERLEDSMQFDIGSLKDGLAKIVESRFTALDEKLHELSSKMDAM
FT                   AAERRRPEPTVQSSPDVRPADRDVRRPDPIARPDTGTRPEAPTVDITQGAVGTESGQTN
FT                   SDAAQDESEDDIDELRKRIMNTLKKLDQAEVE"
FT                   /protein_id="YP_874989.1"
FT   gene            complement(26520..26687)
FT                   /db_xref="GeneID:6370216"
FT                   /locus_tag="CENSYa_0036"
FT   CDS_pept        complement(26520..26687)
FT                   /locus_tag="CENSYa_0036"
FT                   /gene_family="HOG000111075" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein L37E"
FT                   /transl_table="11"
FT                   /note="COG2126"
FT                   /db_xref="GI:118575247"
FT                   /db_xref="GeneID:6370216"
FT                   /translation="MVKGTTSMGGFTRKHVHIRCRRCGKNSYHKRHHRCSSCGFPDAKI
FT                   RKYSWVKWYT"
FT                   /protein_id="YP_874990.1"
FT   gene            complement(26696..26932)
FT                   /db_xref="GeneID:6370217"
FT                   /locus_tag="CENSYa_0037"
FT   CDS_pept        complement(26696..26932)
FT                   /locus_tag="CENSYa_0037"
FT                   /gene_family="HOG000223550" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="small nuclear ribonucleoprotein"
FT                   /transl_table="11"
FT                   /note="COG1958"
FT                   /db_xref="GI:118575248"
FT                   /db_xref="GeneID:6370217"
FT                   /translation="MSVDMAVKVLDESINKVVLIKLKGGKAIRGNLLGFDQHMNLLLES
FT                   SEEIPVEGETRTLGTIVVRGDNVVIISPPPATA"
FT                   /protein_id="YP_874991.1"
FT   gene            complement(26994..27704)
FT                   /db_xref="GeneID:6370218"
FT                   /locus_tag="CENSYa_0038"
FT   CDS_pept        complement(26994..27704)
FT                   /locus_tag="CENSYa_0038"
FT                   /gene_family="HOG000111077" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="conserved hypothetical protein, putative amidase"
FT                   /transl_table="11"
FT                   /note="COG1402"
FT                   /db_xref="GI:118575249"
FT                   /db_xref="GeneID:6370218"
FT                   /translation="MNNASDLPDPDLRRMLSGRPAVLPVGSTEQHGAHLPVSTDSDIVS
FT                   EVAYRVSKKCGYLCMPTIQYGVSFEHSPYLNLSLRGATLRHVVRDIISSMASAGAPAVF
FT                   VINGHHGNARHLEGLESKRAPRTRVISYWHYLEEGLDHAGDIETSIMLAISDKVRMSRA
FT                   KKGFVPPELDDTGRERLSKRASRSFIEVTGNGIWGDPRKATAKKGEEMLSRATRAISIE
FT                   CRAWLRAGRNPSRA"
FT                   /protein_id="YP_874992.1"
FT   gene            complement(27701..28543)
FT                   /db_xref="GeneID:6370219"
FT                   /locus_tag="CENSYa_0039"
FT   CDS_pept        complement(27701..28543)
FT                   /locus_tag="CENSYa_0039"
FT                   /gene_family="HOG000033576" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /EC_number="3.5.1.10"
FT                   /note="COG0788"
FT                   /db_xref="GI:118575250"
FT                   /db_xref="GeneID:6370219"
FT                   /translation="MTGTNVGITVVGEDRAGVVTAFTGFVFGHGGNIEKINQDVKNGLF
FT                   GMYLEASFPGTINMDAFGTEIQEIAREYKMEVSTRHEAGPNRNVAVFVTRESHCLKAIL
FT                   DARDELRGRIAVVVGTEGTLSKMAEDAGVPFVEVAEKNQEEAEQRLISTCKKYDIDLIV
FT                   LARYMRILNPNFVWRYPDRIMNIHPSLLPAFTGASAYAQAFERGTKIVGVTAHYVTENL
FT                   DQGPIIFQDSFKVGPADGIEEIKKKGQELEARTLLKAVRMHLEGKLEVRWRRVHVKEQ"
FT                   /transl_table="11"
FT                   /protein_id="YP_874993.1"
FT   gene            complement(28586..28673)
FT                   /db_xref="GeneID:6370220"
FT                   /locus_tag="CENSYa_0040"
FT   tRNA            complement(28586..28673)
FT                   /db_xref="GeneID:6370220"
FT                   /locus_tag="CENSYa_0040"
FT                   /product="tRNA-Leu"
FT   gene            complement(28716..29459)
FT                   /db_xref="GeneID:6370221"
FT                   /locus_tag="CENSYa_0041"
FT   CDS_pept        complement(28716..29459)
FT                   /locus_tag="CENSYa_0041"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575251"
FT                   /db_xref="GeneID:6370221"
FT                   /translation="MITVRERAGRKEITASVTEFTGGLEYCQYMIDFMVKGKRKKPSAA
FT                   AMQGAAIHKGIEKYEQKHVVLEPVSEQQLSNEEHNIEFAREKIMTRLLRPVSVGGTEAA
FT                   VLLMGRADKIMRENSTLIVQDEKTARNAQKYDSLVEPYRGQKLQVLTYLNSMFTEKGSM
FT                   NPDDWFEVPHERKMWRVNVLDREDGLRLYKSFEGYQTDADLEYLNGSLETFVEIVLGKR
FT                   LPDHHNSANKCRACGYFDDCSDRIE"
FT                   /protein_id="YP_874994.1"
FT   gene            complement(29490..29744)
FT                   /db_xref="GeneID:6370222"
FT                   /locus_tag="CENSYa_0042"
FT   CDS_pept        complement(29490..29744)
FT                   /locus_tag="CENSYa_0042"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575252"
FT                   /db_xref="GeneID:6370222"
FT                   /translation="MSEKKASGSKTKAKKKPSKKPAKAAKPKGGTAPKKAEEPKEKKVV
FT                   SLADSGIVIVDEYTEVDQEKVNEERRAYLEEARSQEASD"
FT                   /protein_id="YP_874995.1"
FT   gene            complement(29939..30874)
FT                   /db_xref="GeneID:6370223"
FT                   /locus_tag="CENSYa_0043"
FT   CDS_pept        complement(29939..30874)
FT                   /locus_tag="CENSYa_0043"
FT                   /gene_family="HOG000277368" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG3035"
FT                   /db_xref="GI:118575253"
FT                   /db_xref="GeneID:6370223"
FT                   /translation="MDITFGAPWVLLLLGAIPLLYILYRRHSVAWSPPVRFSSLDIVKK
FT                   AAGGGLRRHLPFVLLVSAIGTGTVGLADPLFPSGQAEGGAGIVLVLDGSGSMAADDYAP
FT                   TRLDAAKAAAAQLVGRLAPGDRVGVILFGSSAITISYLTSDRAEAAGRIGEIVQGDGAT
FT                   ALGDGLALGVEMAAAGPEKSTIILLSDGVHNSGRTVPGEALELAIQGNIRVHTIGMGSD
FT                   EPVRVGDDIFGEPRYAELDEDTLREIADRTGGMYYTSVDNPTLDGIFEALSEDIAGTEG
FT                   HLSASRWFLAGTVSVLLALAFVTYGRFKLG"
FT                   /protein_id="YP_874996.1"
FT   gene            complement(30878..31708)
FT                   /db_xref="GeneID:6370224"
FT                   /locus_tag="CENSYa_0044"
FT   CDS_pept        complement(30878..31708)
FT                   /locus_tag="CENSYa_0044"
FT                   /gene_family="HOG000277380" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG1721"
FT                   /db_xref="GI:118575254"
FT                   /db_xref="GeneID:6370224"
FT                   /translation="MVRRIEFRTKGLVWGMGSGRYRSRFRGGGTDLAELREYVPGDDTR
FT                   RIDWNASARHGSIYTRELAEERELAVHVSVDVSGSISCGMAKQERMLEVAASIMYSAEQ
FT                   SGDRIGMSIFTDCIEGFIPPGRGRAHLLRLFGSLARHKPRSSCTDLSASLLGLGSALRG
FT                   RSLVFVISDFASDPFAEQLGRLSAVHDVILVRVTSSIEAEIPDAGQVIFVDAENNEQMA
FT                   IDTSDIHFRAEYARLAKERGAELARDARRSGAGLIDVGPTEPFEAAFLRHFGRR"
FT                   /protein_id="YP_874997.1"
FT   gene            complement(31737..32744)
FT                   /db_xref="GeneID:6370225"
FT                   /locus_tag="CENSYa_0045"
FT   CDS_pept        complement(31737..32744)
FT                   /locus_tag="CENSYa_0045"
FT                   /gene_family="HOG000236942" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MoxR-like ATPases"
FT                   /transl_table="11"
FT                   /note="COG0714"
FT                   /db_xref="GI:118575255"
FT                   /db_xref="GeneID:6370225"
FT                   /translation="MPSPIFGDAGNVQVRELGSQAAELSGILEGVQAEIRRHIVGQDRA
FT                   IHSILTSLVAGGHVLLEGVPGLAKTGMARALAGAIDVDFARIQFTPDLLPADILGTRVY
FT                   DAASGSFRTERGPIFHRIILADEINRAPPKVQSALLEAMQEGQASIHGETIPLPGPFLV
FT                   IATQNPLEDEGTFRLPEAQVDRFAVKIMVGYPSREEEVAIIEMDGGSKEARPVVDGADI
FT                   QKVQALSRQVYADGVISRYVADIAAATRDPAGSGLDLDGAIQHGASPRASVWLMRTARA
FT                   HALLDGRGFVMPEDVKAVAHDVLRHRIMLTFEAEADGLRPEGVIDAVLARVPPP"
FT                   /protein_id="YP_874998.1"
FT   gene            32852..34093
FT                   /db_xref="GeneID:6370226"
FT                   /locus_tag="CENSYa_0046"
FT   CDS_pept        32852..34093
FT                   /locus_tag="CENSYa_0046"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575256"
FT                   /db_xref="GeneID:6370226"
FT                   /translation="MYGIMICSMALCAISMLPVYAQAGGDYNFIWDIESGEDAAAPHEG
FT                   IESAKPDKEPGHSSPARPAEPSPEYFADTLFQYTDPRIPIEERVDRMISNAAHLQNSTS
FT                   EDNWKHRILFWDRYGDDYVPLASALLDPLTNQTFIVGGTVYEENPNSNLKYFLLERGYD
FT                   LDDLESVPNWVFSPAEYDELREAVLAGGSGGTFDMREFSKNHLALDGDGLHRMMLDELR
FT                   GQGSMVYGDLVLDRDRPVQAVYEPQVQAAREPPQVLEVVPEAPGPVRSVPSDPPYLLYA
FT                   LAAVSAAAGAVLYAVYTGLLPGMRASTPAGRRAPGVQDMIGESRRLLTEGSIKEAHGIL
FT                   GRAIRLHYSIALGLGREATTDEVLGRLRGSADEHDASRWLRLCGGVEYAREEPRQEGLA
FT                   GALSWFSGILGRDT"
FT                   /protein_id="YP_874999.1"
FT   gene            34090..35028
FT                   /db_xref="GeneID:6370227"
FT                   /locus_tag="CENSYa_0047"
FT   CDS_pept        34090..35028
FT                   /locus_tag="CENSYa_0047"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575257"
FT                   /db_xref="GeneID:6370227"
FT                   /translation="MKGLIFAAVLLITVHAAWGELPILTQEEVDAAMGHKFWLVAWSGN
FT                   GTLHDSQEVDDSSGIILRDKTRIFEPIYYKYKIPTVIVDAYKFHNSTGANSFWSTSSGE
FT                   PVFGLMPFRGSSAQTGDCFFASNIEGAVTSCRMDDIIVRAAIHDKYHEHYTYTENMTIS
FT                   ADEPTVIMANEMISRISGEQVKVHEVIRPARVESLQPSPADDSAAAGRPGQGVVPLGED
FT                   QLDSSPPNHTLEYSCGRDDFGLVTLDGLYINDDTFRGSVPLTVILYDGETALLSDTEEI
FT                   PHVGISESREFRVHARWDGGFTHCEAHAWIQ"
FT                   /protein_id="YP_875000.1"
FT   gene            35025..35489
FT                   /db_xref="GeneID:6370228"
FT                   /locus_tag="CENSYa_0048"
FT   CDS_pept        35025..35489
FT                   /locus_tag="CENSYa_0048"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG3398"
FT                   /db_xref="GI:118575258"
FT                   /db_xref="GeneID:6370228"
FT                   /translation="MTGAPRDKRDLIHRHIRENPGLLLGDISSGTGIPKATLAYHVNKL
FT                   VRENKVKHRASSRRKRYFAVGYTEVQAGAICALRTATPRAILGMLLDSPGTSFSGMASS
FT                   IQKSRSTVSACLKSLSDSGLVGSKLDGMTRVYFVRDGDTVREMLDRYFSS"
FT                   /protein_id="YP_875001.1"
FT   gene            complement(35479..36987)
FT                   /db_xref="GeneID:6370229"
FT                   /locus_tag="CENSYa_0049"
FT   CDS_pept        complement(35479..36987)
FT                   /locus_tag="CENSYa_0049"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575259"
FT                   /db_xref="GeneID:6370229"
FT                   /translation="MRTTVIAAFAAVLLAGATSITIAEAEFRGPRQPNYENPGIMTWFC
FT                   LNKPWSLYGSNVSNYHEVDQSELKGEVIKNCDRADDSYLWPPHGNVYVLVLAPSWNNDK
FT                   HSMDTIGNSEDNEITCSSSDGGRTTVTDGRSVGMSEIGYDTGIFGGRLKLAGELRTVDG
FT                   VVNIFGRTSSDVRTISPLDRGSMCTVQTQESGGFTWSWEYSSDAYVTKSGGYTYREGNV
FT                   KFSKDVYTMGDEIKVVVDDVDLPRWSFDTKAVPVQVWSDTDTSGIEVKARFVREYWKPL
FT                   PMDGTHYGTIMLNDGDSSGSNNDLRITPGDNIYAAYYDYTLPLPYSSDGCAPIRGQPAT
FT                   HTCEHIKITNFAKVLPDRGIKIAPAEIAAPTVKVADVIGPSEAAMKKYTSDGMYKVVIW
FT                   WDTDGELRSGTEHKMSMIIMDSRSEKIRHGIDFDLNMTLAGRPVLAELEQDESGVFSGS
FT                   ILFDMPGHATAYISGINGDSSEGTFEFQVDRPRSFFLAPGEIRN"
FT                   /protein_id="YP_875002.1"
FT   gene            37136..38695
FT                   /db_xref="GeneID:6370230"
FT                   /locus_tag="CENSYa_0050"
FT   CDS_pept        37136..38695
FT                   /locus_tag="CENSYa_0050"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="signal peptide protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575260"
FT                   /db_xref="GeneID:6370230"
FT                   /translation="MLPFMIVDSAHAEVPDWVKSSAGWWAAGEITDTDFAESIGFLIEE
FT                   GIMQVAATGTAGQADSEIPDWVRNNAGWWASGDITENDFIGGIEYLVDTGVIHVDTGLA
FT                   DGVVIIVEESEFQKNADAPVKEEWMRHAPAGDKIDYPGVAIDTFRDAIHVTYGSTVGGS
FT                   SNVMIQTSYDMGLTWEDPVRVNTDEGVADMPHANPPYIEMGPDGELYVLYNVGYDGPEW
FT                   VERGFSFGYTALFLTRSDDGGKTFTPAMMVEPETGPGGQVGALHSKTFDSMFVADDGRV
FT                   YVTWLDSRGKQNDSFLPTEVKIAWSDDGGASFEKSRTIKTKACQCCVTSGSTGTDGEVF
FT                   VQYRNIVGNFGEPNIRDVVVSRSNDYGQTWNTPILVADDGFEIDNCPHSTSTISTDSAG
FT                   NLHSAWWTQGGQSPGTYYAVSSDGGETWTDPLFLHGDGEWYPATTIKISMDADDNPVIF
FT                   WADKTVEGGAVKYTQIVDGKSTGIVDLGTGDHPWSDSRDGITALVWVSDGKIMMKSWHD
FT                   GA"
FT                   /protein_id="YP_875003.1"
FT   gene            38847..39992
FT                   /db_xref="GeneID:6370231"
FT                   /locus_tag="CENSYa_0051"
FT   CDS_pept        38847..39992
FT                   /locus_tag="CENSYa_0051"
FT                   /gene_family="HOG000097105" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytochrome c biogenesis protein"
FT                   /transl_table="11"
FT                   /note="COG0785"
FT                   /db_xref="GI:118575261"
FT                   /db_xref="GeneID:6370231"
FT                   /translation="MINVWATWCEPCRRELPYLQSLHEQYSDDGLVMIGTSIDTSGKDR
FT                   QVANYAREVGMTYEIWRDINDKATFAFRMIGVPETVLLDADGSIIQQWKGPIEPGMGVE
FT                   ETIEAALGIAPAGVIESGSVGISEAEVIGLAVAFSAGLLSFLSPCVLPLVPAYATFITG
FT                   MSLKELSSGRTNTGGGAQSRLRVRTVALTRGSLFVLGFSVVFVSLGIAVSYVSSLFDAA
FT                   MWIERIGGIAIIIFGLHLLGVFRIRRLNMEKRFDLSGRSTRNAGSFLVGMGFGAGWTPC
FT                   IGPILAGILTLAATSSGAGSGALLLTVYSAGLAIPFILSALAINQFLVFFKRIRKWMGW
FT                   IERASGILLIGIGALLLTGSLSALTAAFNDTLVPGMTVDSG"
FT                   /protein_id="YP_875004.1"
FT   gene            40040..40126
FT                   /db_xref="GeneID:6370232"
FT                   /locus_tag="CENSYa_0052"
FT   tRNA            40040..40126
FT                   /db_xref="GeneID:6370232"
FT                   /locus_tag="CENSYa_0052"
FT                   /product="tRNA-Ser"
FT   gene            40163..40324
FT                   /db_xref="GeneID:6370233"
FT                   /locus_tag="CENSYa_0053"
FT   CDS_pept        40163..40324
FT                   /locus_tag="CENSYa_0053"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575262"
FT                   /db_xref="GeneID:6370233"
FT                   /translation="MGRRKSKKIITKGPRNVTTGMCPLCKTIGKIFITGQIGEERGKCP
FT                   ACNQAFDL"
FT                   /protein_id="YP_875005.1"
FT   gene            complement(40327..41076)
FT                   /db_xref="GeneID:6370234"
FT                   /locus_tag="CENSYa_0054"
FT   CDS_pept        complement(40327..41076)
FT                   /locus_tag="CENSYa_0054"
FT                   /gene_family="HOG000105017" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Mg-dependent DNase"
FT                   /EC_number="3.1.21.-"
FT                   /note="COG0084"
FT                   /db_xref="GI:118575263"
FT                   /db_xref="GeneID:6370234"
FT                   /translation="MHRIYDAHVHLSDPEYEGQLDSMITGMKRTGITACCVSMDEIDSR
FT                   AVLDMAIPGTILPFVGIHPERAPGDPEAISTMLDEYSGSISGIGEIGLDPSYCTSDEDT
FT                   KNQVDTFKHLLDLAEKHSKPVSIHSRGSLDDILDMLESYSLRACLHWFDGNKRSLKRAL
FT                   DMGLYVSYGPLAVYAAEKRSLLSRTDRDRILVETDGPVRFSRCFGRRPAHPSMVPSVIF
FT                   AASAAIGTEYGETCRILEANSRRYLGV"
FT                   /transl_table="11"
FT                   /protein_id="YP_875006.1"
FT   gene            41164..41391
FT                   /db_xref="GeneID:6370235"
FT                   /locus_tag="CENSYa_0055"
FT   CDS_pept        41164..41391
FT                   /locus_tag="CENSYa_0055"
FT                   /gene_family="HOG000222925" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histone H3 and H4"
FT                   /transl_table="11"
FT                   /note="COG2036"
FT                   /db_xref="GI:118575264"
FT                   /db_xref="GeneID:6370235"
FT                   /translation="MTMGSSELGLAAMYRILKKSGAQRVSDESADELRRTIEEIALSIA
FT                   RNAVDMSSHAGRRTVKAEDVRLASRQYTRH"
FT                   /protein_id="YP_875007.1"
FT   gene            41429..42655
FT                   /db_xref="GeneID:6370236"
FT                   /locus_tag="CENSYa_0056"
FT   CDS_pept        41429..42655
FT                   /locus_tag="CENSYa_0056"
FT                   /gene_family="HOG000105029" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="membrane-associated Zn-dependent protease"
FT                   /transl_table="11"
FT                   /note="COG0750"
FT                   /db_xref="GI:118575265"
FT                   /db_xref="GeneID:6370236"
FT                   /translation="MPGMAPFGMDLDFITSNAIIYVLIAWVVMLVVAKGLKLQNHGFEI
FT                   KAYSIIYKNEGVQSVLTRMLTRSRRGIRVFADVSVVAGFVMMGFAFWFLFSNISAYFVK
FT                   PTEFAEVTVLIPGVTLTSASAIINFLLCIPIVLIMHEGAHGIVATLERIKIKTGGFAIF
FT                   IAMFAGFVEPDEEEFNKAKKISKLRVIGAGATSNVLFSLFLGIILLTNPLFAIIMPEPI
FT                   LGAFYESPDGVLVLSLIEGSGAEQAGVLPNDVITGIGDDPVNTAADLQLIGLEPGETVD
FT                   VSIMRDGTALTIPVVVMESPDEPGRGLIGVLRDNSFAYQPIYDFIKWDNPQVSLFLLWL
FT                   WMISFFIGIINMLPLPILDGGKFIHSIIDKKISEKSVGIVMWSIYGMTFVLFGLNIGLS
FT                   YAKSGWFTI"
FT                   /protein_id="YP_875008.1"
FT   gene            42784..43593
FT                   /db_xref="GeneID:6370237"
FT                   /locus_tag="CENSYa_0057"
FT   CDS_pept        42784..43593
FT                   /locus_tag="CENSYa_0057"
FT                   /gene_family="HOG000225863" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATPase of the PP-loop superfamily"
FT                   /transl_table="11"
FT                   /note="COG0037"
FT                   /db_xref="GI:118575266"
FT                   /db_xref="GeneID:6370237"
FT                   /translation="MIGRGDRVAVGVSGGKDSLVLLHILEQMSQKWGFELEAVTIDEGI
FT                   PGYRDEALSIVEEYCGSLGVAHRVYAYKDLFDMTLDEALNMRGENSQTSCSICGTLRRR
FT                   AMDHAIHDTGADVLATAHNLDDTLQTFLINMISGDTDRIAWMDPDTSSNELRKIKPFCE
FT                   IYESEIVFYAFANKIPFQAESCPHMDEGIRTELRIFLNSLEESHSGAKNSLYRSVMKVT
FT                   EALRPEVHKERQQCPGCGNSCTGGVCSVCRTISGLRGTAQGEAPGTA"
FT                   /protein_id="YP_875009.1"
FT   gene            43651..44130
FT                   /db_xref="GeneID:6370238"
FT                   /locus_tag="CENSYa_0058"
FT   CDS_pept        43651..44130
FT                   /locus_tag="CENSYa_0058"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575267"
FT                   /db_xref="GeneID:6370238"
FT                   /translation="MAPDGNPLEEALARMSDEQKLALLRLSIEAEKAEKSGSDEELEKM
FT                   LDKSWTDYALKPGESIDDLAREAAEYQRRHEELNELIRRMKSRKDDADAKMAAFALDLA
FT                   FDEITNPATKLCKSKKRLDGLIGRLEGRQGDADAHMMAEAITEYRNAITRDPEWL"
FT                   /protein_id="YP_875010.1"
FT   gene            44214..44534
FT                   /db_xref="GeneID:6370239"
FT                   /locus_tag="CENSYa_0059"
FT   misc_RNA        44214..44534
FT                   /db_xref="GeneID:6370239"
FT                   /locus_tag="CENSYa_0059"
FT                   /product="7S signal recognition particle RNA"
FT   gene            44600..44671
FT                   /db_xref="GeneID:6370240"
FT                   /locus_tag="CENSYa_0060"
FT   tRNA            44600..44671
FT                   /db_xref="GeneID:6370240"
FT                   /locus_tag="CENSYa_0060"
FT                   /product="tRNA-Cys"
FT   gene            complement(44727..45002)
FT                   /db_xref="GeneID:6370241"
FT                   /locus_tag="CENSYa_0061"
FT   CDS_pept        complement(44727..45002)
FT                   /locus_tag="CENSYa_0061"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575268"
FT                   /db_xref="GeneID:6370241"
FT                   /translation="MRSSFSSFLYRSQNSFPAYTSSPARPHAYRYAGLTDKDAPRGALL
FT                   SYHSSAGAPTCQSCPLLSPCPVLSDRHRRGTLRETLPSYIPHRGPG"
FT                   /protein_id="YP_875011.1"
FT   gene            45013..45435
FT                   /db_xref="GeneID:6370242"
FT                   /locus_tag="CENSYa_0062"
FT   CDS_pept        45013..45435
FT                   /locus_tag="CENSYa_0062"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575269"
FT                   /db_xref="GeneID:6370242"
FT                   /translation="MPEYVEHLQGGGPLRLGSKTKRIIRIIDDDQRLGITEMWKYDVTG
FT                   SYRMLYAHFKPGWECTIKRCKENAIPAIIGCDLERDREKECAILHWIGNHDDYDRRQCH
FT                   GKSRGKGAGGRARKKLKEAKAGEKPRPKKNRGPPRK"
FT                   /protein_id="YP_875012.1"
FT   gene            45468..45692
FT                   /db_xref="GeneID:6370243"
FT                   /locus_tag="CENSYa_0063"
FT   CDS_pept        45468..45692
FT                   /locus_tag="CENSYa_0063"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical membrane protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575270"
FT                   /db_xref="GeneID:6370243"
FT                   /translation="MKPQIISPGGPVHFMALIWIAVGVGIAVILVLILKIIQTPRHKAV
FT                   SVDYYCKMCGEKTNGLKCPRCSKNDPFGR"
FT                   /protein_id="YP_875013.1"
FT   gene            45734..46117
FT                   /db_xref="GeneID:6370244"
FT                   /locus_tag="CENSYa_0064"
FT   CDS_pept        45734..46117
FT                   /locus_tag="CENSYa_0064"
FT                   /gene_family="HOG000105040" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical membrane protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575271"
FT                   /db_xref="GeneID:6370244"
FT                   /translation="METKGAGLSVYAEKCSRLLEQKEIRFAGIIDEEGSLVSGGFKEGL
FT                   VPLEGDETRLKSFMEFVSRISIRKEYDASLGPINYLAARRDKAVLVSFPFPVSKVVLLI
FT                   SAEPSVDIERLAGRVVGTFAGVS"
FT                   /protein_id="YP_875014.1"
FT   gene            complement(46119..46724)
FT                   /db_xref="GeneID:6370245"
FT                   /locus_tag="CENSYa_0065"
FT   CDS_pept        complement(46119..46724)
FT                   /locus_tag="CENSYa_0065"
FT                   /gene_family="HOG000039949" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pyridoxine biosynthesis protein/glutamine
FT                   amidotransferase"
FT                   /transl_table="11"
FT                   /note="COG0311"
FT                   /db_xref="GI:118575272"
FT                   /db_xref="GeneID:6370245"
FT                   /translation="MSGPSIGVLSLQGDVRENIGMIHTAISRAGVGGSVEQVNDASAIK
FT                   ELDGLIIPGGESTVIGGLAGGELLDVIRTKVRGGMPAFGICAGLILLSKGATDRTVGRT
FT                   GQPLLDLLDVRVERNAFGRQKESFETELSMTSCGIEEFRGVFIRAPVITEAGPGVQVIA
FT                   EYDNKKVAVQQGSVLGVSFHPELTNDPSLHQYFLKMCA"
FT                   /protein_id="YP_875015.1"
FT   gene            complement(46721..47689)
FT                   /db_xref="GeneID:6370246"
FT                   /locus_tag="CENSYa_0066"
FT   CDS_pept        complement(46721..47689)
FT                   /locus_tag="CENSYa_0066"
FT                   /gene_family="HOG000227586" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pyridoxine/pyridoxal 5-phosphate biosynthesis
FT                   enzyme"
FT                   /transl_table="11"
FT                   /note="COG0214"
FT                   /db_xref="GI:118575273"
FT                   /db_xref="GeneID:6370246"
FT                   /translation="MIPLAGEIQTARGIKGGMVGAGSSVRGSSTVKRGLAHMLKGGVVM
FT                   DVTTVRQAQIAEEAGAVSVMVLDKLPSDVRKAGGVARTASMEIVREIMDAVTIPVMAKC
FT                   RIGHTYEAKVLQELNVDMIDESEVLTPADESQHIWKWDFTTPFVNGARSLGEALRRIEE
FT                   GAAMIRTKGEPGTGNVTEAVIHIKKVRDEIREIKSLYDADDRQGLVQAAREFRASYKLV
FT                   EDTARLGDLPVVNFAAGGISTPADAAYLMSLGCSGVFVGSGVFKADDASERARAIVLAT
FT                   AHWEDPAKVAEAQSMIDERQSMLGLGPDKMELRMQERGGSA"
FT                   /protein_id="YP_875016.1"
FT   gene            complement(47720..47890)
FT                   /db_xref="GeneID:6370247"
FT                   /locus_tag="CENSYa_0067"
FT   CDS_pept        complement(47720..47890)
FT                   /locus_tag="CENSYa_0067"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575274"
FT                   /db_xref="GeneID:6370247"
FT                   /translation="MCLSDIRQTYESRTPSSQADSTLVREYIQASARTAHPRVRQYCRQ
FT                   IICRHGARVHK"
FT                   /protein_id="YP_875017.1"
FT   gene            complement(47944..48267)
FT                   /db_xref="GeneID:6370248"
FT                   /locus_tag="CENSYa_0068"
FT   CDS_pept        complement(47944..48267)
FT                   /locus_tag="CENSYa_0068"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575275"
FT                   /db_xref="GeneID:6370248"
FT                   /translation="MEQSMEVARELKRSNIMRGAFILVKCSKTRHNDCRDIRDALIKGS
FT                   SGYIQDAMTTNTVVDGTKWCVAVSALVPLDDADNFERRLKRIQTKDKKSVSVEKLKFMM
FT                   DRR"
FT                   /protein_id="YP_875018.1"
FT   gene            complement(48395..48928)
FT                   /db_xref="GeneID:6370249"
FT                   /locus_tag="CENSYa_0069"
FT   CDS_pept        complement(48395..48928)
FT                   /locus_tag="CENSYa_0069"
FT                   /gene_family="HOG000105051" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575276"
FT                   /db_xref="GeneID:6370249"
FT                   /translation="MVRPVIIALGAVPAIVAVLIAIPLLTQPEIPSSAANPSDRIEIEY
FT                   TRHQLRTVSHGVTERTGSHLTEILIIDDDGSLRYTVTEDGVPVPEVAGSIDGPTLKRLE
FT                   ALIKETGFLAMPSDSFPITEGIDEYQKSSVRVTLNGVRNQIHWPEQNATERTIPPIVTR
FT                   VGEELDAIMDSMRS"
FT                   /protein_id="YP_875019.1"
FT   gene            49008..49152
FT                   /db_xref="GeneID:6370250"
FT                   /locus_tag="CENSYa_0070"
FT   tRNA            49008..49152
FT                   /db_xref="GeneID:6370250"
FT                   /locus_tag="CENSYa_0070"
FT                   /product="tRNA-Arg"
FT   gene            complement(49155..51419)
FT                   /db_xref="GeneID:6370251"
FT                   /locus_tag="CENSYa_0071"
FT   CDS_pept        complement(49155..51419)
FT                   /locus_tag="CENSYa_0071"
FT                   /gene_family="HOG000224293" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="3-isopropylmalate isomerase/aconitase A"
FT                   /EC_number="4.2.1.3"
FT                   /note="COG1048"
FT                   /db_xref="GI:118575277"
FT                   /db_xref="GeneID:6370251"
FT                   /translation="MEIATTTEMVQGVYERLREGIDRYRKDAGRPLTLSEKIMAGHMVR
FT                   DGTDIPVENKDYVHLTPDRVALQDVTGQMVMLQFMVTRHEETALPTTIHCDHLIRAKVE
FT                   GGEDMRVSLDENSEVFRFLKSAAARYGCGFWKPGAGIIHQVVLENYAFPGGLMIGTDSH
FT                   TPNAGGLGMIAVGVGGMDAAEAMAIKEWELLYPKRIGVHLTGKSSGWTSPKDVILKVVE
FT                   ELTVSGGTNAIVEYLGPGASTISCTGKATITNMGAEMGATCSIFPYDNRMGEYLGYTGR
FT                   CGITKLANLHRELLVADPEIEEDPSKYYSRVIEIDLSRLEPHIVGPHTPDLSRPISELS
FT                   DDSRKNGYIDEISAALVGSCTNSSYEDMSRAAGIAEQAKARGLQAQVPLMISPGSEQIR
FT                   ATIERDGQMQSLKDIGATVLANACGPCIGQWSRPELEENEENTIVSSFNRNFPGRNDGS
FT                   RSTMNFIGSPELVVAMALGGRLSFNPLKDELTAADGTKFMLKPPPPAPEVPKDGFQTVE
FT                   GAYVPPPADPHSVKVVIDESSERLEELETFPPWDGADLEGLRVMAKAKGKCTTDHISPA
FT                   GAWLAYRGHLDHLSDNMLLGAVSAYHNEVGKGKNLLTGEMAPYHKVARAYMKAGIRWVI
FT                   IGDGNYGEGSSREHAAMSPRHLGCAAVIARSFARIHETNLKKQGILALVFSDPADYEKI
FT                   LEDDTINIVGLKSMAPHTHVKCLVVHADGSEDTLDLSHSYSASQIGWFRAGSALNVLRD
FT                   K"
FT                   /transl_table="11"
FT                   /protein_id="YP_875020.1"
FT   gene            51418..51567
FT                   /db_xref="GeneID:6370252"
FT                   /locus_tag="CENSYa_0072"
FT   CDS_pept        51418..51567
FT                   /locus_tag="CENSYa_0072"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575278"
FT                   /db_xref="GeneID:6370252"
FT                   /translation="MGIPPHRHKIKIAGPAVHLVELFWPLLLNNYKHNTGTIIGGCWST
FT                   SITW"
FT                   /protein_id="YP_875021.1"
FT   gene            51561..52199
FT                   /db_xref="GeneID:6370253"
FT                   /locus_tag="CENSYa_0073"
FT   CDS_pept        51561..52199
FT                   /locus_tag="CENSYa_0073"
FT                   /gene_family="HOG000105062" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575279"
FT                   /db_xref="GeneID:6370253"
FT                   /translation="MVNKGFPKFGMSQAGAFVADLKNYNLPDFILELVAKDCNSELLPR
FT                   GRIDDRLQSMNDDALEYLHRVFVGCMEDKAGKSAQLRFYAYVSSIYHKCEVLINEPIPG
FT                   KSGKNHKVPVAVKNNGMYIAVAFNKATGKPVNTRDTSRFYDIVDDIKCGEHGTQLTDAI
FT                   YGSSVGFRGEALVELDRLGNSRTGNLENKLDFKTANFENNIYSITKAPT"
FT                   /protein_id="YP_875022.1"
FT   gene            complement(52200..52688)
FT                   /db_xref="GeneID:6370254"
FT                   /locus_tag="CENSYa_0074"
FT   CDS_pept        complement(52200..52688)
FT                   /locus_tag="CENSYa_0074"
FT                   /gene_family="HOG000105073" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575280"
FT                   /db_xref="GeneID:6370254"
FT                   /translation="MALFYKSWIKERFGREIEVKSDELVVRRRGLLGRLDTHSLVRDHR
FT                   SRGEDTYHYYLSNFHPTWTDCTCEGYHAENFGMSVWQKPKEGDGVPFLASKNCTVVSHE
FT                   IAHELLRQAGYKRYMQDVHDIWTKHLHAGQAFDRYDKKFAKTEGDAEFMTLDMSGFEV"
FT                   /protein_id="YP_875023.1"
FT   gene            complement(52786..53025)
FT                   /db_xref="GeneID:6370255"
FT                   /locus_tag="CENSYa_0075"
FT   CDS_pept        complement(52786..53025)
FT                   /locus_tag="CENSYa_0075"
FT                   /gene_family="HOG000225449" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="COG1522"
FT                   /db_xref="GI:118575281"
FT                   /db_xref="GeneID:6370255"
FT                   /translation="MATAYVLINCELGSEEAIIQQLKGLDGVKEVHGTFGAYDILTKIE
FT                   SDTVEKLRETITWKIRKIEKIRSTLTLMGIEGQT"
FT                   /protein_id="YP_875024.1"
FT   gene            complement(53068..53514)
FT                   /db_xref="GeneID:6370256"
FT                   /locus_tag="CENSYa_0076"
FT   CDS_pept        complement(53068..53514)
FT                   /locus_tag="CENSYa_0076"
FT                   /gene_family="HOG000263533" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG2947"
FT                   /db_xref="GI:118575282"
FT                   /db_xref="GeneID:6370256"
FT                   /translation="MSYTMAYWLVKQEPGGPRGYSLDQMQKDKKTVWDGVRNNLALKHI
FT                   RNMKKGDLAMYYHTGTERQAVGIIEVTTAPYPDPGAENERFVVVDVKFKSRLKRPVTLD
FT                   EMKGEKAFKDWELVRISRLSVMPVPKGIWDRIMTLSRLSPPGRA"
FT                   /protein_id="YP_875025.1"
FT   gene            complement(53729..54940)
FT                   /db_xref="GeneID:6370257"
FT                   /locus_tag="CENSYa_0077"
FT   CDS_pept        complement(53729..54940)
FT                   /locus_tag="CENSYa_0077"
FT                   /gene_family="HOG000105094" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="COG0072"
FT                   /db_xref="GI:118575283"
FT                   /db_xref="GeneID:6370257"
FT                   /translation="MHDINSIAFPLRYTTAGRGHRFVPLHSDAELTVDEILEKTEVGTK
FT                   YGPLLKGSKKVPVILDAKGRTVSFPPVINAARTTVNTKTLGLFVDVTGTDKRVIEDVLS
FT                   VIALTLQGAGFTLYSVRVSGAGNSTPLFRPRKMRLDAQLVNSTLGLDLKPTAIVNALRK
FT                   SRLDAIAKGKIIECTIPRHRFDILGEMDLVEDAALGYGMDKLGPRLPTSSTLGMAHPIQ
FT                   VMLQSARGIMTGLGYTEILNSSLTSKRILYENTDRDPSKMISVSDSKSLEHTILRDSLL
FT                   PGVIDSLAANIHHEYPQRLFEIGTVFGRGSPVSEQGSLCAASSHGSAGFTEIKSTLQSA
FT                   ARHILGGTCKTRPAPHDIFEEGHSAEVLVGGKVIGIAGELSGTVRERFRLREPVSAFEI
FT                   KLPG"
FT                   /transl_table="11"
FT                   /protein_id="YP_875026.1"
FT   gene            complement(54943..55284)
FT                   /db_xref="GeneID:6370258"
FT                   /locus_tag="CENSYa_0078"
FT   CDS_pept        complement(54943..55284)
FT                   /locus_tag="CENSYa_0078"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="COG0072"
FT                   /db_xref="GI:118575284"
FT                   /db_xref="GeneID:6370258"
FT                   /translation="MAEAIPYLGLDIEDRSGDRLRVEYSPNRPDYSTDYGIAMGLQGLL
FT                   GVRRGMAQLRIRDGKYSIKADTSVSKIRPYVTCIAAKGRDVDDSLLKQLISMQEDLHAG
FT                   LGRGAERPP"
FT                   /transl_table="11"
FT                   /protein_id="YP_875027.1"
FT   gene            complement(55338..56711)
FT                   /db_xref="GeneID:6370259"
FT                   /locus_tag="CENSYa_0079"
FT   CDS_pept        complement(55338..56711)
FT                   /locus_tag="CENSYa_0079"
FT                   /gene_family="HOG000230293" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phenylalanyl-tRNA synthetase alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="COG0016"
FT                   /db_xref="GI:118575285"
FT                   /db_xref="GeneID:6370259"
FT                   /translation="MQVLHEIEKKIIGVIRGEWRFEADLPFLTGLSPDQVRRGIQWLKH
FT                   KDIITVNETANIEFRLGKNGLEALANKLPERRLMNALKGGQRNIRELKKELGGVLGPAM
FT                   GIALREGWISNKNGIISLEKNVDKLPGEDTIERIGEGNAFILNLISKDLDTLRSRPNFI
FT                   IEKKHMVHAIELKDKEIKVDFKTKAIDVEADAPVTHPARVHPLNEVIAEIREAFVALGF
FT                   TEITGSLAQSSFWNFDALFTPQDHPAREIQDTFFLEGIQSSNFATPGQIKNVSGAHKKN
FT                   WGPWSLDEARRTVLRTHTTCTTIKYLAEERPDEARAFSLGRVFRNEKVSYKHLVEFHQA
FT                   EGVVTGPDVTLRGLMGIQEEFYKRIGLGKTKFWPTFFPYTEPSLQTMVYNERMGKWVEL
FT                   FGMGIFRPEVTRPLGIRRPVLAWGGGIERIAMIKYGIDDVREFYNNDLDWLRTAEKCR"
FT                   /transl_table="11"
FT                   /protein_id="YP_875028.1"
FT   gene            56765..57871
FT                   /db_xref="GeneID:6370260"
FT                   /locus_tag="CENSYa_0080"
FT   CDS_pept        56765..57871
FT                   /locus_tag="CENSYa_0080"
FT                   /gene_family="HOG000224742" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="COG0180"
FT                   /db_xref="GI:118575286"
FT                   /db_xref="GeneID:6370260"
FT                   /translation="MPDNFVVTPWRVEGEIDYDRLTEQFGTTKLTDELLDRLRKIAGED
FT                   HFMLRRRIFFSHRDLNMILDSHESGKGFFLYTGRGPSGHTHIGHLIPWVFAKWLQDRFG
FT                   ANMYFQLTDDEKFYSQNNMTLDETRGFAYENALDFVALGFDPAKTSIVIDTEDISTLYP
FT                   LAAQVAKKLNFSNMKAVFGFTNETNIGMIFYTSLQSAPCFLEDKPVLIPLGVDQDPHFR
FT                   LTRDVAPKLGRPKPALLHNIMVPALGGPGGKMSGSSGGAIYTTDDPGTVKKKINKYAFS
FT                   GGKADVEEHRKLGGDPEVDVSYQYLRIFFEPDDARLRKIHDEYRSGSLLTGELKGILIE
FT                   KINTFLARHQEARERAKDRMGEFRLAKN"
FT                   /transl_table="11"
FT                   /protein_id="YP_875029.1"
FT   gene            complement(58139..58459)
FT                   /db_xref="GeneID:6370261"
FT                   /locus_tag="CENSYa_0081"
FT   CDS_pept        complement(58139..58459)
FT                   /locus_tag="CENSYa_0081"
FT                   /gene_family="HOG000105096" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575287"
FT                   /db_xref="GeneID:6370261"
FT                   /translation="MDRMLEGIEGSTKGLKDGLDPDNLAAWYDAIMGDAREMAPPWLHS
FT                   KMRIRRDPVLTMKFTVDISKRAVGYFMTAADARMGQMPYSTRLYFLKVLEAMESEVDRW
FT                   LV"
FT                   /protein_id="YP_875030.1"
FT   gene            complement(58537..58995)
FT                   /db_xref="GeneID:6370262"
FT                   /locus_tag="CENSYa_0082"
FT   CDS_pept        complement(58537..58995)
FT                   /locus_tag="CENSYa_0082"
FT                   /gene_family="HOG000284155" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pantetheine-phosphate nucleotidyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="COG1019"
FT                   /db_xref="GI:118575288"
FT                   /db_xref="GeneID:6370262"
FT                   /translation="MAFKLAAVGGTFDVIHEGHAALLARTFEAAEAIIGLTSDALALKR
FT                   GKRPAKNYEERFAALESFISERFPDAKYSVSRLDEDFGPAVLEPGVDVLVVSEETHPQG
FT                   DVLNALRRGKGLPPVSVVVVPMVMAEDGTRISSTRIKNSEIDPSGRQP"
FT                   /transl_table="11"
FT                   /protein_id="YP_875031.1"
FT   gene            59063..59413
FT                   /db_xref="GeneID:6370263"
FT                   /locus_tag="CENSYa_0083"
FT   CDS_pept        59063..59413
FT                   /locus_tag="CENSYa_0083"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575289"
FT                   /db_xref="GeneID:6370263"
FT                   /translation="MGPRECLVERAASTHSIVGKERMSVMLEHACMLLEAHEMTSTFVL
FT                   NGRIDSAGLSQALQVLVLPKCMEIKNPAVDHTDTGTKSVPQNSAYSERVKEGRLDELPG
FT                   NIEFLLEKLCDL"
FT                   /protein_id="YP_875032.1"
FT   gene            complement(59423..60526)
FT                   /db_xref="GeneID:6370264"
FT                   /locus_tag="CENSYa_0084"
FT   CDS_pept        complement(59423..60526)
FT                   /locus_tag="CENSYa_0084"
FT                   /gene_family="HOG000105107" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575290"
FT                   /db_xref="GeneID:6370264"
FT                   /translation="MPNYFNRPGGASCMIRLLVIAVLAAGLLPVQPALAQSVDTDPTLG
FT                   VGLSSFTPYHYTDSQGRTVIVGEVENTKDFPVTSVKIWAGFFGDTSLAPLESTIGTTVL
FT                   DVIPARGSSPYMIISPSANPDTSNVSVNLLGFTSAASKPAELEIGGELTGTAERIEYSG
FT                   TIKNNAKSPAEETSIHMVMYDGFRPPRLLKVVTVDIPSVIPAGGSSTFSLSEAYHRSTV
FT                   GFYMFAESTTLLSNTWDVEVTQPEPISKKVSINDVHISVGGERVSSTKVGEPLLIQSST
FT                   WLQVASQGETYDQDYVYYAQVKQSGRDAVVEYVGAFSGSFNSPEPQMPSVEWIPEKDGL
FT                   YFIETYMWDTNGVPLSPKGPVVLVIVN"
FT                   /protein_id="YP_875033.1"
FT   gene            complement(60759..61046)
FT                   /db_xref="GeneID:6370265"
FT                   /locus_tag="CENSYa_0085"
FT   CDS_pept        complement(60759..61046)
FT                   /locus_tag="CENSYa_0085"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575291"
FT                   /db_xref="GeneID:6370265"
FT                   /translation="MPKLITRPGGANKNLYGLARLRSRRGGPPRQSRRGAAVFFECIGR
FT                   GDMAGPACGPGASAAGPRGSVKGYASGGGSASGINVQIAGVIGLSGIPWI"
FT                   /protein_id="YP_875034.1"
FT   gene            61147..62661
FT                   /db_xref="GeneID:6370266"
FT                   /locus_tag="CENSYa_0086"
FT   CDS_pept        61147..62661
FT                   /locus_tag="CENSYa_0086"
FT                   /gene_family="HOG000105118" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transketolase, N-terminal subunit"
FT                   /EC_number="2.2.1.1"
FT                   /note="COG0021"
FT                   /db_xref="GI:118575292"
FT                   /db_xref="GeneID:6370266"
FT                   /translation="MAEIIGVLFYGHLRYDPKNPSWEDRDRLVLSKGHAAPGLFSGLAV
FT                   AGYFDKDEIETLRKFGSRLQGHPDLKCPGVEFCGGSLGIGLSFSLGIALAAKIDGRGHR
FT                   VYTILGDGESDEGQVWEAAMAAAKYKTDNLTAILDRNLIQQDSRTEDVMPLDAPGMKVG
FT                   DKWRSFGWNVIEVDGHRIEELDGALRGAADTKGAPTMIIARTIKGKGVEHMENNPSWHG
FT                   QAADPEIAPIIQEELGSQCAIAPSIIAGDMTDLSGEVRRCAEGGADYIHLDVMDGRFVP
FT                   NKTFDHEKIRELRPITQTPFDTHLMIDEPGRHIREYAEAGSDIITVHAEACDSSTFGEI
FT                   HDYLRDNLVGVGLAVNPGTELPPWAAKFAPTIDQVIIMSVVPGKSGQKYIEDTHAKASR
FT                   MAEQLAGHGFEGVIEADGGVTEQNIGSCFTDGARAFVGGSAIVGQRDISSAITGFREAL
FT                   ADARRTMLLHSAERRGGRDLVKKWAGLHKGKAGELVEQLATKEGLL"
FT                   /transl_table="11"
FT                   /protein_id="YP_875035.1"
FT   gene            62658..63614
FT                   /db_xref="GeneID:6370267"
FT                   /locus_tag="CENSYa_0087"
FT   CDS_pept        62658..63614
FT                   /locus_tag="CENSYa_0087"
FT                   /gene_family="HOG000243869" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transketolase, C-terminal subunit"
FT                   /EC_number="2.2.1.1"
FT                   /note="COG0021"
FT                   /db_xref="GI:118575293"
FT                   /db_xref="GeneID:6370267"
FT                   /translation="MTLTDMRSEYGKTLVELGSTDQSVVVLGADTTSSLKTAGFGREFP
FT                   GRFFNMGIAEANLVSVSAGLAISGKTAFASTYAIFLPGRAVDQIRNAVCYPTRNGKSGL
FT                   NVKLVVSHGGLTVGADGGSHQQLEDIAIMRAIPNMRVLIPADTFAVRALVRTMAAEYGP
FT                   FYMRMARSKTPTVHSESTKFVPGRGITVRDGSDCTIASCGITVHMAIEAADMLDKEGIS
FT                   CRVLDMFSVKPIDGPLLEKAARETGRIVTCEEHNILGGMGSAVAEAVSERHPVQVRRIG
FT                   VDDTFGESCRDSEVYMLLEKHGITAANIARIAKGMIH"
FT                   /transl_table="11"
FT                   /protein_id="YP_875036.1"
FT   gene            63665..64276
FT                   /db_xref="GeneID:6370268"
FT                   /locus_tag="CENSYa_0088"
FT   CDS_pept        63665..64276
FT                   /locus_tag="CENSYa_0088"
FT                   /gene_family="HOG000226073" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="COG0176"
FT                   /db_xref="GI:118575294"
FT                   /db_xref="GeneID:6370268"
FT                   /translation="MGLVDGITTNPSLLSKEGGSPKEVMAEIARIIEGPVSLEVVSTEY
FT                   AGMMEEGHRLRGYGDNVVVKCPMTADGLRACKSLTAEDIPVNITLVFSPNQALLAAKAG
FT                   AAYVSPFIGRLDDIGQEGMLLIEEMVEIYSNYEFEAEILVASIRHPMHVIEAAKLGADV
FT                   ATLPPAVLGKMLSHPLTDRGLESFLADWDKLKSENPGAGF"
FT                   /transl_table="11"
FT                   /protein_id="YP_875037.1"
FT   gene            64296..64781
FT                   /db_xref="GeneID:6370269"
FT                   /locus_tag="CENSYa_0089"
FT   CDS_pept        64296..64781
FT                   /locus_tag="CENSYa_0089"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575295"
FT                   /db_xref="GeneID:6370269"
FT                   /translation="MSARQRPYPLRPGSSACIRACRALSVTPPGEPPMPPKTLLRSFIM
FT                   SFMLVNPMTLGDPKGDWGCCMSPFISFAEDSETITYGEPSGEASMLLTTYSFCTVRAIH
FT                   PGNLNFKRAHATALYAEIQPSGRPGGSAGACPRAARPGSCAMLKRDCPGPHLRQEIG"
FT                   /protein_id="YP_875038.1"
FT   gene            64822..65451
FT                   /db_xref="GeneID:6370270"
FT                   /locus_tag="CENSYa_0090"
FT   CDS_pept        64822..65451
FT                   /locus_tag="CENSYa_0090"
FT                   /gene_family="HOG000105129" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="type I membrane protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575296"
FT                   /db_xref="GeneID:6370270"
FT                   /translation="MGDPKILQRIRRAAEQDEVVSVYEREYVEGLVRRHLQPSYAAGTE
FT                   PVVIPLEKEKLPRRIEQPKKKRRLSRLVPRPGRLRPNSRKKKIAYIVIFALLVTIIAGS
FT                   IPLGTDSPRGPRAVPSSGLSVDSDATRYSVGDIISISGVSGDGIDVSLSIVNEAGGTIW
FT                   RENVSPRGDNSYSTLIIAGGEGWDSGEYTIRAVRGQATEEAHFAVR"
FT                   /protein_id="YP_875039.1"
FT   gene            complement(65453..65809)
FT                   /db_xref="GeneID:6370271"
FT                   /locus_tag="CENSYa_0091"
FT   CDS_pept        complement(65453..65809)
FT                   /locus_tag="CENSYa_0091"
FT                   /gene_family="HOG000105141" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575297"
FT                   /db_xref="GeneID:6370271"
FT                   /translation="MEIVYEPWKKVIIRELVEYKFEDWIQQIAFATKTSGGGIATVNWA
FT                   KGVVFSVAIFPPTEAVTEENMKGILYLSSVTFAIKEKFEKQVVYEGATISLIDVGANET
FT                   FNKLSDVLRARTKY"
FT                   /protein_id="YP_875040.1"
FT   gene            complement(65855..66415)
FT                   /db_xref="GeneID:6370272"
FT                   /locus_tag="CENSYa_0092"
FT   CDS_pept        complement(65855..66415)
FT                   /locus_tag="CENSYa_0092"
FT                   /gene_family="HOG000105163" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TATA-box binding protein (TBP), component of
FT                   TFIID and TFIIIB"
FT                   /transl_table="11"
FT                   /note="COG2101"
FT                   /db_xref="GI:118575298"
FT                   /db_xref="GeneID:6370272"
FT                   /translation="MPQTKPIVSVENVVASASVDQKIDLNDVTKKFPDTEYNPEQFPGL
FT                   VFRLTSPKTATLIFRTGKMVCTGAKSEDMAVKAVRTVVQKLRKSGIKIKKDAVVVVQNI
FT                   VAAINLGGKIHLEKAARVLPRSMYEPEQFPGLIHRMLDPKTVILLFASGKLVCTGAKKE
FT                   SDMYRSVYNLHALLEEKDLMTYE"
FT                   /protein_id="YP_875041.1"
FT   gene            complement(66553..66978)
FT                   /db_xref="GeneID:6370273"
FT                   /locus_tag="CENSYa_0093"
FT   CDS_pept        complement(66553..66978)
FT                   /locus_tag="CENSYa_0093"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575299"
FT                   /db_xref="GeneID:6370273"
FT                   /translation="MPFSIPALCRPHSIRQENSRAPQVEHEIQGPISRPRPPEDTKIGL
FT                   PQAQDTEKARHGSNHRKGRDIRCKEVQLSPRGQAGQAVPPGIGGPPWRQVRLSAPGRAA
FT                   PPGAHPVQGKAGPIRGGASRRHASTKRDPGRRDRRGL"
FT                   /protein_id="YP_875042.1"
FT   gene            complement(66985..68868)
FT                   /db_xref="GeneID:6370274"
FT                   /locus_tag="CENSYa_0094"
FT   CDS_pept        complement(66985..68868)
FT                   /locus_tag="CENSYa_0094"
FT                   /gene_family="HOG000105165" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cysteine synthase"
FT                   /EC_number="2.5.1.47"
FT                   /note="COG0031"
FT                   /db_xref="GI:118575300"
FT                   /db_xref="GeneID:6370274"
FT                   /translation="MLYYDLGRKCLFYSILDMQHGGCYPDGRGGRNVHAMRSWFAGGPI
FT                   SIRGIHALMGAMGVYEAAHERPIYGRCSLDAWKKSGCCIYVPKGRMALPRGDLPARANS
FT                   KCGYYTEGTMAEQIDTELLKRFEDQVWSKVPHIEERDGKKGIVSATPLGDMTDDFVECA
FT                   KSVYKLDLSNKGIKVYGKFDGVLPSGSIKVRPAAYIIHEAISTGKLRGGQMVIEATSGN
FT                   FGIALGLLTKLGITVVALVSRRLQEGVFKELRNENIRIMDLDMDICPAPGMKDSADVVA
FT                   AKATAANIRSQLTELGFDPSTFDGSYKEIEALLVDQDIIKLAQLLGRIYKIFCPAQYDN
FT                   ELNIEAHRTITGPEIDQQLKEHGESMAEYEIYCTFGTGGTSGGLSRHISDKYSRKAVHV
FT                   VFPPAGQDVAGIRTENKASGLKYYRPDDYAKVHVEDFDKAAPLLKFFVDKGHDIGESSA
FT                   LELYAALRTAASGESTKFVIMIADGITKYRKKLEERSTQRQIKISLEDAASASGEYDKI
FT                   IWVHPQFTPKEEGIEMLAASLGVDKSRIAVPTAGSVRKLLETNQIPEELEKELGGAKKS
FT                   LLVCMAGNTSLMAANVLAGKGVITESLNGGITGLPSGQNKSPAEYVQPASE"
FT                   /transl_table="11"
FT                   /protein_id="YP_875043.1"
FT   gene            complement(69126..70691)
FT                   /db_xref="GeneID:6370275"
FT                   /locus_tag="CENSYa_0095"
FT   CDS_pept        complement(69126..70691)
FT                   /locus_tag="CENSYa_0095"
FT                   /gene_family="HOG000105176" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575301"
FT                   /db_xref="GeneID:6370275"
FT                   /translation="MQELLGPGDALIEIGTFLARRWSGRDNATIEFSERGGIRTRMSDA
FT                   RITLYPIEKLSGDGFEKYRQFRAYLWYESMRLRFCDKVLSSDHAFGFILNTLETKRIEH
FT                   LGMKAWRGMGTELAFYRVYQQEYRPQLNSVYGRAKVVEGFYQQFLFGKFKGEISGRHAE
FT                   KIARAARAAHVILDEAVSGDHGTSWLEKKVPEIIRMLDIDSLLTIPLALPWMKPQMALT
FT                   EEELLKALTKVTRDAEGDFAKVDPSAAARGDALREEYRALAAESRKDDAHGVTAADVGV
FT                   QVPSRTDVDESTIYDLDLINSLKTRFKSWKSGWSEENFSSGDEFDGEAYIEGHVPFLTD
FT                   VKKVIKAEIAIMLDHSSSIAGDQVEYKKATLALCEVLGYLKVDFSVYAFSTVNKAVVCW
FT                   MIKPGGQQWNSACAKRLAQVEANGSTPLAEVYGKMFPILQAKRPGIFLTLTDGEPADPG
FT                   AVRSMIKGYRGLGIRMVALGLGPDTVRATTIASNLKHLGYERTLAVSRLGDIPGKVLGV
FT                   LGAD"
FT                   /protein_id="YP_875044.1"
FT   gene            complement(70691..71485)
FT                   /db_xref="GeneID:6370276"
FT                   /locus_tag="CENSYa_0096"
FT   CDS_pept        complement(70691..71485)
FT                   /locus_tag="CENSYa_0096"
FT                   /gene_family="HOG000105187" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nitric oxide reductase Q protein"
FT                   /EC_number="1.7.99.7"
FT                   /note="COG0714"
FT                   /db_xref="GI:118575302"
FT                   /db_xref="GeneID:6370276"
FT                   /translation="MQEAAYLDWNNSFEILNKAHESGLFVLIIGPKGTGKTTLVKDFAK
FT                   SKSARLDSINFSLRTRESHLVGTKTLSDGSVGFDEGLLVRSMREGSMLYLDELNSAEAD
FT                   VLLRLDEALDDRRQIVLKESSGETIQADKDWFVVATINPLTHVGTKELPPQLLSRFPVR
FT                   IRLEYPPEKTEFEIVKRHAPGVPDDDLEQGIRLANILRQAAAVEEINYSPSMRETISYA
FT                   RLVVSGMPPAAVAAIVFGNVYAQWGSVEYQKVSDIITSMFGG"
FT                   /transl_table="11"
FT                   /protein_id="YP_875045.1"
FT   gene            complement(71565..73016)
FT                   /db_xref="GeneID:6370277"
FT                   /locus_tag="CENSYa_0097"
FT   CDS_pept        complement(71565..73016)
FT                   /locus_tag="CENSYa_0097"
FT                   /gene_family="HOG000105198" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dehydrogenase"
FT                   /transl_table="11"
FT                   /note="COG0644"
FT                   /db_xref="GI:118575303"
FT                   /db_xref="GeneID:6370277"
FT                   /translation="MADYDVIVAGGGLAGTVTAQSVLKHGPGLSVLVVDKSPETMPGKK
FT                   NTAGWICGDAVSKEAVDYMTENIGVKWGEPEIEHKVKGVMAFSPDRETSIPFDGDGYML
FT                   NRQLLPERQNERTINMGVKFEFEKNLTGLIIEDGLAAGVKGVDAKTREPFRKTCRLVID
FT                   ATGMTSLLRGQAYSDKVEKRIDRHDIESTGRYIMYFEPGIHDTTEFDPDYCIIHLDQDI
FT                   APGGYGWVFPKGDKKVNIGLGVEKSLLESRNARMNKKDTVNTLMDEYLARNKAIENPRL
FT                   SEDGVDKNNATGIFQVSVRRQNDCMVAGGYILVGDSAWMPKPLDAGGIGPALVAGSIAG
FT                   RCAAEALEANDPSEAGLWKYNKEFINEYGYKTAGLELFRRLIQTLTNEQINYGMKHFLG
FT                   NLDVESISKGEHPDFGGLGKIGMIIRGALNKRLADGLRFTTKQNKWLVEHYRSYPESPG
FT                   GFAEWNKELHRVLDESNARLEQFAN"
FT                   /protein_id="YP_875046.1"
FT   gene            complement(73152..73565)
FT                   /db_xref="GeneID:6370278"
FT                   /locus_tag="CENSYa_0098"
FT   CDS_pept        complement(73152..73565)
FT                   /locus_tag="CENSYa_0098"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="exosome subunit"
FT                   /transl_table="11"
FT                   /note="COG1325"
FT                   /db_xref="GI:118575304"
FT                   /db_xref="GeneID:6370278"
FT                   /translation="MAGGMRAEIDVIIHATEDESLVYEALEEQLGIIQEMITIQNLTGH
FT                   YDNPITMVNCRLDKKNAEAFVDRLSRGMAPGEFTRLASAPQSSGVHIRLDKQRLVRGRL
FT                   EDVEGGSVRIRIHIPVYDGNMAGAYAQLLRQPS"
FT                   /protein_id="YP_875047.1"
FT   gene            complement(73575..74186)
FT                   /db_xref="GeneID:6370279"
FT                   /locus_tag="CENSYa_0099"
FT   CDS_pept        complement(73575..74186)
FT                   /locus_tag="CENSYa_0099"
FT                   /gene_family="HOG000105219" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein S3AE"
FT                   /transl_table="11"
FT                   /note="COG1890"
FT                   /db_xref="GI:118575305"
FT                   /db_xref="GeneID:6370279"
FT                   /translation="MARRKIKVKDKWRDKRWITIHAPDSFNSVPAARVPITDDKHAKGR
FT                   VIEVTLFDILKGDPQQNNYKIYFQIDKVSEESATSIFKRYEYSKEYLRSLVRRGSSKVN
FT                   YIVDVKTSDGYVFRLKVLALTYRHLNTSKKHALRLIIRDVIENTVPQMNIDQFVQAACY
FT                   GKINSDILSRAKKLVKVRHMGLEKVKLVRTAEEQITLLQA"
FT                   /protein_id="YP_875048.1"
FT   gene            complement(74246..75502)
FT                   /db_xref="GeneID:6370280"
FT                   /locus_tag="CENSYa_0100"
FT   CDS_pept        complement(74246..75502)
FT                   /locus_tag="CENSYa_0100"
FT                   /gene_family="HOG000035937" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="COG0172"
FT                   /db_xref="GI:118575306"
FT                   /db_xref="GeneID:6370280"
FT                   /translation="MLDPHILRSRPKDVSDMLQARNVDFDLDALLDADERRRYFMQLAD
FT                   DMRQERNFAGRQVAQFKRDGVDTTAAIKEMKDLSEKLYQAEGEQQSAESEYLELAWTIP
FT                   NMIDKSVPRGPDETANVVLRKWVGTPTPSVPKGHEELAVGRGLLDMKRAAKVSGARFYY
FT                   LKGSLVRLNQALISHSLDFLGSRGYTLVQPPYLIRRNAMEGAIIAEDFEDVIYKIEDDD
FT                   LYLIGTSEHAMAAMHSDEIIEGGLPLRYAGVSPCFRKEAGAHGKDQKGIFRVHQFDKIE
FT                   QFVFSKPEDSWREHDRMLEITEEFYQGLGIPYRVVLLSSGDMGKVSAKTYDIECWMAAQ
FT                   DAYREVVSCSNCLDFQSRRLKVRFRDRTDEDTQYVHTLNSTLAATSRLLACIIENFQEA
FT                   DGTIRVPQPLQKYVGKEAI"
FT                   /transl_table="11"
FT                   /protein_id="YP_875049.1"
FT   gene            complement(75502..75627)
FT                   /db_xref="GeneID:6370281"
FT                   /locus_tag="CENSYa_0101"
FT   CDS_pept        complement(75502..75627)
FT                   /locus_tag="CENSYa_0101"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575307"
FT                   /db_xref="GeneID:6370281"
FT                   /translation="MEMAEIDGGVVLNFSGNNVKQLVSTIDEVLEHVQLALEATV"
FT                   /protein_id="YP_875050.1"
FT   gene            complement(75704..77035)
FT                   /db_xref="GeneID:6370282"
FT                   /locus_tag="CENSYa_0102"
FT   CDS_pept        complement(75704..77035)
FT                   /locus_tag="CENSYa_0102"
FT                   /gene_family="HOG000105221" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="single-stranded DNA-specific exonuclease"
FT                   /transl_table="11"
FT                   /note="COG0608"
FT                   /db_xref="GI:118575308"
FT                   /db_xref="GeneID:6370282"
FT                   /translation="MVTTHMDCDGIASGGIMAKALSRAGAKYSVSAVGGLGPEEAKMLG
FT                   GSAHDLHVIMDLGSGVSAELDELKGGWFVLDHHPVSDDENPRVVNAWKFGIDGGSEASA
FT                   GTMAYLAACAIGEDNTDLAPCALVSALGDRQDSGEKRSFTGKNQEIALAAKERGLVEID
FT                   LDLLLAGRETRPLPDALAFTTQPFIEGLTWNRPACLSLLESTGIKLKEGGRWRVPSELV
FT                   EDEKRKLISAVTKFATGSDDGELGGSLIGHTYTFPEEDRMGLLRDAREYSTMLNSCGRI
FT                   GMAGAGMAVCMGDRNIMLEECEGILERYRTMTKEYMAILSSERWRISDGKECIMVNGEG
FT                   VVPESMTGTISSIIAGSPRSSGKIVILRAEGGSGTVKFSSRKSFSCTSGVNLRDLMMGA
FT                   ERFEGAGGGHAAAAGARITKDKLDVFLDYLEANVSNVQGQGNPA"
FT                   /protein_id="YP_875051.1"
FT   gene            complement(77110..77556)
FT                   /db_xref="GeneID:6370283"
FT                   /locus_tag="CENSYa_0103"
FT   CDS_pept        complement(77110..77556)
FT                   /locus_tag="CENSYa_0103"
FT                   /gene_family="HOG000180723" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein S15P/S13E"
FT                   /transl_table="11"
FT                   /note="COG0184"
FT                   /db_xref="GI:118575309"
FT                   /db_xref="GeneID:6370283"
FT                   /translation="MGRLHSHRHGKSHSIRPSSPKAPSWIQGPGEVEDLIVKYAKEGLA
FT                   PSQIGSKLRDQHAIPLTRPITGKSVTQIMEEHGATPELPEDLNNIVQKAVGLQRHLRAN
FT                   KGDRRNVRSLELIEAKVHRLDVYYKRIGRIPKDWKYKSVVAQLE"
FT                   /protein_id="YP_875052.1"
FT   gene            77954..78478
FT                   /db_xref="GeneID:6370284"
FT                   /locus_tag="CENSYa_0104"
FT   CDS_pept        77954..78478
FT                   /locus_tag="CENSYa_0104"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein S17E"
FT                   /transl_table="11"
FT                   /note="COG1383"
FT                   /db_xref="GI:118575310"
FT                   /db_xref="GeneID:6370284"
FT                   /translation="MSQALCSSGEEKASTLPRAEASRFLFLFDGVSGGLCGAAEGISSP
FT                   GGTAIPVNRIKKHTEELLKNHKSEFGLSFEENKKTLERLSTIRYKILKNEIAGYITNQN
FT                   KKEAEKARREAERERSNSRQAEPEPEPKKSSGDFTVGIGGIRKWTGETPPEATPVSYKP
FT                   ADDPADDPATV"
FT                   /protein_id="YP_875053.1"
FT   gene            78732..79031
FT                   /db_xref="GeneID:6370285"
FT                   /locus_tag="CENSYa_0105"
FT   CDS_pept        78732..79031
FT                   /locus_tag="CENSYa_0105"
FT                   /gene_family="HOG000105232" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575311"
FT                   /db_xref="GeneID:6370285"
FT                   /translation="MNAWARFWKWYEDKILGSILIIAVIQFIQIPHMIWNADLYLELGT
FT                   ISRVHPALDWLLYGVDLIEIVSIINVGMIMYSLVKKRRAERRMAHKATESSLAD"
FT                   /protein_id="YP_875054.1"
FT   gene            complement(79028..79987)
FT                   /db_xref="GeneID:6370286"
FT                   /locus_tag="CENSYa_0106"
FT   CDS_pept        complement(79028..79987)
FT                   /locus_tag="CENSYa_0106"
FT                   /gene_family="HOG000105243" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HNH endonuclease"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575312"
FT                   /db_xref="GeneID:6370286"
FT                   /translation="MAKDYLRMFNRFFGNSNRMASTYKPVFLRALLDVADLDGTRRLAG
FT                   ERWLERKDGKLVIDLNFIAARFAKYYWDMEYSFRLRQSQDRQDANITRLVKAAHKEGDK
FT                   PPTIEVMASEEMDEFRKRVIKMSIKPEVLVHLLTDMKGLYVKTGPSTIQLDDDIIEFLR
FT                   GHRVLLKQGINNVLARYLEKLNRMTPQITSKIEGEPTGRKALGSIAQEKMKKWQDSRCF
FT                   YCEDKFSKPHVDHVIPHNYVFATDLYNCTLACQQCNCTKSDMLPEKDIFEKVVERNRGI
FT                   PQCLKKFKPGYSEESYRLLFDTCIKEYNGDEFFTPRIR"
FT                   /protein_id="YP_875055.1"
FT   gene            80168..83377
FT                   /db_xref="GeneID:6370287"
FT                   /locus_tag="CENSYa_0107"
FT   CDS_pept        80168..83377
FT                   /locus_tag="CENSYa_0107"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycosyltransferase involved in cell wall
FT                   biogenesis"
FT                   /transl_table="11"
FT                   /note="COG0463"
FT                   /db_xref="GI:118575313"
FT                   /db_xref="GeneID:6370287"
FT                   /translation="MDLYIFHGIVALLVFCVIMAICIKWSMIIYNTLWSRRHVIGINDV
FT                   NENSSQPKVSIIVPARNEKGEIARCLDTLLKQDYHDYEVIAVDDGSNDGTYDIMKSFKD
FT                   RGILSMQTEKPDGWLGKSWACSEAAKRASGELLLFTDADTEHKPDSLSKAVSHMTAHGL
FT                   DCLSLTPQLKMDSVWARAVLPLITSFKLVKPCGIIQYTEAQANDPRCRMGGFNGSYLLI
FT                   KTDAYQKIGGFARVRNELFEDWALGLIARENMLKTRIADGRKLVSAAWARDRRSLNEIL
FT                   RRMTIQMHGRRKITNIKDFFLLAVLMFAPYIAAAASSLALILHTEVSTVMVTAGAAASV
FT                   FFHMAAYAIHAKGLGLSRRSVFLAPLGGFIAATGYLKGITAESTTWRGRRITTKDIADE
FT                   NIMLNNHVKAYKRFLAWWKEWIYPKYGEVPPPFHRRSWLVWGLIFGIVFIITYYLHVYD
FT                   QRFELKNAADILIINVEVLVTVLSVTLGATLLGIQFRAQSYSMLFLMKQINNLVVYLFV
FT                   GIFVSQVIINLGFIIWIPEKDLDVYIPFVFLGTVFSMFYLVGYIYHMIHKLHPHEIMNE
FT                   VGRDINKIVLEIGKCKKRNDNSYTSPFTTVNLDNWNAIMLKEKSHRSEYEKFDVWKEIM
FT                   LRTVKNDNVTLFKKGLEKIFEIYDKIMKLILDVHAVEINKLNQDVKYEINFANFGVIRH
FT                   KNYHKWEKEVRQLTLTLHFFVEYVNDIMISSIENNRDLCVLTFMRIFTRRDESYLRKYG
FT                   WHFGPGLMFDVWYDVMRRCIIEEKDDLIRQGIGHLEKRLKLQLSECKETCEDTIVRGVF
FT                   HHVLSSLVPLAMDKNSIYLNAYLDIVEIYQIPNMHELHECETKSCLHPISPWIVPVENR
FT                   PQLFELVKNGMHHPDGCSYIIDSAYGKRDLSLFSSGIDALFDSLIGTKYYPVKVIRYPN
FT                   PPERIPTNITFENISEEDIRFRWLYEALLDITENIEESEFIYEIVSKLEELKSNSHIDQ
FT                   IWLNFVSRIITLKNPGLNNIRSDLKNILQIINKPSLQTDYVELREKCQNILQEIPSSKN
FT                   EYVSLYHLERIGIDFLCENNK"
FT                   /protein_id="YP_875056.1"
FT   gene            complement(83933..84100)
FT                   /db_xref="GeneID:6370288"
FT                   /locus_tag="CENSYa_0108"
FT   CDS_pept        complement(83933..84100)
FT                   /locus_tag="CENSYa_0108"
FT                   /gene_family="HOG000105265" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein L40e"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575314"
FT                   /db_xref="GeneID:6370288"
FT                   /translation="MPITDVAKRQIAQKARLHMKICFYCGARNSMAATRCRKCRNNYLR
FT                   LKNRNLGAKK"
FT                   /protein_id="YP_875057.1"
FT   gene            complement(84130..85044)
FT                   /db_xref="GeneID:6370289"
FT                   /locus_tag="CENSYa_0109"
FT   CDS_pept        complement(84130..85044)
FT                   /locus_tag="CENSYa_0109"
FT                   /gene_family="HOG000239685" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="succinyl-CoA synthetase, alpha subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="COG0074"
FT                   /db_xref="GI:118575315"
FT                   /db_xref="GeneID:6370289"
FT                   /translation="MTDIIQLLRGTPGDSDYGKKPVVVQGITGKFGSTHTRLMKEYGTN
FT                   IAAGVTLREGAKDFEGIPLYGNIGEAVEATGAQISAMFVPAKFFLSAAKDALEAGIKLL
FT                   VAIPEHVPVRDTLELLELARKKDAIVIGPNTPGVIIPEVIKVGIMPAGPFKLGDVAVLS
FT                   KSGTLLYEISNALTQAGFGQAITIGIGGDPINGTRLIDAFEMVREIPGLRGLVVVGEIG
FT                   GDAEELLAQRITETKFNKPTVAYIAGRAAPKEKRMGHAGAIVMGNYGSAESKISMFNKA
FT                   NVPVAKRPAEVPILLARKIQGSD"
FT                   /transl_table="11"
FT                   /protein_id="YP_875058.1"
FT   gene            complement(85041..86138)
FT                   /db_xref="GeneID:6370290"
FT                   /locus_tag="CENSYa_0110"
FT   CDS_pept        complement(85041..86138)
FT                   /locus_tag="CENSYa_0110"
FT                   /gene_family="HOG000007059" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="succinyl-CoA synthetase, beta subunit"
FT                   /EC_number="6.2.1.5"
FT                   /note="COG0045"
FT                   /db_xref="GI:118575316"
FT                   /db_xref="GeneID:6370290"
FT                   /translation="MEYQAKELFAEYGIKVPQGRASKGIEQARKDAKDIGYPFVIKIQV
FT                   PVGGRGKAGGIQKCTNEDELVLRYPQVYDLTIKGERARAILLEKMADISKELYLSLFLN
FT                   RSKRCYTVIASAEGGVEIESVKSQIIKEVGLGKVSPEVAAQVASEMGLEGAAAKDLSDI
FT                   LQKLSLLTTEKEAELAEINPLAILSDGTLLALDGKVMTDDNAAFRHQELEKYRESSELE
FT                   ERAQKSGFSLVELDGNIAVVGNGAGLVMSTLDMLSDSGGRPACFLDVGGGATTESVYEA
FT                   LTLINKMDRVKGILVNLYGGIVKTTTIASAFLKAYDDGIVDLPVYARLRGAESDKAREM
FT                   LKSSSTNLYDTVEDAISAAVMGIEK"
FT                   /transl_table="11"
FT                   /protein_id="YP_875059.1"
FT   gene            complement(86244..86579)
FT                   /db_xref="GeneID:6370291"
FT                   /locus_tag="CENSYa_0111"
FT   CDS_pept        complement(86244..86579)
FT                   /locus_tag="CENSYa_0111"
FT                   /gene_family="HOG000105266" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575317"
FT                   /db_xref="GeneID:6370291"
FT                   /translation="MVKQISLDSWQVQHLVRLLRRGSADVNRTGTPILLYRQTLEEEED
FT                   CYEETICTLVVDHVIEQRVTSGGPVPPTFNEQLVYTIDEYPARLIRISRDRLQEIIALL
FT                   ESRFGQP"
FT                   /protein_id="YP_875060.1"
FT   gene            complement(86634..89813)
FT                   /db_xref="GeneID:6370292"
FT                   /locus_tag="CENSYa_0112"
FT   CDS_pept        complement(86634..89813)
FT                   /locus_tag="CENSYa_0112"
FT                   /gene_family="HOG000105277" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /EC_number="6.1.1.5"
FT                   /note="COG0060"
FT                   /db_xref="GI:118575318"
FT                   /db_xref="GeneID:6370292"
FT                   /translation="MELREKYDPKGIEEEVRSHLEGADLDRMIAESGNREEVMFIEGPP
FT                   TMNGPPHAGHLRGRVIKDLWYRYNTLRGKRVIFNAGWDTQGLPVELQVQKELGVAEGKS
FT                   ELVESMGIEKLVAECKALVGKYQVQWKEADRLLGVSLNQDKAYWTYRDDFIEREWQVLK
FT                   KANERGILEVDFTVIAYCPSCQASLSHAEVNQGYEEVSDPSLYYKVKLDDRDVYLIIWT
FT                   TMPFTLVTDAMVGLHPDEDYNHVRVGDETWIVGATRTAEFFKEVGIEEYSIEKSSKGSE
FT                   FEGLKYVHPLYEEVPALRELSGRGYHVAVSEEFVDASTGSGLVHLSPANGEEDIKIAHK
FT                   RGVEIFCPIDDEVKFTPDAGKYSGLFVRDADRVIVEDLKERGALVRIGKLRHKYPLCWR
FT                   SHHRIVWLARRGWFYKLGKLGSEVVDAAESVEYFFEQPRNRFLGIVKEKHPWCISRERF
FT                   WGCPLPVWNCTDCKNRNWLYSRQEIEAAAAEPPGKFELHRPWIDEVKIKCSKCGGTNTK
FT                   REQFVLDTWHNSGSAPFSSLTDNEYVQHIPAPFFTEGIDQTRGWAYTLLVENVIMSGSS
FT                   PYKSFLFQGHVLDKKGNKMSKSLGNMLEAGEMLREHPADLVRFYLMWKASPIEPLSFDA
FT                   NEMMSRPYQVLSTLYHLHLYFKQNSEYDGYGGGTAAEAKTAGLLRPPDIWILSKLQGLI
FT                   RDAAGYSERCRLHEYARSLESFIINMLSQVYVPIVRGELWDEDDSKKDRRMAIYAVISE
FT                   VLQALDVMLHPISPYTTEYLYQGVFRDKQSILLEGWPREDPLLEDRALEESFDLLRDAA
FT                   SAAAAARMKGKLKRRWPLVGGTVCVGSGQMSKIMPLYDLLLSQINLEKCDIVEVGAEDD
FT                   LGYLLALKRLGLPVSAEIKLDRKAVGPRAGRLMGGLVSAFEGMGREEIIASFEGYGSLK
FT                   VDVEGKEITLGPGDITVKIEAGEGFVFARHGDAAALISIYRSKELLAKGLVKDLARRLQ
FT                   KLRKDRAYRPTDMLEQACIDGLDPEQIAMIKERKDELAFLVRVNRIEIGGSCAEYSEEE
FT                   MDGQKIRISVE"
FT                   /transl_table="11"
FT                   /protein_id="YP_875061.1"
FT   gene            89903..91144
FT                   /db_xref="GeneID:6370293"
FT                   /locus_tag="CENSYa_0113"
FT   CDS_pept        89903..91144
FT                   /locus_tag="CENSYa_0113"
FT                   /gene_family="HOG000033463" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphoribosylamine-glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="COG0151"
FT                   /db_xref="GI:118575319"
FT                   /db_xref="GeneID:6370293"
FT                   /translation="MLVVGSGGREHALGWRLSQSPGVEEVFTAPGNGGAPGSVGIGFSD
FT                   LNALADFADENGCFTVVGPEAALADGIVDYFEDRGLGIIGPSKKASWLESSKIYAKEFM
FT                   ARNGIPTAEFASFDEPRKALVYAGSLSYDVVVKADGLAEGKGVVVCHSKQDAESAIDAM
FT                   LVDGKFGDAGRKIIVERRLDGIEASYIALCDGDSAIPMAASRDHKRAHDGDKGPNTGGM
FT                   GAYSPVPEMDGPMSKRIQDEIINKTVSCMKSEGTPFRGFLYAGIMIDKGRPFVLEYNVR
FT                   MGDPECQPLMMRADFDLYEYLSAATGGGLSGLPAPKWSSQHAACIVMASGGYPVRYDIG
FT                   EEITGLGDVPEDVMVFHAGTQQDGEKVLTSGGRVLGVTALGDTLSGAVSRAYDSVSKIS
FT                   WPGAQYRTDIGVRP"
FT                   /transl_table="11"
FT                   /protein_id="YP_875062.1"
FT   gene            complement(91134..91655)
FT                   /db_xref="GeneID:6370294"
FT                   /locus_tag="CENSYa_0114"
FT   CDS_pept        complement(91134..91655)
FT                   /locus_tag="CENSYa_0114"
FT                   /gene_family="HOG000007299" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /EC_number="6.3.3.2"
FT                   /note="COG0212"
FT                   /db_xref="GI:118575320"
FT                   /db_xref="GeneID:6370294"
FT                   /translation="MLLSRRDSLSHDIIRIAEAKIARRMGKIPEFAKARSVACYYSMGS
FT                   EVPTHTLMQGLLDSGRKVCLPSIPGEDLVFREVRDLGRLESGKFDIMEPRNDCEECIDP
FT                   DVIIVPAVGTARDGSRLGYGRGYYDRFLAGLDIPSIVPCYSKQLVKSVPTEEHDIPVNW
FT                   IVTEDETIRV"
FT                   /transl_table="11"
FT                   /protein_id="YP_875063.1"
FT   gene            complement(91675..92523)
FT                   /db_xref="GeneID:6370295"
FT                   /locus_tag="CENSYa_0115"
FT   CDS_pept        complement(91675..92523)
FT                   /locus_tag="CENSYa_0115"
FT                   /gene_family="HOG000218242" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="5,10-methylene-tetrahydrofolate
FT                   dehydrogenase/methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="1.5.1.5"
FT                   /EC_number="3.5.4.9"
FT                   /note="COG0190"
FT                   /db_xref="GI:118575321"
FT                   /db_xref="GeneID:6370295"
FT                   /translation="MDGKAVAAAVKERVKMAVAELKSGGTDPCLATVLVGDDPASGTYV
FT                   RNKHAACAEVGITTQDHRLGPSTTEGDLLKLIAELNSDRSVHGILVQMPLPEGIREIKV
FT                   VSAISPLKDVDGLTPLNAGLLTAGTATLIPCTPLGIMEMLDYYNIELEGKEVVLINRSR
FT                   LVGIPLHHLFLGRNATVTTCHSRTKDIGSISRRADVIVTAVGNRDKFVLTPDMVKEGAV
FT                   VIDVAISRSDRGLTGDADYAAVSEKASHITPVPGGVGPMTVAMLLKNTTTAASLVKSLE
FT                   R"
FT                   /transl_table="11"
FT                   /protein_id="YP_875064.1"
FT   gene            complement(92598..92918)
FT                   /db_xref="GeneID:6370296"
FT                   /locus_tag="CENSYa_0116"
FT   CDS_pept        complement(92598..92918)
FT                   /locus_tag="CENSYa_0116"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575322"
FT                   /db_xref="GeneID:6370296"
FT                   /translation="MPMKVVLHLLWHEKRHSGRYRMIFFTYAEKAVSFDHIVYLICIVG
FT                   LLRILIPGVKTEDARRQGIPVYERVVIPGSTQLCRILGDVKLCLHNMGGLLRIFKSWAG
FT                   LS"
FT                   /protein_id="YP_875065.1"
FT   gene            complement(92960..93535)
FT                   /db_xref="GeneID:6370297"
FT                   /locus_tag="CENSYa_0117"
FT   CDS_pept        complement(92960..93535)
FT                   /locus_tag="CENSYa_0117"
FT                   /gene_family="HOG000033575" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="folate-dependent phosphoribosylglycinamide
FT                   formyltransferase"
FT                   /EC_number="2.1.2.2"
FT                   /note="COG0299"
FT                   /db_xref="GI:118575323"
FT                   /db_xref="GeneID:6370297"
FT                   /translation="MEAIIKHVQKRRVPANLAVVISSRSDARGLRIAERLGVDTEVVES
FT                   RGFSGTRKEYDRKVMAALRRHGVTRRDGLVCLAGFMRIIGPECVKRYKHRMLNIHPALL
FT                   PSFRGIDAQKQALEYGAKVSGCTVHLVDEGTDTGPVVAQSVVQIREDDTEESLSKRILA
FT                   REHKIYPYTVELFARGKIQVKGRRVCVG"
FT                   /transl_table="11"
FT                   /protein_id="YP_875066.1"
FT   gene            93587..94630
FT                   /db_xref="GeneID:6370298"
FT                   /locus_tag="CENSYa_0118"
FT   CDS_pept        93587..94630
FT                   /locus_tag="CENSYa_0118"
FT                   /gene_family="HOG000105288" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="exonuclease of the beta-lactamase fold"
FT                   /transl_table="11"
FT                   /note="COG1236"
FT                   /db_xref="GI:118575324"
FT                   /db_xref="GeneID:6370298"
FT                   /translation="MCVIPAVYINYTSGGACLTSVNTNSIRMTDNGISCELNGQKIYMD
FT                   PKRAAADALNFLSHGHTDHLPSGGTGRLLASKETARIASLRGTKMENHVDGMDGLEMID
FT                   AGHILGARGLLADGVFYTGDICTRERGFLPGARVPKCEVLITECTFGLPEFSLPSLDEV
FT                   KVETNRIISEAYSSGRPVILMGYQLGKAQTLSHLFGHWDPLYYHDSVKKMNDLHREMGV
FT                   PLRDVPGHSEVESEGLLDKGPWVMVAPMMTDRNAFVRRMRIKYNAVMVSFSGWARSPRF
FT                   SFGQRGDHSVPLSDHCDYNELVKMVEDSGAKTVYTIHGFTDEFAADLCKLGYDARPLRA
FT                   QSLDCFV"
FT                   /protein_id="YP_875067.1"
FT   gene            complement(94631..94870)
FT                   /db_xref="GeneID:6370299"
FT                   /locus_tag="CENSYa_0119"
FT   CDS_pept        complement(94631..94870)
FT                   /locus_tag="CENSYa_0119"
FT                   /gene_family="HOG000105299" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575325"
FT                   /db_xref="GeneID:6370299"
FT                   /translation="MEKEFDSEALYNHIVHFYIDKKGCSVEKANTIAQSVIRREIERRM
FT                   CKNGDCGHSMDDHIRNTGTCLIIECECRKFRGLT"
FT                   /protein_id="YP_875068.1"
FT   gene            complement(94871..95185)
FT                   /db_xref="GeneID:6370300"
FT                   /locus_tag="CENSYa_0120"
FT   CDS_pept        complement(94871..95185)
FT                   /locus_tag="CENSYa_0120"
FT                   /gene_family="HOG000225449" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="COG1522"
FT                   /db_xref="GI:118575326"
FT                   /db_xref="GeneID:6370300"
FT                   /translation="MQDWWREYGRVSMRTFEIDGSPTISMEKVYVLIQCDLGKETDIIA
FT                   ELTGIPEVKEVRGTYGIYDIFCKIEAERDVLDKIIAKIRQIPRIRSTITLHWIPSQGGR
FT                   "
FT                   /protein_id="YP_875069.1"
FT   gene            95798..96217
FT                   /db_xref="GeneID:6370301"
FT                   /locus_tag="CENSYa_0121"
FT   CDS_pept        95798..96217
FT                   /locus_tag="CENSYa_0121"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575327"
FT                   /db_xref="GeneID:6370301"
FT                   /translation="MHHEGHEARPSQSALAGSRDAGSVGLYKVLPDAGVHVLHKRNKYN
FT                   QLSLGKIRNNAGLSKRSINVEYYFSRMKNYAILLGPHKDGAGYLDQIICAATCLADMWK
FT                   IQQTRMTNGGVMTPIRTAILGCTVELYDCALPNKF"
FT                   /protein_id="YP_875070.1"
FT   gene            complement(96310..98928)
FT                   /db_xref="GeneID:6370302"
FT                   /locus_tag="CENSYa_0122"
FT   CDS_pept        complement(96310..98928)
FT                   /locus_tag="CENSYa_0122"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575328"
FT                   /db_xref="GeneID:6370302"
FT                   /translation="MLVRIECRSVLAYHVAMLWSTSIRDLTHNLPLQHRICYISVIGSY
FT                   SILGLWKRFQECECCTQNDSYRLIRSFFCKNSSDNELPRLFKRGSRIFCLGFFVISLII
FT                   LSLYPIDGNIANDDVANILMINAEILVTTLAVTLGATLLGIQFRAQSYTMIGMIHQMKN
FT                   YVLYTFIFIFISLIVLSTMTVVYITYLPGDSMKSTEGEHADPEHKIVVVLPFIFLGTSF
FT                   SMLYLAGYVYYIINKLQPDQMMAEVVKDMNNALFIENDNFAIDLFKIVNEDLDRENLSK
FT                   KYHDIKTKFAVWEQIMLRAVELNNILIFKMGLEKMFDIYNRVKDVGDVSINDISKNFKR
FT                   NEYIGELLFERNMQFKKLFEIYHFITKNADSFEVTKLLKYEKINEFLCDRIEELQSDKK
FT                   IQLSKLIETYDNVIKSNDIGTEKLTNDDDTKLSIKGYYDILERKEQYSPMVDSLLKNKK
FT                   SKNILYQQIRKLSINEKIEIIQKLYERFLYKATIQSIQEFNKDLFFEHISEVILGCVQH
FT                   DRQQCSSEFFQLYINDEEPIPTPQEFLEKTYRNTMIRLWHMMMKNSILDGKTHITRLGM
FT                   NAFNIKLSIDSQSKNTQWATWYYDNTIASLVEWATDPNIKTGNECLLAYLKYFGRHILP
FT                   RWDLLEKIKSESGDDTDEKESEKIDEIIVPGKPGVSSVYQLVGSPAVKMWRSIMSHAYV
FT                   KKNMLIFLAGLNEMLNKLQKENDMEHRMSINALSELMMEILKLDLAIDGKESRSITSSE
FT                   LFYSRQYIEYFLQIFADLSWKWPVKDLQITLLWIKCLKIIIKNRELNSIFYTRSELNKY
FT                   LKQYQTIKESINFKEHKDRLNGVKDELEIVMDGLRDYKIEEEINNELSESMDSVEKSSH
FT                   I"
FT                   /protein_id="YP_875071.1"
FT   gene            99306..99473
FT                   /db_xref="GeneID:6370303"
FT                   /locus_tag="CENSYa_0123"
FT   CDS_pept        99306..99473
FT                   /locus_tag="CENSYa_0123"
FT                   /gene_family="HOG000105320" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575329"
FT                   /db_xref="GeneID:6370303"
FT                   /translation="MATCSECDGSIHVPADSLEGEIVTCPECGAGFELVKTQEGFELKP
FT                   AQTVGEDWGQ"
FT                   /protein_id="YP_875072.1"
FT   gene            99470..100318
FT                   /db_xref="GeneID:6370304"
FT                   /locus_tag="CENSYa_0124"
FT   CDS_pept        99470..100318
FT                   /locus_tag="CENSYa_0124"
FT                   /gene_family="HOG000228553" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glutathione synthase/ribosomal protein S6
FT                   modification enzyme (glutaminyl transferase)"
FT                   /transl_table="11"
FT                   /note="COG0189"
FT                   /db_xref="GI:118575330"
FT                   /db_xref="GeneID:6370304"
FT                   /translation="MTRCLTVLYDTIRWEEKALLEAGKKKGADVRMVDCKKLALDLDGD
FT                   SGTEYGTVLQRCVSYYRNVHSTAALEGMGVPVINCLRTGMLAGNKLYTHMLLRKKGVAT
FT                   PAATVAFSREAALESLDKGGYPRVIKPTVGSWGRMIAKLNDHDSAEGIMELRDGMYPIY
FT                   QIHYLEEFVKRPPRDIRVIMVGDKAVAAIYRYSGDDHWKTNMALGGRAEPCPVGQELEE
FT                   ICIKAKDAVEGQIVGVDLMESDERGYVVHEVNNTTEYKNTVRVCEVDIPSLMIDYALDR
FT                   C"
FT                   /protein_id="YP_875073.1"
FT   gene            100362..101444
FT                   /db_xref="GeneID:6370305"
FT                   /locus_tag="CENSYa_0125"
FT   CDS_pept        100362..101444
FT                   /locus_tag="CENSYa_0125"
FT                   /gene_family="HOG000105331" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acetylornithine
FT                   deacetylase/succinyl-diaminopimelate desuccinylase"
FT                   /EC_number="3.5.1.-"
FT                   /note="COG0624"
FT                   /db_xref="GI:118575331"
FT                   /db_xref="GeneID:6370305"
FT                   /translation="MLEKALRLYTPSMAEKPMAEFLADKCDDLGFEDITIDDVGNIIAT
FT                   RGSGPPHVMLCGHMDVVPGKVRVRRDGDRLYGRGASDAKAPLMAMLFAAAAMPHDGGTV
FT                   KFVGAVDEEGNATGIKHLVKQDLDVDYAVFGEPSGLRQVTIAYKGRLAINLRISAEDSS
FT                   HASAPWLSKNAIEEAMLFCGALREELGTGQEGRSKGMMLTSALTEIKGGTSHNVTPKEC
FT                   EAVMDIRVPVDATCKGVEERISKSVKRISRERGIEAFYSILDETDPFEAPHDSPLVRSF
FT                   NLGVMDVEKCRPTLIRKTGTGDMNVVGNRLGIPVVTYGPGDPHQAHTINEMVSISEYLS
FT                   GIEVLKRMLHHLKRLHERKR"
FT                   /transl_table="11"
FT                   /protein_id="YP_875074.1"
FT   gene            101444..102481
FT                   /db_xref="GeneID:6370306"
FT                   /locus_tag="CENSYa_0126"
FT   CDS_pept        101444..102481
FT                   /locus_tag="CENSYa_0126"
FT                   /gene_family="HOG000105332" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="diphthamide biosynthesis methyltransferase"
FT                   /EC_number="2.1.1.98"
FT                   /note="COG1798"
FT                   /db_xref="GI:118575332"
FT                   /db_xref="GeneID:6370306"
FT                   /translation="MLWFVGMGLAGAGSIPADAKNVIEQAEMVYLEGFTSIVTESDERA
FT                   LEEMAGGKIIPARRWMVEDGKEILDNARTKKVVLVSYGDPYTATTHIELRTRAAELNIP
FT                   TGSIHAASILASAVGECGLHHYKMGRTATVTRDPRAASTPYRIIYENLVSGSHTVLLLE
FT                   YDQDGGFFLDPGDALGLLIEYEKEQRRGVITDELFAVIASRIGMKGQSIVAGRISSLKG
FT                   YDFGAPPHAVIIPGGLHFTESEALSASAKCLDAPSDNSERMPSIPQQMVKKYVPMVRDA
FT                   MKTIEALEDNPPEYGHVLENAGHYLRDAEEFMGKGEGELAVLSVGYADGLVDALRMARG
FT                   IDRVQ"
FT                   /transl_table="11"
FT                   /protein_id="YP_875075.1"
FT   gene            102510..103118
FT                   /db_xref="GeneID:6370307"
FT                   /locus_tag="CENSYa_0127"
FT   CDS_pept        102510..103118
FT                   /locus_tag="CENSYa_0127"
FT                   /gene_family="HOG000105343" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytidylyltransferase"
FT                   /EC_number="2.7.7.39"
FT                   /note="COG0615"
FT                   /db_xref="GI:118575333"
FT                   /db_xref="GeneID:6370307"
FT                   /translation="MDAIDNLILSSIYVSSLDGSEPLAAARKSMIPEDMLQERMASLAS
FT                   RGAIENNALTELGRSSLRVVFAGGVFDIIHPGHIHTLNAAKKLGDILVVTVATDSTVKK
FT                   MKKHAPLHTQEQRKDLVSSLHMVDLCLVGDERDMFRTVEKVRPDVIALGYDQVHQEKYV
FT                   TDGCSKLGLSIAVARLQSPVPEISSSTIEKEYGEAIHDT"
FT                   /transl_table="11"
FT                   /protein_id="YP_875076.1"
FT   gene            complement(103115..103696)
FT                   /db_xref="GeneID:6370308"
FT                   /locus_tag="CENSYa_0128"
FT   CDS_pept        complement(103115..103696)
FT                   /locus_tag="CENSYa_0128"
FT                   /gene_family="HOG000015512" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator of a riboflavin/FAD
FT                   biosynthetic operon"
FT                   /transl_table="11"
FT                   /note="COG1339"
FT                   /db_xref="GI:118575334"
FT                   /db_xref="GeneID:6370308"
FT                   /translation="MGISQQAASQHLRELEDEGLITRNAEGKGISVMVTDKGRHELLRV
FT                   YNILHDSLHSRPDHVEITGTLVSGMNEGAYYMSREGYTGQFQERLGYVPFPGTLNVDTD
FT                   RKHGPEIARLDGMNGTIIDGFTDGKRSYGWVKCFAGTLNGTIPCHLIRLERTHHGSSTV
FT                   ELISKLDIRKETGLDDGGKITIRIPLEQED"
FT                   /protein_id="YP_875077.1"
FT   gene            complement(103800..104867)
FT                   /db_xref="GeneID:6370309"
FT                   /locus_tag="CENSYa_0129"
FT   CDS_pept        complement(103800..104867)
FT                   /locus_tag="CENSYa_0129"
FT                   /gene_family="HOG000105364" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="bacterial-type DNA primase"
FT                   /transl_table="11"
FT                   /note="COG0358"
FT                   /db_xref="GI:118575335"
FT                   /db_xref="GeneID:6370309"
FT                   /translation="MGAIYGQTEGLLGPEMNLNELQRLSKIGRIDATARQAVNKTHGSV
FT                   LVPTSTDIDTCALIAASIESIDKVGPFDCKFSLESIDDVRAAKKDDIVRRAKEIKQKWV
FT                   TKTVSEGDTMLKDVHEGASHGKVQSFGPAKLACSPGIHSSNWIILVEGRADVINLLRAG
FT                   YDNALAIEGAKIDESIKEICDSKDRVVAFMDGDRSGGFILKELKTLVSVDESIRADPDT
FT                   EVEELTPQRIAEILDPIAAKIREELEPAKLKDEADKPIAEVASSIYPGLNETLEAVALD
FT                   DDRKEAFRVPISELVTKLSKQSGLKYLVLDGIVTQRLLEAARNAGVKCVIGHRSAKLAN
FT                   SHGLTIKSFGELGVS"
FT                   /protein_id="YP_875078.1"
FT   gene            104967..105185
FT                   /db_xref="GeneID:6370310"
FT                   /locus_tag="CENSYa_0130"
FT   CDS_pept        104967..105185
FT                   /locus_tag="CENSYa_0130"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575336"
FT                   /db_xref="GeneID:6370310"
FT                   /translation="MVGAPTIGYMCLSPEIPPWCRADQGLGWAPGVWTGLQKCRTAGLG
FT                   GRGWLDTGPCRSGTSIPGWIWRLVSAC"
FT                   /protein_id="YP_875079.1"
FT   gene            complement(105653..106003)
FT                   /db_xref="GeneID:6370311"
FT                   /locus_tag="CENSYa_0131"
FT   CDS_pept        complement(105653..106003)
FT                   /locus_tag="CENSYa_0131"
FT                   /gene_family="HOG000228313" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG0316"
FT                   /db_xref="GI:118575337"
FT                   /db_xref="GeneID:6370311"
FT                   /translation="MATEQTTKMVTVTEKAAAKIKEFMSEEGEQSQYLRVYVQGGGCSG
FT                   LSYGMGFEKTAEEDDTVIEESGVKLLVDSYSQDHLNGASVDYIESLMGSGFKINNPNVT
FT                   KSCSCGHSFSTE"
FT                   /protein_id="YP_875080.1"
FT   gene            complement(106110..106769)
FT                   /db_xref="GeneID:6370312"
FT                   /locus_tag="CENSYa_0132"
FT   CDS_pept        complement(106110..106769)
FT                   /locus_tag="CENSYa_0132"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575338"
FT                   /db_xref="GeneID:6370312"
FT                   /translation="MHSLPHSSCEVTSCAVPLASRSMCAQQLCMTGNILYDPGPLQTIF
FT                   MPCGKRSTGTCIDRLPSMSTTVYSLLQNRHEGGDAAPQSLPSPAALHPSPYPPCSSRRS
FT                   SSRPSSPQGPPAGSWAFLRRARRPAAAVLLLELPDPFAGFLQLFSSLLEPVISPSGALL
FT                   VGCQIRRQSSHGRLELGGTLVILLHRGLVSLLQLYRTGKLHAQQHDIGAHMDNAIS"
FT                   /protein_id="YP_875081.1"
FT   gene            106847..107143
FT                   /db_xref="GeneID:6370313"
FT                   /locus_tag="CENSYa_0133"
FT   CDS_pept        106847..107143
FT                   /locus_tag="CENSYa_0133"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575339"
FT                   /db_xref="GeneID:6370313"
FT                   /translation="MPGRAGWQRSTRRRAIRLGKKLANAEPNLFTFLFYHDIQPANNAA
FT                   KRAIKAIIRQGRCREQLKTAGGMMTFSVLMAYLLTWKQQDTSIRVGILAQIRT"
FT                   /protein_id="YP_875082.1"
FT   gene            complement(107260..107460)
FT                   /db_xref="GeneID:6370314"
FT                   /locus_tag="CENSYa_0134"
FT   CDS_pept        complement(107260..107460)
FT                   /locus_tag="CENSYa_0134"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575340"
FT                   /db_xref="GeneID:6370314"
FT                   /translation="MIAHHPHGLRQRLGVRFATKLKNAQLHLFTFLRYEDVEPTNNAAG
FT                   TALKAAVRQGGAGSSSNQSEA"
FT                   /protein_id="YP_875083.1"
FT   gene            107643..108083
FT                   /db_xref="GeneID:6370315"
FT                   /locus_tag="CENSYa_0135"
FT   CDS_pept        107643..108083
FT                   /locus_tag="CENSYa_0135"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575341"
FT                   /db_xref="GeneID:6370315"
FT                   /translation="MGHNGLGQYYKASSDGLTLRVSSVKSNLKVKSFYSALNGAAMEEI
FT                   SIFYKKSQVHILPLAMAAGKEVGIRLSLEKASKSASKDVLAEERMWMVCCIALLKNGAL
FT                   GLFAATKTPPGIYGGRANGGIGFLIQLNRGMTTNSKPYKGFQ"
FT                   /protein_id="YP_875084.1"
FT   gene            108136..110394
FT                   /db_xref="GeneID:6370316"
FT                   /locus_tag="CENSYa_0136"
FT   CDS_pept        108136..110394
FT                   /locus_tag="CENSYa_0136"
FT                   /gene_family="HOG000105371" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575342"
FT                   /db_xref="GeneID:6370316"
FT                   /translation="MTRLTKFRAGCNVMGKGIWNRDRKKVVNLVIEVNKKCPHVLLPEF
FT                   VEDYNAEIGVTEMMKKYNIHDSIHFDYLVKKVFKQDNHSIDRRGSKYSNRYEVITKECS
FT                   SIRTPICGLLHDSIRETVFIHAALEEQHAQRGNIAYVVSDVYPKISPLLPLLKIKSIKS
FT                   SFDHYMGGNLAANSDDIINEIKVEHGLSITDKGTSGSEKHLPAEGALYDLVKKHKKGIS
FT                   YNSIIWEIEERFPLLRMLIGVGKIDELLDKLVNEKKLLRTYDFKRTSSIHDQFFTPENH
FT                   KALMKTTKEDYKKTNKDPAKIGKDEFFGRKIDPDRFIDELVELEKGDLDDCDDQVARIT
FT                   GLVLSHAALLRSPRETGKKFDFIVDLKDDNFSADHQKLMKNQDFEANKDDIFHCKVMIN
FT                   KKVTIAIIEDLIKSIPSGDKGVIFTCRRVDPSVRQYTHEDRTVQIIDEEGIQGWCHITP
FT                   TIPCRRHSVARIMCGKEKGSMVLVKSLNYESGQALVEIIPGGIETTFAIGYMQEIDLHV
FT                   PLDVNFESVSNKYFDIVSMLAKLSDDDFKIGMGLDTSTMHSTHENVQQSTRSKRHGGID
FT                   PPVDPMPADGGVPTHIKFKDAHVELRHSSSNSQNCFHCTCDKWSDKTHYHALCSHLTSA
FT                   INHYCVSPAGWQEINKRIKLMTRELEEFQMNNLQRMTQAVHEALDTNHKKLFARYMRAH
FT                   AEEDEEGGTDATDAAKIALAIKENLQNEPDTLQLFEKLCEILPSFDGDGLKNVANKLE"
FT                   /protein_id="YP_875085.1"
FT   gene            110465..110722
FT                   /db_xref="GeneID:6370317"
FT                   /locus_tag="CENSYa_0137"
FT   CDS_pept        110465..110722
FT                   /locus_tag="CENSYa_0137"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575343"
FT                   /db_xref="GeneID:6370317"
FT                   /translation="MDHVQVFSSHASVGKILYMPCLRGSRASVYTLPLRNLPIITPIRP
FT                   NSTMLTTCTADFVCMQDPLSHVDVHQTPPLYPRISFCGAL"
FT                   /protein_id="YP_875086.1"
FT   gene            110771..110971
FT                   /db_xref="GeneID:6370318"
FT                   /locus_tag="CENSYa_0138"
FT   CDS_pept        110771..110971
FT                   /locus_tag="CENSYa_0138"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575344"
FT                   /db_xref="GeneID:6370318"
FT                   /translation="MPPSTGKSRGRHLETFRGKSASKEVPTDNPPPRLVRIEMASRYDL
FT                   CIKQVRINSEIFLSLSMPAFP"
FT                   /protein_id="YP_875087.1"
FT   gene            110968..111141
FT                   /db_xref="GeneID:6370319"
FT                   /locus_tag="CENSYa_0139"
FT   CDS_pept        110968..111141
FT                   /locus_tag="CENSYa_0139"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575345"
FT                   /db_xref="GeneID:6370319"
FT                   /translation="MSDIFEYVPLDKIKVKKHSVRLHGIEQGIEDPAESTKANGLLQPI
FT                   AAYYDSAKSTCL"
FT                   /protein_id="YP_875088.1"
FT   gene            111138..111797
FT                   /db_xref="GeneID:6370320"
FT                   /locus_tag="CENSYa_0140"
FT   CDS_pept        111138..111797
FT                   /locus_tag="CENSYa_0140"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575346"
FT                   /db_xref="GeneID:6370320"
FT                   /translation="MTDSDLVQAVAKIYNTYGSYDLVKEKFDLSTQMINKYVRLARLPP
FT                   ELKHAIKEGKIHSNPKKAENAVLKAVEAFNYVTGGSIPVDRVIELAKYLAKPDIGLSDD
FT                   VKIKKWVGENPDLSMNECIENARQLKPVEETTHMVVIEIQDELRAFMEANIDYEEKILG
FT                   MLRENLPGTFYAVNAGNSVAAISMDEEAYKIFYREQYEKNSSYTIFLNNFLAEWVR"
FT                   /protein_id="YP_875089.1"
FT   gene            complement(112016..114631)
FT                   /db_xref="GeneID:6370321"
FT                   /locus_tag="CENSYa_0141"
FT   CDS_pept        complement(112016..114631)
FT                   /locus_tag="CENSYa_0141"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575347"
FT                   /db_xref="GeneID:6370321"
FT                   /translation="MDSIRRGFCTCTLHYFCKNASDDGLPRVFKRHFRVFWAAIIVAGL
FT                   YLCLDLDIGNTIENRDAATILVVNAEILVTTLAVTLGVTLLGIQFRAQTYTMIAMMQQM
FT                   QNWVVYGFVIVFISLIVLSMIPVGYAAYLQDAGPAGNPAGAEPAYRIAVFIPVLFLGTA
FT                   FSMLYLAGYVYYMINKLQPDQMMHTVVDGIRDALSGRSGNAAVDVFVKICNDGKKGHDF
FT                   KEKFAVWEQIMHRAVELNNTLLFKLGLERLMAIYDDVIRGMGDVGRMEGSKVYEMIKDE
FT                   TARESLRGEAGRLPDGKREVTVMLRREKRLFFRYINEVMLACVQYSRKTCSSEFFGEFV
FT                   RNKEPIPTREELRTSAYKNMMFDVWSTVMITSILGAKDQIMRRAVQNLFKKLETPAMEK
FT                   NRRWTMAFFHSRIASLVEFAMDPTINTNNQYLLHYLTAFGHYEFPKNARGITARQEFAD
FT                   DRDGKKPPQGTGHVLDANQVAMPSPTEAWSMIMNHAYAQKNTVVFDAGLEAMKKSLQRI
FT                   RTGTEYRMSIDALSELMGEVLKRQPPGNAEYDYSKRCASSFLKCFTASTWVWLFHDIRI
FT                   TRLWMECIRIIIDAREESTIKYCLERLESHPGDGGEGPYLRSEAPGGDSNVGAGKTGSS
FT                   PETAKSILQDLRLKLDTLTHMPEVDDKAWASIPGKLEDLGDKYLRQFLLTCANGTGTQC
FT                   LELQTSEIFRNGMLRFYHSDIGTVRQIMDELRLAVESFHGRKIDASMKHALPCYETRES
FT                   LLDNLLRFSDSGKVQELFEILRLYEKYNFYAAFYDYVTEGKRRDTVVNNIYSAIDLKDR
FT                   ELVKYTLEYFQNDPDTANRNDLKESIGLQLEKLNENAEWDKIESIVELSMELKLPLARQ
FT                   "
FT                   /protein_id="YP_875090.1"
FT   gene            complement(114822..117080)
FT                   /db_xref="GeneID:6370322"
FT                   /locus_tag="CENSYa_0142"
FT   CDS_pept        complement(114822..117080)
FT                   /locus_tag="CENSYa_0142"
FT                   /gene_family="HOG000105382" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="helicase"
FT                   /EC_number="2.7.7.-"
FT                   /note="COG1203"
FT                   /db_xref="GI:118575348"
FT                   /db_xref="GeneID:6370322"
FT                   /translation="MPDFAEFFTTATGHLGGPPPYQERIAGTTFEDIPDTLILPTGSGR
FT                   TETILSLWLWRIYSKEPGIPRRLVYCLPSGALTEHTAIKVKKWLWNLKLNRKVDIRFLA
FT                   GGSEGYMSNINLGRECIIVGTQEVLLSGALNHMYGQRPGIWPIASALLNNDSMWVMDEA
FT                   RTMGAGLGTSLQLDAFRRACGTFGPSRSVWISAVKGPLGTKDNPEKNRRVLSIEDPAGD
FT                   GARIRRIDLPTRDGRYTDTDAKKLLDLRGGGSMAVILNSVDRAQRLYSAVKGVQGQMRC
FT                   VLVHPRFRADDRARLSREIHGINEDTNVVVISTQALESGTDLSVQTLVTELAPWPAMVN
FT                   RIGRCRGADSSAYWIDIDGPYRPHNPVYDEMGGSRKVLEEIEGRAVPASTLPVSPGTDD
FT                   IHGAISLQEVKKLYDTTQDIGGDPVDVSRFVGDDNPEALVFWSREGRRSRWNELCGMEL
FT                   GELRRFVSGHRGMCTCWDSKTMKWAEMGDDDAYPGMIARIEPSAGGYSQEMGLYTGYRG
FT                   PVGEVFPQARQDRRSGRDVTLREHTQDVVDEADWILSGLGVGAEYSNAVRTAAQWHDVG
FT                   KMHRIFQEFLGPNVEGTSDEIWAKSGRKEYDKDAKDRRDYERHGFRHEVASAMAFTAVH
FT                   DGEEHDLAAYLVMSHHGIVRVVLRGPADVPGDMIAGVVHGEALSDRGYSVHEGVTVPAG
FT                   IILDTSISGKGERRPWSARTSSLLDGHGPFRLSYLESILRKADWAASAKEDLAPDGKR"
FT                   /transl_table="11"
FT                   /protein_id="YP_875091.1"
FT   gene            complement(117408..119030)
FT                   /db_xref="GeneID:6370323"
FT                   /locus_tag="CENSYa_0143"
FT   CDS_pept        complement(117408..119030)
FT                   /locus_tag="CENSYa_0143"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575349"
FT                   /db_xref="GeneID:6370323"
FT                   /translation="MSQDRQKEAGANDGENVKTAEFSYRKDEGLVAGYATECVGQGPGI
FT                   LYITTQRLVFYSQKHGIRLNLDYEHLFDWRIIGDTLKIRWQELKHGQAQHRLEDEIFEL
FT                   VFLFKSGYEWIIHMIIYATYTSRFPTGNAGLGWYLNEKAELLHRYDDEPRVYDVKLPLC
FT                   IRDITLGIDMENKLTARAKILPPGEDFRIDDHTGELILEQSVYKWLKIRHAQRDDGTWS
FT                   CHEGYIRPGSIKDNGKGIIMDIIKNEVKCEISDGITAHKELIDDITAGKVEASTAFIPA
FT                   VKLHGEEICAADDLEDRLKYLAEKLVVMPRVYELMKGEDFEYTRQAALFRDELQLRLTM
FT                   QLRAGKDITGFAPDIQKAPQMRLKDGISVADVLKKYRGRLIEDGMYDAVYGDHGPDPDV
FT                   EKHLAAHEYWYAHLPDMYTYEIPESRLEMEARIDAARSDVEENSMQDGMDMLAREGIIK
FT                   DGWDHSKSALYNRANLHEQLERKMANPNSPLLMEDVDKISLVTGRFWTFIHLIKYSERY
FT                   RDDTADYLVEIAEKMNSLRISKV"
FT                   /protein_id="YP_875092.1"
FT   gene            complement(119027..119233)
FT                   /db_xref="GeneID:6370324"
FT                   /locus_tag="CENSYa_0144"
FT   CDS_pept        complement(119027..119233)
FT                   /locus_tag="CENSYa_0144"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575350"
FT                   /db_xref="GeneID:6370324"
FT                   /translation="MATASSHMCLTHVMEKEISWQNVQAEYAFLDSVRPGSDVSKASKS
FT                   INNPVSPPRYAGDRVCKTSPESK"
FT                   /protein_id="YP_875093.1"
FT   gene            complement(119261..119425)
FT                   /db_xref="GeneID:6370325"
FT                   /locus_tag="CENSYa_0145"
FT   CDS_pept        complement(119261..119425)
FT                   /locus_tag="CENSYa_0145"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575351"
FT                   /db_xref="GeneID:6370325"
FT                   /translation="MIRHLSLKQASLKGFARVGISGPPACTGQPCTQALSEMKNAHNDS
FT                   TRTGQRSRS"
FT                   /protein_id="YP_875094.1"
FT   gene            complement(119425..120249)
FT                   /db_xref="GeneID:6370326"
FT                   /locus_tag="CENSYa_0146"
FT   CDS_pept        complement(119425..120249)
FT                   /locus_tag="CENSYa_0146"
FT                   /gene_family="HOG000105393" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="bacterial-type DNA primase"
FT                   /transl_table="11"
FT                   /note="COG0358"
FT                   /db_xref="GI:118575352"
FT                   /db_xref="GeneID:6370326"
FT                   /translation="MSGAQRFKNTICMHYTVHGKVSEYQVESTVLSVIWDEYVSDGTIF
FT                   NQTLRVLKNMGYISSVKVDVESNDKDTIGSVIIHVGSNLDCGLMSSKIKRLGWVHKFPA
FT                   KFKTGYVGPTSKFSNYMTSHMLNRATANSALASDGGADLGKLKHGRTAYQEKWIILVEG
FT                   AADVAHLARIEYQNTMEIGGARLDDRALDLARTKEKVVAFMDGDDKGADNLRRLRSILN
FT                   IDEGLLADRGVEVEELGLDRIMDLLKPAVKRIKKEMRDGSRKSRTDAHTAEI"
FT                   /protein_id="YP_875095.1"
FT   gene            complement(120522..123233)
FT                   /db_xref="GeneID:6370327"
FT                   /locus_tag="CENSYa_0147"
FT   CDS_pept        complement(120522..123233)
FT                   /locus_tag="CENSYa_0147"
FT                   /gene_family="HOG000105382" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="helicase"
FT                   /EC_number="2.7.7.-"
FT                   /note="COG1203"
FT                   /db_xref="GI:118575353"
FT                   /db_xref="GeneID:6370327"
FT                   /translation="MQSPPKISHTQQSGFQLVFRHLPIDGIIHVYRILESSGHPIRGFG
FT                   RGILFYQYVPRIFSLGTKPALIPKELLTTRSHHPHGLWHYPAAQGACLCDRARKGIRVH
FT                   DAGKWQAHRRTRVSHVGTVSRSGSLPESRENEPGGGLGMPDFASFFTTATKHPRGPFPY
FT                   QEKLAYTSFGEIPDTLILPAGSGRTEAAVLSLWLWRIYCREPGIPRRLVYCLPSGALVE
FT                   QIASRARGWLWNLKWNKKVDVRYFMGGSEGYASNIDLAKPCIMIGTQDILLSGALNHMY
FT                   GQRAGIFPVAAAMLNNDSIWIMDEAQTMGAGLGTSLQLDTFRRICGTFGPSKSVWISAI
FT                   AGALGTIDNPGKNRAVFRPGEEDLRGELGRRVNAARTIRRIDLPTRDGMYTEADAKKML
FT                   GLREGGSMAIILNTIDRAQRLYSMVKKSVTGRTWCVLVHPGFRPGDRAKLSHEIQGIGE
FT                   DADGVVISTQALETGVDLSVRTIVAELAPWPSMVKRIGRCRGDGKAAAYWIDLDSNSYQ
FT                   PYGPGDGQAYDRMDRSREVLEGMEGSAVSGTRLAEVPAYNAIYGAISREQLEELFDTTQ
FT                   DILGSPVDVSRHTGDGDPGALVFWSDAERRAKWNDLCGMNLEELRGFVSEHASLCSYWN
FT                   PKSMSWGEIGAGDVYPGIIVRIEPAAGGYTQELGLWTGYDGPVKEAVLPARLDRQDGRD
FT                   VTLRDHTRNIADAAGEILSGLGVDAEYSGAVRTAAQWHDVGKMHYIFQEYLRPNLASGI
FT                   DEIWAKSGRKERDKTREERRSYGRRGFKHEVASALAFMNSHDGPEHDLVAYLIMSHHGL
FT                   VRLEMHPKDDGMVSGIVDGEPLCERAYAVHDNVMIPAGLVLDASAYGAGGRRPWRERTA
FT                   ALLKRHGPFRLSYLETVLRKADWAASAKDDER"
FT                   /transl_table="11"
FT                   /protein_id="YP_875096.1"
FT   gene            123279..123863
FT                   /db_xref="GeneID:6370328"
FT                   /locus_tag="CENSYa_0148"
FT   CDS_pept        123279..123863
FT                   /locus_tag="CENSYa_0148"
FT                   /gene_family="HOG000105393" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="bacterial-type DNA primase"
FT                   /transl_table="11"
FT                   /note="COG0358"
FT                   /db_xref="GI:118575354"
FT                   /db_xref="GeneID:6370328"
FT                   /translation="MPNSKESVGTITIQLGSDIDHTSIEYYIEEIERVDKFIAKFNTIY
FT                   SGSTSNLRHQKKLYLSNKARAKQKLTSGGMVNLEGLVHGKNIDRTRWIILVEGAADVGR
FT                   LSQLGYQNTLEVGGARLDDRALAFARTKEKIIAFMDGDEEGIDNLRRLRNTIKIDEPLL
FT                   ADKGIEVENLPLNRIREILEPASKKMSRELL"
FT                   /protein_id="YP_875097.1"
FT   gene            123925..124125
FT                   /db_xref="GeneID:6370329"
FT                   /locus_tag="CENSYa_0149"
FT   CDS_pept        123925..124125
FT                   /locus_tag="CENSYa_0149"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575355"
FT                   /db_xref="GeneID:6370329"
FT                   /translation="MCGRRTWSGHTMVGNYPPCQTAPADVSYTKAPDVPLPCQRLTSVR
FT                   TAIFAPIPMLLKISIPATGRA"
FT                   /protein_id="YP_875098.1"
FT   gene            124198..124401
FT                   /db_xref="GeneID:6370330"
FT                   /locus_tag="CENSYa_0150"
FT   CDS_pept        124198..124401
FT                   /locus_tag="CENSYa_0150"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575356"
FT                   /db_xref="GeneID:6370330"
FT                   /translation="MGGRFRASTIGARLHQSGHVPGYFPALLLMDPGPGGQENPSVSLL
FT                   RRGRSLVQHGGPPAECPYQKVR"
FT                   /protein_id="YP_875099.1"
FT   gene            complement(124434..124922)
FT                   /db_xref="GeneID:6370331"
FT                   /locus_tag="CENSYa_0151"
FT   CDS_pept        complement(124434..124922)
FT                   /locus_tag="CENSYa_0151"
FT                   /gene_family="HOG000105404" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575357"
FT                   /db_xref="GeneID:6370331"
FT                   /translation="MAFHKAPPCFDGGSENLVRQLGNEADKCALVKTNAGGSGYEYHLA
FT                   RIPEGKVVIMSVILHPDGRQMVEPTTIKFLRKFYMTDELIFLTTNYAAVKNGYCMLAHA
FT                   SDGIFSSHLNAESCRRDHPRQRELVEDLQIRGGDELEEAGILTEYAALCTDIIDRKLG"
FT                   /protein_id="YP_875100.1"
FT   gene            complement(124943..125257)
FT                   /db_xref="GeneID:6370332"
FT                   /locus_tag="CENSYa_0152"
FT   CDS_pept        complement(124943..125257)
FT                   /locus_tag="CENSYa_0152"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575358"
FT                   /db_xref="GeneID:6370332"
FT                   /translation="MYADEIMSRISPYQPGGIRNIEYSEYSSFCPMHANLNPSMTKRWQ
FT                   TENPCLRDWLVPARIASRPSIRKSLYKDEPLHPHWAKNVSSAGKSWAARRSIWSIQSDT
FT                   "
FT                   /protein_id="YP_875101.1"
FT   gene            125479..127086
FT                   /db_xref="GeneID:6370333"
FT                   /locus_tag="CENSYa_0153"
FT   CDS_pept        125479..127086
FT                   /locus_tag="CENSYa_0153"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="superfamily II DNA/RNA helicase, SNF2 family"
FT                   /transl_table="11"
FT                   /note="COG0553"
FT                   /db_xref="GI:118575359"
FT                   /db_xref="GeneID:6370333"
FT                   /translation="MIISGPYWPEPVRVNKVEMVGLNVRLVGAYTDTGIHVDQILHTSA
FT                   FDSITDSHSVIDFSANPWHVFLALEARRYRFASMYDPLLGMSASLVDPLPHQIEAVYER
FT                   VLKMHRIRFLLAHDPGAGKTIMAGLIIKELKMRNIINRILIVVPRHLEYQWSKELIEKF
FT                   EERFVVVNRSYINNQFENAWLKENQIITSLDFAKQDDIIESLESANFDLIVVDEAHKMS
FT                   AELYGNTISKTNRYRLGESLSEITEHFLFLTATPHKGSPANFRFLLNLLEPGFFANEDI
FT                   VKESILNQDNPLFLRRMKEDMKDFDGKPLFVSRSVKTPDIKFAGKELELYNKLSTYMRE
FT                   QHDKAQSIQNRQRINTGFGIVIFQRRLASSAYALQKSLERRKKRLEGQRETVIRIGSEL
FT                   EEMSKINDEQSEEEEQRKEILRERLNVEDRVELEKEIMDMDVLIGLTRDLINEESEIKL
FT                   TSLRDTMFRLKKDHPEKKILVFTAYRDTLDYLVKKVRXXXXXXQLITIQNPATHLSAER
FT                   REQVRYVIAQSQIKDINS"
FT                   /protein_id="YP_875102.1"
FT   gene            complement(127491..128480)
FT                   /db_xref="GeneID:6370334"
FT                   /locus_tag="CENSYa_0154"
FT   CDS_pept        complement(127491..128480)
FT                   /locus_tag="CENSYa_0154"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="superfamily II DNA/RNA helicase, SNF2 family"
FT                   /transl_table="11"
FT                   /note="COG0553"
FT                   /db_xref="GI:118575360"
FT                   /db_xref="GeneID:6370334"
FT                   /translation="MKWIEGKLYRNAKSGAIFEDPRGRLDGHILFYKGEIKDGMGKVAG
FT                   ERLFSYYVDLSVAVTPVDPSIVWDLAKPVGQYTGYIEDHERMQEKVLGKVVTSMAEYQT
FT                   VLLDERRRQCEIKRKYGLKSLERLITDLDNSITDIEQQWWLKNKPERVLRNKREKKKKY
FT                   EHAKSNLKEQIEKEQQLTISTPEFFGIIRIKPSRVADIPEDTVGSPESEKAGMEIAMMH
FT                   EKNAGRNPVDVSKENLDFDIKSSDNEGKTRYIEVKTSYGIGDVVLTTNEWFRARMLKDD
FT                   YYLYVVWNAGRSSSKLVAIKNPATSLSAEKKGHALYLIDQDQIKKMCS"
FT                   /protein_id="YP_875103.1"
FT   gene            complement(128488..131538)
FT                   /db_xref="GeneID:6370335"
FT                   /locus_tag="CENSYa_0155"
FT   CDS_pept        complement(128488..131538)
FT                   /locus_tag="CENSYa_0155"
FT                   /gene_family="HOG000008648" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="superfamily II DNA/RNA helicase, SNF2 family"
FT                   /transl_table="11"
FT                   /note="COG0553"
FT                   /db_xref="GI:118575361"
FT                   /db_xref="GeneID:6370335"
FT                   /translation="MRYRFASLYDPLLAMNVSLVDPLPHQIEAVYGVVLKMPRIRFLLA
FT                   HDPGAGKTIMAGLIIKELKMRKVVSRILVVVPGHLKDQWSRELREKFEEKFVVVNRDYM
FT                   RAHYGENVWAKENQVITSLDFAKQEDIIASLESSDFDLIIVDEAHKMSAERYSNKTSKT
FT                   DRYKLGETLSRTTQHFLFLTATPHKGSSENFRLLLDLLEPGFFADEELVRESIKNRDNP
FT                   LFLRRMKEDMKDFEGKPLFVDRTVKTPDIEFGEEEIKLYNDVSSYVKDQYGKAQAMHDK
FT                   QRRNIGFALVILQRRLASSVYSLQRSLERRKKRLEDMRDRGVVGVDGTSETFETDDMNE
FT                   EERWELEKKWETLSVAENKVELEGEIATIKDLIVSAKDLINQESEVKLGNLKETMSNLW
FT                   KDHPGKKILVFTESKDTLDYLMGKMEKWGYLANTIHGGMGLEERVEAERVFKNKTDVMV
FT                   ATEAAGEGINLQFCHLMINYDLPWNPNRLEQRMGRVHRYGQQYPVTVFNLIASNTREGE
FT                   IFKKLFERLESIKRDVGDKVYDVVTEVLPGKKLAELLLAAAASAKKQSEILAELDFPID
FT                   EEEIRRIKENLGDSLATKYMDYTSISEIRERAHENKLIPEYTREFFKTAFREAGGTVKE
FT                   KSTKGKGVKFMAVDSIPYVIKSIALEDQFKKRHGSILNSYPRITFDKTVGFENPEVEFV
FT                   TFGHPLFEATMEWIERKLSDNSRIGAVFEDPDGRLDGHILFYEGEIKDGMGDVAGKKLF
FT                   SYFVDTAGTTESVNPSILWDLAKPENPDAGSEGDLEGMKEHTMNGTILSMEKYQAELLE
FT                   ERKRQGEIKRKYGLESLSKLIIRLDNEITGIERQKKVTDKFDVSLWNKQEQRRKYESAR
FT                   SGLVEQIEKEQRLTMSTPEFFGMIRVVPQKREGSGRGMSNNPESEAAGMVTAMEYEVNA
FT                   GRKPVDVSKENLGFDIKSSDNEGKTRYIEVKARSGVGDVILTTNEWFRAEMFKDDXXXX
FT                   XXXXXXXXXXXXXXXXXXVCNIQTPPV"
FT                   /protein_id="YP_875104.1"
FT   gene            complement(131570..131785)
FT                   /db_xref="GeneID:6370336"
FT                   /locus_tag="CENSYa_0156"
FT   CDS_pept        complement(131570..131785)
FT                   /locus_tag="CENSYa_0156"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575362"
FT                   /db_xref="GeneID:6370336"
FT                   /translation="MIITGPFWPEPVRVNKVVKLGDHVRLIGAHVTTKNHVDQLLHLSD
FT                   FDSIASXXXXXXXXXXXXXXXXXXVS"
FT                   /protein_id="YP_875105.1"
FT   gene            complement(132079..132345)
FT                   /db_xref="GeneID:6370337"
FT                   /locus_tag="CENSYa_0157"
FT   CDS_pept        complement(132079..132345)
FT                   /locus_tag="CENSYa_0157"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575363"
FT                   /db_xref="GeneID:6370337"
FT                   /translation="MSKNTWISVSAYRYEKLGLAQPPTCQEDCRLVTSACIQSWYKEPL
FT                   KMNLGKLDRLYHHPICLSGGLPSRSILENDVLWHRGPSRVPAG"
FT                   /protein_id="YP_875106.1"
FT   gene            132414..132836
FT                   /db_xref="GeneID:6370338"
FT                   /locus_tag="CENSYa_0158"
FT   CDS_pept        132414..132836
FT                   /locus_tag="CENSYa_0158"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575364"
FT                   /db_xref="GeneID:6370338"
FT                   /translation="MPIGVILAESRKRIGIMDLRLVEEDYHIEAYISWDAVYFEDVINK
FT                   IIELSKEVMDEPIIIDNEINEYIILKLREAKLPCKIITVRKRVNNEIKVNEVYDQWEAL
FT                   EYINHLYKTGXXXXXXXXXXXXXXXXXXXXXXXXXX"
FT                   /protein_id="YP_875107.1"
FT   gene            133102..138144
FT                   /db_xref="GeneID:6370339"
FT                   /locus_tag="CENSYa_0159"
FT   CDS_pept        133102..138144
FT                   /locus_tag="CENSYa_0159"
FT                   /gene_family="HOG000105415" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575365"
FT                   /db_xref="GeneID:6370339"
FT                   /translation="MTIMVAGGVTFAFPPAIPAYAQSSAEYLFVSAENSDFDNSFAGPM
FT                   VIEVVVNDPDLKEIDEVESEPDVTVNGQDLEMVQATDGNWYAYFADRTMATRADNLTDV
FT                   PDTGLDFGDGCMAPTTGRYSDSDGVFFPKIGSHAGNGKGLQACEAMDAVDTENSMNVIR
FT                   EPKEPTNAITGTMSRTAVLEGQVGITSGEFPAIQLYDFTVDGDVEVKYNRGGGVQQIDL
FT                   AYLDDTSDLVSWSPDRSEYPSDAHVHVTITDMQLNIDPTDEDSWTFNTWPEETRTYYQL
FT                   FDENGDFAPNVDPSANPDSVTAINGSDLTALNFEDNGVLEVDINPQGGAAVLALADNDD
FT                   QELTDAGMIVGLDNDMLPITFTETQSNSGIFVNTDEGDQANIRIAEDPPRETTATVEYN
FT                   DEAGSVLVTDFFANIEIDEDHVGGTWNSGEEIHVTLTDQDANKNSLVDEDFDLYEPNVL
FT                   LIPSVRIGSPITGADLIEGTVLAVGGAQTITGVTFHTSSDLPNVIIPGAQASLNSVENH
FT                   DCADLVANSFCVEAFSDRIRINLDQATTFGDNTPNDEAEIGFTFDRDIQADIVEDWLAP
FT                   GTADAKHHYLNYDLRTFELLGDDGQNFAGGEIEIIVAGTTTGHAGPDNIHVIEADSFAG
FT                   LVSLDEEDARPGNTNRILDSLDDDTAPATGNLHVHFTIDSFGDNAELQKGEYPMAVDLF
FT                   RFGQTGDGDDFDDRFNDAIYRIELEESGDNTGAFEGSMEYIMLNQINVNDTTTYDAVTP
FT                   IDDEIELIVHEDLTDEDSVRVNYLDLGGDGVSTQVADQVAAPTHSGSVTFDADNYKVAD
FT                   TVTVTVDDPDLNIDVETIDVFTVVDVSNDPAEDAVGAPGYGMNSKEEPFGRLLDITFDD
FT                   ETWTANECGLTGIDTGLASTGFTLKETAADSGLFTGDFQIPTRYCPVDPDFGDEDGVTT
FT                   TGTDMEVNYVDYRDASGEIIEVGDSVGIRANTGSVSLDRTVYPVPFGDYLDREFNFPIH
FT                   AEGQIPLPNNAINPDNFLPEGVLTIHARINDPDFDVSASGEDNIAVTTNRDDGNRNNDE
FT                   GDDIDGIDFNSDGTVDMDNGPHGPVLFTISRGGTTVYHATAGAPVEREFNPLTLDESDR
FT                   FESTLTPDNAVFPPELGPINEIAPDAGIFEVDLAIAWNDGPDDMVLQGDILTVEYTDPT
FT                   DASGDPNTVTDSATFDLRNGVLQSDKSVYIIGSDMIITLIEPDFDLDNDAAETYPLTLI
FT                   EWDSDAGSATLGSNEEDFDPEPSDLRETGDSTGIFQSVIEIPEEVENDRIERGEEVELE
FT                   YTDWGPAGADFVGEEDEDINLTIFTSNFGATIELDQKVYSWTDKVYITIVAPDHNFDDD
FT                   LIDEIGETNLDEITVSTREDDLDNYKLDETGPDTGIFTGEVILTGFPHDADGDGDFDAG
FT                   MIETRGTGPTDGFLASDEDDGLTVSFEFSEDETVIGSALIRWNIGESQWLEAAYPATGT
FT                   GVVRIVDPDLNLNPEAVDNFGVDVWSDSDAGGIDLTVTETNEATGIFEGTVSFTVNDQS
FT                   SGHRLRVAEGDTVTARYEDNTLPDPFTTADNLDITGTAIIGTIVPPLERVDIIDARLVD
FT                   SFGGALTTVAVDQQVQITADLASGQDRDQTFAYLLQVQDANGVTVSLAWITGSLAAGQS
FT                   FSPALSWIPEEAGSYTATIFVWESVDNPTALSAPATVQITVA"
FT                   /protein_id="YP_875108.1"
FT   gene            138428..138742
FT                   /db_xref="GeneID:6370340"
FT                   /locus_tag="CENSYa_0160"
FT   CDS_pept        138428..138742
FT                   /locus_tag="CENSYa_0160"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575366"
FT                   /db_xref="GeneID:6370340"
FT                   /translation="MATRGQILAAAVQIGASQALLSQEVSCMSFIVQLTVSYMHKTTVI
FT                   KIGVIVAVVGVAYMAFNITSNYENGREPELGERVTYYVILVAGLFIVMLGATRDEKPHT
FT                   "
FT                   /protein_id="YP_875109.1"
FT   gene            complement(138954..144167)
FT                   /db_xref="GeneID:6370341"
FT                   /locus_tag="CENSYa_0161"
FT   CDS_pept        complement(138954..144167)
FT                   /locus_tag="CENSYa_0161"
FT                   /gene_family="HOG000105415" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575367"
FT                   /db_xref="GeneID:6370341"
FT                   /translation="MTIMVAGGVTFAFPPAIPAYAQSSAEYLFVSAENADFDNSFAGPM
FT                   VIEVIVNDPDLKEIDETESEPDVTVNGQDLTMVQATDGNWYAYFADLTMAMTADELVED
FT                   HNAGTSLDFGNMCEEDSMLVEALDRYQDTDGVFFQHNVDCTSSTITNTIFGTINDDSMN
FT                   VIREEKVPTDNEDGFNFNGDSRTEDVDDVSRGQIGVLPNEFPAIQLYDFTVDGDVEIKF
FT                   NRGGGVQQIDLAYLDDISDLVSWSPDRSEYPSGAHVHVTITDMQLNIDPTDEDSWTFNA
FT                   WPEETRTYYQIFDENGEFANATNTNDATIIEDADLTALNFEDNGVLEVDISPQSEDLTD
FT                   AVLTLADNNDQELVDGSIANSTNSDVSFGTADFKNDRLPITFTETQSNSGIFLNTDEGD
FT                   QANIRIAEDPPRETTAIVEYNDEAGSVLVTDFFANIEIDEDHVGGTWNSGEEIHVTLSD
FT                   QDANKNSLVDEDLELYEPEVLIIPSVRIGSPITGADLIEGTVLAVDGAQTITGVTFHTS
FT                   SNLGTLAADRVLSPGTQHSLDWAEDHDCTDLVANGFCVEAFSDRIRINLADDTEFGVGQ
FT                   GPAPASVAGTAEIGFTFDRNITSDIVEDWLLNGTADAKHHYLNYDLRAFELLGDGDEAN
FT                   FAGGNIEIIIAGTVTGHGNVALTHGIEEQDDFAGLVSLDEDDPRSGAGPTDRFILESLE
FT                   SATGNLHVHFTIDNIGTPTLEKGDYPIAVDLFRFGQTGDGDDASDRYNDAIYRIELEES
FT                   GDNTGAFIGTMEYIMLNQINVNNSDTYEAISPIDDEVELIVHEDLTDEDSVRVNYLDLG
FT                   GDGVSTQVADQVAAPTHSGSVTFDADNYKVADTVTVTVDDPDLNIDVETIDVFTIVDVD
FT                   NDPAQDAVGASGYGVNSKNEPFGRLLDITFDDEIWTERHNCGDDSDGNRIYGSPDRGLE
FT                   YTGFTLKETAADSGLFTGDFQVPKTYCSVDEVLKTVTGTDMEVNYVDYRDASGEIIEVG
FT                   DSVGLRANTGSVSLDRTVYPVPFGSSEEFREPNGGFPDRISWFPQHAAADGELGSGDLT
FT                   IHVRVNDPDYDLSASGEDKIAEEGNIRDNTNKGGPLKITISRGGESVVLATAGAENAAD
FT                   GLITLGNDVEDNTRELGPINEIAPDAGIFELDMKIRHTDGPTDNRCPQTVTYETDADNI
FT                   QAASLTDNARERQSNGNFGDDEVRFANIPSSNTGTVQPDYCIMQGDILTVEYTDPTDAS
FT                   GDPNTVTDSATFDLRNGVLQSDKSVYIIGSDMIITLIEPDFDLDNDAAETYPLDLIEWD
FT                   SDAGDISMGTAGDNIFDPEPSDLRETGDSTGIFQSVIEIPEEIEGDRIERGEEVELEYT
FT                   DWGPSGSDFVGDEDEDINLTIFTSNFGATIELDQKVYTWTDKVYITIVAPDHNFDDDLI
FT                   DEIGETDLDEITVSTREAELEGYKLDETGADTGIFTGEVILTGFLHDANGDGNFDAGLI
FT                   DTTGTGPTDGFLESDEDDGLTVSFEFSEDETVIGSALIRWNIGETQWLEAAYPATGTGV
FT                   VRIVDPDLNLNPEAVDNFGVDIWSDSDAGGIDLTVTETNEATGIFEGTVSFTVNDQSSG
FT                   HRLRVAEGDTVTARYEDNTLPDPFTTADNLDITGTAIIGTIVPPLERVDIIDARLVDSF
FT                   GGALTTVAVDQQVQITADLASGQDRDQTFAYLLQVQDANGVTVSLAWITGSLAAGQSFS
FT                   PALSWIPEEAGSYTATIFVWESVDNPTALSAPATVQITVA"
FT                   /protein_id="YP_875110.1"
FT   gene            144258..144929
FT                   /db_xref="GeneID:6370342"
FT                   /locus_tag="CENSYa_0162"
FT   CDS_pept        144258..144929
FT                   /locus_tag="CENSYa_0162"
FT                   /gene_family="HOG000105404" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575368"
FT                   /db_xref="GeneID:6370342"
FT                   /translation="MRAYAGKTNLHLDVHKTFIRSCSTALPLGKKCFVCKQKMGGKDEY
FT                   LEHTIRYIGGSKIGDLAFHKDPACFNEGADILARQLRGDGDKYALVETNAGGCDYEYHM
FT                   MLNEYGKMILLYMIVRHDGKKEAEPTTLKFLRQFYDTDELIFLGTSYTMEKSHYFMLAH
FT                   VSDRIFSSHFNAENYKRDKIRQEEVWQDLQIRGEVELEEVKILAEFALQCMGIIADKSG
FT                   Q"
FT                   /protein_id="YP_875111.1"
FT   gene            complement(144967..146496)
FT                   /db_xref="GeneID:6370343"
FT                   /locus_tag="CENSYa_0163"
FT   CDS_pept        complement(144967..146496)
FT                   /locus_tag="CENSYa_0163"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="bacterial-type DNA primase"
FT                   /transl_table="11"
FT                   /note="COG0358"
FT                   /db_xref="GI:118575369"
FT                   /db_xref="GeneID:6370343"
FT                   /translation="MSGTSYKYCVKVHYKFKAAIEGTDVRNSLLYMGIGGLKETALVNL
FT                   KNSGVIEDIYVKKFTGGEEDGSPVWTGKMLIPVVDENYCKMVSKVLADADKIYIYERDM
FT                   FDLEIRIVRVPSEGTSRPVKYKDAGLDCGPGASTSGWIILVDGWWDVLNMGCAGYDNAV
FT                   AFAGSDLASHIGKITDICGEKGRVLAFLGGGRPGERHEKALREHRIVDDDTCRRAPEEV
FT                   ENLSSEAIHEKIGSIADRFEGELGIAKPTDTEYWEKPLEEVWPDLSEAAEPPVKDGINP
FT                   EAPAGQLVRGLEPYTHAASAPAPKAEPAGKAKPGRRPPLSHVAIAAGMTVLFLFGFAVY
FT                   LGYDVPLIGMMYEPRFSGPVQDDAAPGGPAPDAVPSADTSEGGRLGPDDPPDLATVELT
FT                   RIAQLSSINRMGTEAGVIALALVDGGAGPGVGMPAIEQLCPQGSEVYYETDGAESDGQM
FT                   IAKVWCTEKISGIPLHSINEILLDEGLAGLYKPHCMETGFGTERWARDAGC"
FT                   /protein_id="YP_875112.1"
FT   gene            146692..148080
FT                   /db_xref="GeneID:6370344"
FT                   /locus_tag="CENSYa_0164"
FT   CDS_pept        146692..148080
FT                   /locus_tag="CENSYa_0164"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nuclease"
FT                   /transl_table="11"
FT                   /note="COG2251"
FT                   /db_xref="GI:118575370"
FT                   /db_xref="GeneID:6370344"
FT                   /translation="MQCTEIPWIRREQAPLEAQPGHKGLPDALYGMQCSRACMNADELY
FT                   SSCVDGPDYSITGAEVFRYAMSPFFYYCEKFADRGGADPPPGNVKGGSPYVDDMDRGTA
FT                   LDCTGDKDCFRECIRLMFDGQDEICNAPLLYLPEGIAGRPDILRKAEGRSIFGGHYYAP
FT                   ALVIMALKPRRDHEMQAAFYSYLLHRIQGRRPEFTVVDGRGGIHDSPAGDNTDSVPGNI
FT                   EGMRRIDSGHVPPAEVLRRPWTSYSIKKALETGHLSLVLWLDGSKIRRLERSGIRDVSA
FT                   LAGTTTSTISSICRVDRRKAGILKGMARAAAEQKPIVFKDPEVDDTGAKSFLAVETERI
FT                   DNRIEMSGAAVLVRDESGERRRTFEGDGMMDGISGFVRGSTVYYWGRRALTLAESSGGQ
FT                   MPRGMRNLMEIFAESITFHLPLVDPEHISREMGHPVENSVPGECIALRNIHDWLLSKRG
FT                   QGSP"
FT                   /protein_id="YP_875113.1"
FT   gene            148284..149819
FT                   /db_xref="GeneID:6370345"
FT                   /locus_tag="CENSYa_0165"
FT   CDS_pept        148284..149819
FT                   /locus_tag="CENSYa_0165"
FT                   /gene_family="HOG000105426" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575371"
FT                   /db_xref="GeneID:6370345"
FT                   /translation="MKLISPTDLTKSRSFIREFLEPVVNNVYTRTAGTAHVRGEKYRRI
FT                   MEMLPPDEPVLFGNLYENNRTELSSMYTKNTRIMLSRALSWGCKNGILSRDNPGRVPDW
FT                   FYEIKSVSRWAAQLQGSNMKHPEKKSYDSSTRRQYVQCLWNFNRWITGRTFEIREYWPT
FT                   PEGTYALRSETRNFENVGDLLDVLERPLADSRNVSRIVKDFLLDRMETHSGSSHIMMYK
FT                   NSIVSYFDKNEQQLKLSFNPRLSRGRSAYEQSMDLPEFLRFMTDGAPSVMERALFMCKF
FT                   HRGLDVSTLVDGFNYEVWDQLVQWFHTEDYTSWDLGKCPVPVSLIRVKTGYRHIGFLER
FT                   DSMVCLTEYLDYRRRATGRPMISGEPLFLNKFGRPVTRSWTFASFVRIADRAGIRKQTI
FT                   IDGRSRYNLDSHELRDLLKSTLIDCGCRPDVADHVIGHKPRDSYEKQARLYPETLRREY
FT                   SRASPRLNILTGNAAAPAGDALARCEAAIGEIKLRMQEFDTQIIRMREMAAPG"
FT                   /protein_id="YP_875114.1"
FT   gene            complement(149820..150575)
FT                   /db_xref="GeneID:6370346"
FT                   /locus_tag="CENSYa_0166"
FT   CDS_pept        complement(149820..150575)
FT                   /locus_tag="CENSYa_0166"
FT                   /gene_family="HOG000027939" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="enoyl-CoA hydratase/carnithine racemase"
FT                   /EC_number="4.2.1.55"
FT                   /note="COG1024"
FT                   /db_xref="GI:118575372"
FT                   /db_xref="GeneID:6370346"
FT                   /translation="MVNTSASDGITTVKINRPDKLNAMNVDVATELVRIFEELGKQDGT
FT                   KVIILTGEGEKAFSAGADIEYMSKITPDESVEYAKLGQLVTNTIESVKQPTIAAVNGYA
FT                   LGGGCEVAMSCDIRLASENAVLGQPEVTIGIPPGWGGTQRLLRIVGTAKAKEIIYTGRK
FT                   VKAAEALSMGLVNAVYPLDTLMEEATKMAGIIAANSAMGVQMSKVAVNTGRNADLDTGL
FT                   GIELLAWRNCFTHQDRTDRMTAFVNKSKK"
FT                   /transl_table="11"
FT                   /protein_id="YP_875115.1"
FT   gene            complement(150613..152679)
FT                   /db_xref="GeneID:6370347"
FT                   /locus_tag="CENSYa_0167"
FT   CDS_pept        complement(150613..152679)
FT                   /locus_tag="CENSYa_0167"
FT                   /gene_family="HOG000225732" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acyl-CoA synthetase (NDP forming)"
FT                   /transl_table="11"
FT                   /note="COG1042"
FT                   /db_xref="GI:118575373"
FT                   /db_xref="GeneID:6370347"
FT                   /translation="MITEEDAKSILKSYGLKVPDYALVGSADEAARQAKKIGFPLVMKV
FT                   VSPQILHKTDVGGVKVGLDNVNDVKKTFTEMYGRLSKRRGVKVKGILLEKMMPRDGVEL
FT                   IVGLQNDPQFGPVIMVGMGGVLTEVMRDVSFRMLPITVSDARSMLKELKGSRMLRGFRG
FT                   SKAVDLVMLAKALVQIGRMGMASAAYFESIDFNPVMVYPKSYSVLDAKIILKKKPKRKA
FT                   VSRVKPNKTHMESFFTPKTVALVGASSSKGKIGNSILDSLVNHDFKGKVYPVNPKAKKI
FT                   FGKKCYPSVSALPGKIDLVIISVDLSVIPPVLEECAAKGIHNVVIVSGGGKELGGKRAS
FT                   YEAKVRRLSKKHGIRIIGPNCIGMFNAANRLDCAFQGQARMVRAKLGPVALLSQSGTMG
FT                   ISFLETADTFGLSKMVSYGNRSDVDEADMIWYLAGDPQTKVIALYVEGFGDGRKFIKTA
FT                   KKVMKEKKKPVIVWKSGRTEMGAKQAASHTGSLGGSNAIIMGAFKQAGIISVDSYQELA
FT                   AVSKALAWQPPAKGNRVAMTSNGAGPMIGGMDHFDRLGLELAGISRKSLKKMRDHFPAT
FT                   YVIGRGNPADVTGGATAEDYKFVIKTFMDEAKVDVVMPWFVFQDDPLDEVIVKYLAEFS
FT                   KKRKKPLLVGANGGPYTQKISRRVEDKGIPVYDDLRDWVAAASALARWGKVRR"
FT                   /protein_id="YP_875116.1"
FT   gene            complement(152821..153453)
FT                   /db_xref="GeneID:6370348"
FT                   /locus_tag="CENSYa_0168"
FT   CDS_pept        complement(152821..153453)
FT                   /locus_tag="CENSYa_0168"
FT                   /gene_family="HOG000238441" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GMP synthase, glutamine amidotransferase domain"
FT                   /EC_number="6.3.5.2"
FT                   /note="COG0518"
FT                   /db_xref="GI:118575374"
FT                   /db_xref="GeneID:6370348"
FT                   /translation="MLGGLLVQDRYETMTVRPKQEKLPPSDGYNLLVVLGAPYSVNDDL
FT                   PHLREEEGIIREFVESKRPVLGICLGSQLIAKAFGGRVYTGPKKEIGFYHDIQCDNEGL
FT                   FAGFESPFTAFHWHNDTFELPQGSTRLASSTHYENQAFRYKTAVGLQFHLEVDTEMAIQ
FT                   WLDGAQQKGILSTDTAGKIRSEMAEQMPVVNQNMERFYANFKSEFGL"
FT                   /transl_table="11"
FT                   /protein_id="YP_875117.1"
FT   gene            153540..154094
FT                   /db_xref="GeneID:6370349"
FT                   /locus_tag="CENSYa_0169"
FT   CDS_pept        153540..154094
FT                   /locus_tag="CENSYa_0169"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575375"
FT                   /db_xref="GeneID:6370349"
FT                   /translation="MGPCRSILDGYYTSGRRCGRLAAKKTYEDFEIVKEPWTVYLLDDG
FT                   TKLKTRTTMNTMWYVIKGGTQSHTYESQETNIVLCHPSMQGRKDTTVRAKEQLEKNTEI
FT                   EDCRYEVISEEPTEYLMEDGTKVFIYRKLCKISRTRYNDRHGNRIYLYSIDESSKFDSP
FT                   PLGTCPTCGHDHSHDHSHDPQ"
FT                   /protein_id="YP_875118.1"
FT   gene            154275..155450
FT                   /db_xref="GeneID:6370350"
FT                   /locus_tag="CENSYa_0170"
FT   CDS_pept        154275..155450
FT                   /locus_tag="CENSYa_0170"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575376"
FT                   /db_xref="GeneID:6370350"
FT                   /translation="METHVNFEDLPDFDSVAGMLIPEELADSISVDRVVDGKFWYFSEP
FT                   CVAAYVSMLEASSAHTTYKDSMDCLTDNLTEIVEKILAEIPKQGGGPPRLDLVALGIGT
FT                   ARKECVILGRLLEEFKNTATRVSLVAVDFSYPLLMHGIRRVKTTFAYEKERFDLRLYVA
FT                   DYTKREAGDFGGTGDTFTLITAPGLLHNSPIPDIFYSLQKLMTKNTLLLIDAEMIGGRT
FT                   DEELCSQYTDEPSKRFFFTPLSLLARASEEEHKRMDDQTGGGHKYKEFKSVGYVPERIT
FT                   AAVVCGNNLDEFRQSHGLPPGTLNGMKLSPGPGSKTVMITYKQDGSFYVLGHTARFLEI
FT                   EFAAMLDRYGFEVVYECGHKRKHTRYYLLKMKTGDSPGAGSEDDDKSDASI"
FT                   /protein_id="YP_875119.1"
FT   gene            155540..155965
FT                   /db_xref="GeneID:6370351"
FT                   /locus_tag="CENSYa_0171"
FT   CDS_pept        155540..155965
FT                   /locus_tag="CENSYa_0171"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575377"
FT                   /db_xref="GeneID:6370351"
FT                   /translation="MLAGVVLYQAYLTRRDINIRHRAWIGRNSGEKLSLERYFIKMPIS
FT                   SYGPVPARDITITRYISENKGEKSFEKSDKEPFDMSPGETINLHLQISEDQYEKAVGST
FT                   IYFGWRIEYRTGNGSGVYEIDLRYKKGNNDVVTIKSR"
FT                   /protein_id="YP_875120.1"
FT   gene            complement(155920..156207)
FT                   /db_xref="GeneID:6370352"
FT                   /locus_tag="CENSYa_0172"
FT   CDS_pept        complement(155920..156207)
FT                   /locus_tag="CENSYa_0172"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575378"
FT                   /db_xref="GeneID:6370352"
FT                   /translation="MRALEHLACPKPPRGELLSGSLRACISVSYLSWFGVYIMARGRRG
FT                   RLRRGPGGSCRTHDQRAGMAPEAGSCPHGHLRSGDGYLDFIVTTSLFPFL"
FT                   /protein_id="YP_875121.1"
FT   gene            complement(156263..157543)
FT                   /db_xref="GeneID:6370353"
FT                   /locus_tag="CENSYa_0173"
FT   CDS_pept        complement(156263..157543)
FT                   /locus_tag="CENSYa_0173"
FT                   /gene_family="HOG000243801" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glutamate dehydrogenase/leucine dehydrogenase"
FT                   /EC_number="1.4.1.3"
FT                   /note="COG0334"
FT                   /db_xref="GI:118575379"
FT                   /db_xref="GeneID:6370353"
FT                   /translation="MALVENDPFENSRKQVHDACDLLDITDKGMREYLVMPNRVLRFKI
FT                   PVMMDDGNLRIFTGFRSQHNNDKGPYKGGIRYFNPKGGVEYMEREVMALSSWMTWKCAI
FT                   LDLPLGGGKGAVYVNPKEEKISAGEKERITRRFAYMLSEVIGPEKDIPAPDVYTTGKEM
FT                   IQIMDTFGKLNGNRYTPGVITGKPVPVGGSLARNVATGLGSAYCTREAAKTLKIPLKGA
FT                   KVVLQGFGNASTYAGIYLEKMGCKVIGASDSKGSVLVPAGFKMDKMMEHKSKKGTVVGY
FT                   PGSKKVTAAELLTAKCDILVPGALENQIDAKIAAKLQCKIITEAANGPTFPEADPIIFK
FT                   KKILLIPDILANSGGVCISYLEWVQNNQGYYWSFDDVAGKMETTIVRGFKASYEFAKKH
FT                   KVDMRKASMAIAVDRVVKAFEHRGLWP"
FT                   /transl_table="11"
FT                   /protein_id="YP_875122.1"
FT   gene            complement(157564..157812)
FT                   /db_xref="GeneID:6370354"
FT                   /locus_tag="CENSYa_0174"
FT   CDS_pept        complement(157564..157812)
FT                   /locus_tag="CENSYa_0174"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575380"
FT                   /db_xref="GeneID:6370354"
FT                   /translation="MLSLPSLVNLRVFQAIHACREHALVPTPDAVGPSGAQTCFFQSPD
FT                   SCSGALPDMPVLDRRPIHLPMVCGTSPRAMVLCKKTL"
FT                   /protein_id="YP_875123.1"
FT   gene            157814..158530
FT                   /db_xref="GeneID:6370355"
FT                   /locus_tag="CENSYa_0175"
FT   CDS_pept        157814..158530
FT                   /locus_tag="CENSYa_0175"
FT                   /gene_family="HOG000091085" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="20S proteasome, alpha and beta subunit"
FT                   /EC_number="3.4.25.1"
FT                   /note="COG0638"
FT                   /db_xref="GI:118575381"
FT                   /db_xref="GeneID:6370355"
FT                   /translation="MASRGYDMTPTMYSPDGRIYQVEYAIETVKRGTLAIGVSSKEGVV
FT                   IAVEEKPRALQTANITQKIFQVDRHIGVAAAGYIPDARIQVDNARFFSQGNRITYDEPV
FT                   EVETVAKYLADQCHQFTQYSGVRPYGVALIIAGVDIKGEGVYVTDPSGTFVPYSAVAIG
FT                   AGADDVNEFLEKQYKPDMSLDDAAALAVAAINLKDEVKGPESVRMAKVTSKDRTVQNVS
FT                   GADIEAHMQASSKFSK"
FT                   /transl_table="11"
FT                   /protein_id="YP_875124.1"
FT   gene            158584..159264
FT                   /db_xref="GeneID:6370356"
FT                   /locus_tag="CENSYa_0176"
FT   CDS_pept        158584..159264
FT                   /locus_tag="CENSYa_0176"
FT                   /gene_family="HOG000105437" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methylase involved in ubiquinone/menaquinone
FT                   biosynthesis"
FT                   /EC_number="2.1.1.-"
FT                   /note="COG2226"
FT                   /db_xref="GI:118575382"
FT                   /db_xref="GeneID:6370356"
FT                   /translation="MGLAGYWPEVLNVLREIIPVYDRVNSYISLGRDTVHRRRGITGRI
FT                   SPGDKVLDAGSGFGNMSGTALDICGDLDVTMCDPLLPMLKKTNQDTPRALSCGVFEHMP
FT                   FRTGGFDAVLCGYSLRDAISLKTAISELHRVLKDGGRLVIVDLGKPDCIVYRAGVSIYL
FT                   RLVLPIIALIAGGRLGLKFATLYGTFQRWPRNKKLEEMLLEKFSRVEFEKDLKGGAIMV
FT                   AAYK"
FT                   /transl_table="11"
FT                   /protein_id="YP_875125.1"
FT   gene            159261..160517
FT                   /db_xref="GeneID:6370357"
FT                   /locus_tag="CENSYa_0177"
FT   CDS_pept        159261..160517
FT                   /locus_tag="CENSYa_0177"
FT                   /gene_family="HOG000105448" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="permease of the major facilitator superfamily"
FT                   /transl_table="11"
FT                   /note="COG0477"
FT                   /db_xref="GI:118575383"
FT                   /db_xref="GeneID:6370357"
FT                   /translation="MKTTLLLVNAVALLVGISYGMHGPSLPIFAKNVIGASYSDLGLIG
FT                   LGNFIPYMFIPLFVGLLLDRYNRGHLLSIGVVLNSASIYLLSIAQTVPEVAVYRVMTGA
FT                   AHAFFWPPCVRIISSVSTGRERVLNVGRFTGFFIGGVTMGPLLGSVLLENVDVTYRALF
FT                   QITAFVLAAAIIASISLSRRHARDSATGLATPAASVSIHTPHFTLSAVKAMARFPEVIL
FT                   VLVYCTASFGVILAIFPAYLDDNLLTGTEIGILYFVFGLSRITALIMVGRLARRTGHTL
FT                   VASTVSLVIGLGLAYVAGITGGGLFLFAASLLIMGFGFSVLFPLALEVVLSRTHKKITG
FT                   SMIGAYETTIGIGWVTGPIIVGVISEFYGGDLPYLVLCILGAGVAVLSAARRHRLEPAR
FT                   SPGGASLHGAPPSGLDTPS"
FT                   /protein_id="YP_875126.1"
FT   gene            160861..161199
FT                   /db_xref="GeneID:6370358"
FT                   /locus_tag="CENSYa_0178"
FT   CDS_pept        160861..161199
FT                   /locus_tag="CENSYa_0178"
FT                   /gene_family="HOG000245365" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Sec-independent protein secretion pathway
FT                   component"
FT                   /transl_table="11"
FT                   /note="COG1826"
FT                   /db_xref="GI:118575384"
FT                   /db_xref="GeneID:6370358"
FT                   /translation="MLSLGLNVAGSEWIIIIFAALVLILGTNKLPEAAKKLGRAVNEYN
FT                   KAKQDMQNQMKDYTSHDIGVKGPLGNERDKLEAIARSLGEDPSGKTTEQLKDLIQEKIG
FT                   RRDDPGAA"
FT                   /protein_id="YP_875127.1"
FT   gene            complement(161250..161444)
FT                   /db_xref="GeneID:6370359"
FT                   /locus_tag="CENSYa_0179"
FT   CDS_pept        complement(161250..161444)
FT                   /locus_tag="CENSYa_0179"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575385"
FT                   /db_xref="GeneID:6370359"
FT                   /translation="MVNYLTQLTAMHKKYSLQLKKAQTRGAVTKAYIKHKKDHSKMLKK
FT                   HLKEELADVRKVKSKLPRR"
FT                   /protein_id="YP_875128.1"
FT   gene            161579..164041
FT                   /db_xref="GeneID:6370360"
FT                   /locus_tag="CENSYa_0180"
FT   CDS_pept        161579..164041
FT                   /locus_tag="CENSYa_0180"
FT                   /gene_family="HOG000250411" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="helicase"
FT                   /EC_number="2.7.7.-"
FT                   /note="COG1205"
FT                   /db_xref="GI:118575386"
FT                   /db_xref="GeneID:6370360"
FT                   /translation="MQKHPCPSCGSALKIDRTFDGRAHVTCTGCKVEDLIENAGDPDEI
FT                   ILEMAYRLDKGSGGAPLDGLVREKAEIDEMIGGIRVDGLTRDILYTKQDYIAHYSRICR
FT                   PPPEEGPEVENMNLDPRISAHLKKIGIDRFYRYQADALNSISGGRSTVISAPTASGKTE
FT                   AFLVPVIQGIEGGRGVQALIVYPTKSLARDQASKIASFCRSTDITSAVFDGDTIDAERR
FT                   GMLDSPPDILVTNFDVLHHHMWRNTQLASVLGGIRYLVVDEAHYYSGIFGSNVHHIIKR
FT                   LRRLAGDMTCVAASATLDGAAEFCSSLFGEEMHLVEGEGGGGETEFVMVFPSMRKQRAL
FT                   MVDLLRRLSRGRHKTMVFNSSHKNAELLAIQASKQGMRIRVHRAGLSPGYRRSVERSFR
FT                   DGSLGAISCTPTLELGIDVGDVDGVVSSVVPYNRLIQRMGRAARRGQRGYAFLALGNDP
FT                   ISQYYKNHPSDYFEDTEKSYIDPENPLVEEYQVLAMACDKPLDKQEAAGHQGVVEAHQR
FT                   AGRLELRDGRYTPHRAKAAQMLKEYSIRGIGESLGIYHGKKRVGERALPIALEELHRDA
FT                   VYLMAGSRYRVVESGYPEGMYARLERLPRDYPYFTKALKMENPLIEEVYESRRVFGTEV
FT                   AFCRLQIRKIVHGYVNVELGRDEAVGEPVALDYPMEYEFVTKGLAFRAPRPGKEIETAE
FT                   DPAAAEAGCYHAAEHVLIEGSNMITGGAAQDLGGISLGDTGMIFIYDGAIGGNGASRSL
FT                   YGRLEAAIGRGAAILSECPCGDDRGCPRCTFSYRCGNNNDYLHKEAALGVLGEMLSGTE
FT                   SGLGEPGL"
FT                   /transl_table="11"
FT                   /protein_id="YP_875129.1"
FT   gene            complement(164038..164259)
FT                   /db_xref="GeneID:6370361"
FT                   /locus_tag="CENSYa_0181"
FT   CDS_pept        complement(164038..164259)
FT                   /locus_tag="CENSYa_0181"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575387"
FT                   /db_xref="GeneID:6370361"
FT                   /translation="MYIRDAAVIRAMAGTKQGAACPHCNSSSGHSLLKEWGYGSVKVSR
FT                   YECTCGKTFQSYLSKGGSTWTIPKNTNA"
FT                   /protein_id="YP_875130.1"
FT   gene            164390..165949
FT                   /db_xref="GeneID:6370362"
FT                   /locus_tag="CENSYa_0182"
FT   CDS_pept        164390..165949
FT                   /locus_tag="CENSYa_0182"
FT                   /gene_family="HOG000105469" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA topoisomerase IB"
FT                   /EC_number="5.99.1.2"
FT                   /note="COG3569"
FT                   /db_xref="GI:118575388"
FT                   /db_xref="GeneID:6370362"
FT                   /translation="MNWKTLQHSGIHFPPEHEVKGFKIKVKGKQVNLTPLQEEMAYQWA
FT                   KKKDTPYAQDKVFQKNFARDFAKELGIKLLYKDLDFSEAYRLVDMEKDKKDMMTKEEKK
FT                   EIAAKRKEIREGLKAKYGIAVMDGKEVEIASYMAEPPGIFIGRGKHPLRGKWKRRIGPQ
FT                   DVVLNMGTKAKAPPGKWKKIVHEKDGIWIAKWTDNLVKKDKYVWLADTAGLKQERDRSK
FT                   YEKAVALSKKIGEIEAKIVKDMKSKDPKISKIATACYLIYRTAMRVGDEKDKDEADTVG
FT                   ATTLRKEHIRISDGVIEFDFLGKDSIRWNEKLKVTGDDEQFSRNLQGLVKSIKPKDEIF
FT                   KDIRSSDVNRYYSGIVKGVTAKVFRTYLASKKVSEYLRKNDKIRSKSAFFKLYHAKSAN
FT                   LEAAIMCNHKRTVPKTFKKALEKKKETLKKAKGATPKTDKQKERKKERIEKIGLQIKLA
FT                   QNTRDYNVGTSLRNYIDPRIFKAWTDEVGAEWEKLYTTALQRKFLWVRDEKEPWKKVSK
FT                   QY"
FT                   /transl_table="11"
FT                   /protein_id="YP_875131.1"
FT   gene            166015..166105
FT                   /db_xref="GeneID:6370363"
FT                   /locus_tag="CENSYa_0183"
FT   tRNA            166015..166105
FT                   /db_xref="GeneID:6370363"
FT                   /locus_tag="CENSYa_0183"
FT                   /product="tRNA-Arg"
FT   gene            166154..166318
FT                   /db_xref="GeneID:6370364"
FT                   /locus_tag="CENSYa_0184"
FT   CDS_pept        166154..166318
FT                   /locus_tag="CENSYa_0184"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575389"
FT                   /db_xref="GeneID:6370364"
FT                   /translation="MVKKMDYSESSVFSCLLRLSAEALYAALLEFLAFDLWLLEEFPLP
FT                   MHGLGPARS"
FT                   /protein_id="YP_875132.1"
FT   gene            166477..167673
FT                   /db_xref="GeneID:6370365"
FT                   /locus_tag="CENSYa_0185"
FT   CDS_pept        166477..167673
FT                   /locus_tag="CENSYa_0185"
FT                   /gene_family="HOG000105470" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575390"
FT                   /db_xref="GeneID:6370365"
FT                   /translation="MAELDEFAEALFGQLVVETDEEKQIADLAERIRDDAEFDVSFTGL
FT                   EDAAGRIFPEMRKRLAGFPGMGVQGEISIELASLRDFKLLKGRKVFTDKDSRGFVDGLF
FT                   EAVADADAGALVGLIRRDLAKYLVYSTYAIQYLSRISTTYGDFLDGKIYLNDFILSSYP
FT                   QIILYRQGQPFKARFGGVESGYMGALKMTILEELIHSQQDPLHRMNTEAAIQVNSINEE
FT                   LAGIIIGLEDETASSLYEHMQLQEVPDDFPVAKRANLFFMLNPDNFIVNVLGPDVMTYD
FT                   RIEIDPEISRMVPELLGVYQKWLGPIQRHHAAFTTMEGMAGFLVEEILGDDPDFQAYLG
FT                   SFMGTDMSSYRVRKDMGRDFTRSVHEKLGAGTFEMLLNSPPNTKELKDPARYLGRVGS"
FT                   /protein_id="YP_875133.1"
FT   gene            167673..168464
FT                   /db_xref="GeneID:6370366"
FT                   /locus_tag="CENSYa_0186"
FT   CDS_pept        167673..168464
FT                   /locus_tag="CENSYa_0186"
FT                   /gene_family="HOG000263801" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG2912"
FT                   /db_xref="GI:118575391"
FT                   /db_xref="GeneID:6370366"
FT                   /translation="MDWASMVRDPGTGLGAKCLDTSRILAYPDLDSAVYSAKLDALAEE
FT                   ARRETGDKGDRYALAVACEMLARVGYSGNKDDYYDPRNSHLHEVIDRRTGTPISLCIVY
FT                   AEVAGRLGLELKLAGFPGHVVAVLGEETVIDPFNGGRLVGHDELQSILDGLFGGRLVMN
FT                   PSFLDPMTDEAVLLRVSRNLRNSYANSYDYGRASACADMALSLEPDSPGDIRDKGIIEE
FT                   KLGNYSSSLEYLERYIQKSPRGRDVEVITELARATREKLSR"
FT                   /protein_id="YP_875134.1"
FT   gene            complement(168454..168735)
FT                   /db_xref="GeneID:6370367"
FT                   /locus_tag="CENSYa_0187"
FT   CDS_pept        complement(168454..168735)
FT                   /locus_tag="CENSYa_0187"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575392"
FT                   /db_xref="GeneID:6370367"
FT                   /translation="MYPGARTRRLHKPAAPRIIRGYSFLPKLFKVILQAIYMGEEGETI
FT                   YERVAKLEDQCAELRDEVNVLKRALRNKIARHEIKMIKHGTDVDSIID"
FT                   /protein_id="YP_875135.1"
FT   gene            complement(168777..168851)
FT                   /db_xref="GeneID:6370368"
FT                   /locus_tag="CENSYa_0188"
FT   tRNA            complement(168777..168851)
FT                   /db_xref="GeneID:6370368"
FT                   /locus_tag="CENSYa_0188"
FT                   /product="tRNA-Arg"
FT   gene            complement(169071..169652)
FT                   /db_xref="GeneID:6370369"
FT                   /locus_tag="CENSYa_0189"
FT   CDS_pept        complement(169071..169652)
FT                   /locus_tag="CENSYa_0189"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575393"
FT                   /db_xref="GeneID:6370369"
FT                   /translation="MFFGSVYPGSIVRPGPCLAVQDGAEWTSCLNPGSCRQAPASLPVE
FT                   CHAMVFYERVLIPCESAMPERLLEDVTEEVKQVEEIVKSAEWKGSDMPVSRIDEWYFLI
FT                   RIARNNINHLEGHPGYQNDESSKCCKWARDVVASFDSMVHPRVMEYLGLHDGAAQPQGP
FT                   GGKEAIPPESVIKSIVDYYDKTHANPKSTG"
FT                   /protein_id="YP_875136.1"
FT   gene            complement(169899..170645)
FT                   /db_xref="GeneID:6370370"
FT                   /locus_tag="CENSYa_0190"
FT   CDS_pept        complement(169899..170645)
FT                   /locus_tag="CENSYa_0190"
FT                   /gene_family="HOG000288286" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glycerol uptake facilitator"
FT                   /transl_table="11"
FT                   /note="COG0580"
FT                   /db_xref="GI:118575394"
FT                   /db_xref="GeneID:6370370"
FT                   /translation="MQRLIFIWRHNLVPSMVNPRAWLAEAICMYGLVFFGPLSVIVSVA
FT                   AFGEELNTISVLFISAAHGSVIAFMVYSFGQVSGAHINPAITIPLILLRKLGVADGIGY
FT                   VGAQLAGAVVAAATLWAILPELGARVNFGTQGGPSEILNGSIGAAFAVEAVLTFFLVVV
FT                   VFMTVLHKKASPGWHGFSIGGMVFLIHLVGIPLTGASVNPARTFGPALISGFWEFHWIY
FT                   WAAPILGGIIAAFAMYYIFVKKAEEE"
FT                   /protein_id="YP_875137.1"
FT   gene            170706..171167
FT                   /db_xref="GeneID:6370371"
FT                   /locus_tag="CENSYa_0191"
FT   CDS_pept        170706..171167
FT                   /locus_tag="CENSYa_0191"
FT                   /gene_family="HOG000022344" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peroxiredoxin"
FT                   /transl_table="11"
FT                   /note="COG1225"
FT                   /db_xref="GI:118575395"
FT                   /db_xref="GeneID:6370371"
FT                   /translation="MAISEGDKEPKFEAQDSDGKTVKSSDYAGKRHVIYFYPKNFTPGC
FT                   TIQADEFSVNLAKFKKAGIEIIGVSPDDSASHKKFCNKMGVKYTLLADTDHTVSKGFGV
FT                   WGTKKFMGKEHMGVIRSTFLVDEKGLVFKVFPKVKPAGHAAEVLDCFKS"
FT                   /protein_id="YP_875138.1"
FT   gene            complement(171229..172347)
FT                   /db_xref="GeneID:6370372"
FT                   /locus_tag="CENSYa_0192"
FT   CDS_pept        complement(171229..172347)
FT                   /locus_tag="CENSYa_0192"
FT                   /gene_family="HOG000105482" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575396"
FT                   /db_xref="GeneID:6370372"
FT                   /translation="MATKKGSKKELEDKIADLERKLDQLSAGLEAKPSTAQAKPAEQPK
FT                   PAEPEPAKKPKGTLPKGMGEAKPAEPKPEPTKPKGTLPKGMGEAKPTAQPEPPKKPKGT
FT                   LPKGMGEAKPAEPKPEPTKPKGTLPKGMGEAKPAAQPEPPKKPKGTLPKGMGEAKPAAP
FT                   KPDPAKKVEAKAAPANNAQALELIYRDSAMTNPFEYKAKVPGYTPSPNRYYARLHATMG
FT                   SAPTSDWNMQKAKVTGYTAPSNNYFATRQRLAYHPADKQFNGFDYKITGVEAKPEATKA
FT                   PPPEPEKPKQTLPKGTLPKGTLPKGTAQAPPKPAETKSDLASYESDYLARLDREAKEAA
FT                   ELAAAAAELAAKKRAEAQGAAAKPRGTLPKGF"
FT                   /protein_id="YP_875139.1"
FT   gene            172694..176344
FT                   /db_xref="GeneID:6370373"
FT                   /locus_tag="CENSYa_0193"
FT   CDS_pept        172694..176344
FT                   /locus_tag="CENSYa_0193"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="superfamily I helicase"
FT                   /transl_table="11"
FT                   /note="COG1112"
FT                   /db_xref="GI:118575397"
FT                   /db_xref="GeneID:6370373"
FT                   /translation="MSDGEDLERLQNNLRAYQEKLLHINAGNRSILLKKIRPKNNFDLA
FT                   VLEQFRKGTVKRILNRTLVSGASPIRVLPDSAKGDDADAARSDLRKLSLNMNSIEEETG
FT                   ERACHIGWPFIEGGATEKFGVRGPLVLFPAYLKQNRGAQNPGWEIHFVDDRPVLNGAVI
FT                   SAIKKKGEVDIPDDLDELFDAMMEDVVSNGGAWSEFEFLAMFATWIAGILPMDESLNDL
FT                   SYANATDMGAEDIGEMRGQGLHLRNHAVIGSFPQANNEIFKDYVKLQEIDGASDLGVMG
FT                   ELLGIRSGAEEPGEKADLDRTQSIELNTVFLSDSSQDEVILDSKRSGLVVVRGPPGTGK
FT                   SQVIANLVCDALTNDRKVLVVCQKRAALDVVHRRLAKVGLDRFSIILDKNNSNRARMYG
FT                   QLDAIILERREPIKEHEDIMPVSKKIDETVGHLSALGGALHAEYFGGVTAQMLYSRLKP
FT                   GYVSRLDLGSIGTGVGYSDLEGYISRIRGLEALYKRLSNGSHPWRKRKSFAHHKRSFKQ
FT                   EILDDIAKMASLLDTARIMGSLDMQEKLIVKLEGYESSGGLMGGFKRRGLSKEIAEMTG
FT                   ADVSEEFVRNELPRAKDGAIFWGMLGDLLGLFDGRAPPEPGKAALRSMLEELRTSLDDF
FT                   DDMQELDLRREDSGEVFAILDECSRKLEDEDWSEAVRQELMSHWLEQIEGDNAVLRGSP
FT                   FRGYEAHVEELKVLLERKREAVVKKIQHDIANTVTVPDISGSMSPDTIKWRALHEELKK
FT                   KRKVLPVRKLFNMYWDQLLRLSPCWLTSPEAASKTFPLQRNLFDLVIVDEASQLAAERS
FT                   LPFLYRAKNVVVAGDDKQLRPFDLFRITDEDDETEHVSAEKSLLDIAVVRHDPHQLAWH
FT                   YRSEYQNLIDFSNHAFYGGRLQVAPNVSMDPSTPPIRWIPSNGTLVKKRNHVEAGDVLD
FT                   EVQKIWEGCMGGEDWPSMAVVTFNEKQQELIERTHEKRKDEDPEYLELFNRSEEANKSE
FT                   RFAVKNIENIQGDERDIIIFSIGYAKDPEGSFANRFDMLGMEAGENRLNVAITRARRSM
FT                   VVVCSIEPSEIKETSKNPGPRLLRYFLEYAKAVSSMDVKSQEEVLSRLGDPAAVRKGAG
FT                   ETESYFEDRVLEGLVSRGYAVHAQIGQSGYRIDLAVVHPDDPGKYVLAVECDGASYHSA
FT                   KSVIERDISRQRFLEAKGWKFMRVWSTDWWRDPEGQLDDIEKRIGELRSS"
FT                   /protein_id="YP_875140.1"
FT   gene            complement(176361..177302)
FT                   /db_xref="GeneID:6370374"
FT                   /locus_tag="CENSYa_0194"
FT   CDS_pept        complement(176361..177302)
FT                   /locus_tag="CENSYa_0194"
FT                   /gene_family="HOG000105243" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HNH endonuclease"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575398"
FT                   /db_xref="GeneID:6370374"
FT                   /translation="MFNRFFSSANRMSSTYKPVFLRALLDLADLQNPQKARKMVGKQWV
FT                   EQRNGKIIVDLNFIVVRFAKYYWDMEYSFHLKHAQEPRGASITNMIERVHKKEGLEKPP
FT                   TAADIAGGSMEAFRREAIQKSIKKHVWTHLLTNMEGLYEKDRWTITLDEDIVGFLNVHR
FT                   TLLRRGINDVLTRYLEKINRFTPQISNKIDAERPPRIQLDRDTKIRMKHWQDSKCFYCR
FT                   GDLSSPHVDHVIPFNYVFSTDSYNCTLACQKCNCTKSDKLPIERLFCQVLERNDYQGSY
FT                   FKEKKCPYDENSYNLLYKNCAAEYNRDKLFEP"
FT                   /protein_id="YP_875141.1"
FT   gene            177352..178161
FT                   /db_xref="GeneID:6370375"
FT                   /locus_tag="CENSYa_0195"
FT   CDS_pept        177352..178161
FT                   /locus_tag="CENSYa_0195"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histone acetyltransferase"
FT                   /transl_table="11"
FT                   /note="COG0454"
FT                   /db_xref="GI:118575399"
FT                   /db_xref="GeneID:6370375"
FT                   /translation="MILPCRPSVRAYIRASSREPVEIRPASSQDREFVMSVCRAEYPDG
FT                   DYVEDVWDMWLAAGGTCIIWENGERAGLFNAVVEGAQGWVEGTRIHPDYRRRGLGTAVL
FT                   KYAEQLTAGAGGSTVRSIISRENMPSLARSEKAGWKRGDLWGWYSLRPGDPVFVEPIDA
FT                   GAPDAAQYADSWRFYDMPPGFAGAKSLPGCTITIIPARYYPDTALVTVLDGDDLSSLAS
FT                   YLRSMGIGRRQMHGWGSGLHILSRLDPSLFKADFEPVEEYHLMSMDL"
FT                   /protein_id="YP_875142.1"
FT   gene            178254..178628
FT                   /db_xref="GeneID:6370376"
FT                   /locus_tag="CENSYa_0196"
FT   CDS_pept        178254..178628
FT                   /locus_tag="CENSYa_0196"
FT                   /gene_family="HOG000105493" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575400"
FT                   /db_xref="GeneID:6370376"
FT                   /translation="MDDFEKEYPGFDWRNTPAYEHPGGKDCPCPKHEYIREQINFTKQV
FT                   NEKGSDHSKVTLKFCPEHYKVYKEEVIPSMPFKYRLLTKVALKMGAVKIELLTHMQSDN
FT                   CFYCKFGSGGHDKKNELPPI"
FT                   /protein_id="YP_875143.1"
FT   gene            178657..178881
FT                   /db_xref="GeneID:6370377"
FT                   /locus_tag="CENSYa_0197"
FT   CDS_pept        178657..178881
FT                   /locus_tag="CENSYa_0197"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575401"
FT                   /db_xref="GeneID:6370377"
FT                   /translation="MACRDGSSCRRAGSAFYQAVCTGICGNQGMTLPSLCTRRSRCRTG
FT                   TASPVIQSCPRPCRRRIFCPPWDDAQSYL"
FT                   /protein_id="YP_875144.1"
FT   gene            178951..180393
FT                   /db_xref="GeneID:6370378"
FT                   /locus_tag="CENSYa_0198"
FT   CDS_pept        178951..180393
FT                   /locus_tag="CENSYa_0198"
FT                   /gene_family="HOG000227663" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /EC_number="4.1.1.-"
FT                   /note="COG0043"
FT                   /db_xref="GI:118575402"
FT                   /db_xref="GeneID:6370378"
FT                   /translation="MPIEDTGGLIEALEEAGELRRVTGQVDPDLEIAEILRRVMYSKGP
FT                   AILFEDVKGHSMPVLGNAFGSEKRMQIALETEDFTEIGQRIVDMTRMEVPHGMLGKLRK
FT                   LPELSKMGGAFPHVEKGGPVTEVTGEIPSLDALPVLKTWPGDAGRFITLGLVATRHPDT
FT                   GVRNLGVYRMQVVGKNQLIMHWQKHKRGAHHSEIARESGGRIEAAVIIGAEPATVFSAV
FT                   APVPEGLDKYLYAGIVRKEGIRTVQCRTIDLDVPANSEIVLEGYVDPAEMLEEGPFGDH
FT                   TGYYTPPEEYPVFTITGMMRRKKPVYLTTIVGKPVLEDAYIGRVIERSFLPLIRMLQPE
FT                   VVDFAMPPSGWFQGMAIASIKKQYPGQAKKVMMGLWGTGQLSLTKMVIIVDHDVNVHDI
FT                   HDVIWAMTTRADAARDITIIRDAPTDTLDPASPIVNLGSKMGIDATQKTPEEGYSRVIQ
FT                   EQVQSDPDTAQMVDSRWESYGI"
FT                   /transl_table="11"
FT                   /protein_id="YP_875145.1"
FT   gene            complement(180425..181531)
FT                   /db_xref="GeneID:6370379"
FT                   /locus_tag="CENSYa_0199"
FT   CDS_pept        complement(180425..181531)
FT                   /locus_tag="CENSYa_0199"
FT                   /gene_family="HOG000224281" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thiamine biosynthesis enzyme"
FT                   /transl_table="11"
FT                   /note="COG1060"
FT                   /db_xref="GI:118575403"
FT                   /db_xref="GeneID:6370379"
FT                   /translation="MSQLIGQLHDDVEDILDNSLKGVRPDKEACLRLLRSEDVQLMGLV
FT                   AGHLTKQRFGKKASFVNNIILNYTNVCITDCKFCAFYRSPGHEEAYTLTLDEIEARVKT
FT                   AREMFKITQVLIQGGHNPKLKLEYYEDAFRMIRSKYPEVGVHGLSASEINMISKVEKSS
FT                   TKEILSRLKVAGLQSMPGAGAEILDDEVKAKISPKKISTADWLRITEEAHREGIKSSAT
FT                   MMYGHVETENDVANHLQKLADLQEKTGGFMAFIPWTFEPNNTLMQSEGTVRFDSGGEKL
FT                   LKMIAISRLFFDGSIDHIQSSWLTAGVGMAQLALQYGADDFGGTLIGEEVVSCTGSRAT
FT                   EMTDESIRRSVEQIGYEIVERDNFYNPV"
FT                   /protein_id="YP_875146.1"
FT   gene            181742..182473
FT                   /db_xref="GeneID:6370380"
FT                   /locus_tag="CENSYa_0200"
FT   CDS_pept        181742..182473
FT                   /locus_tag="CENSYa_0200"
FT                   /gene_family="HOG000224790" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DhnA-type fructose-1,6-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /EC_number="4.2.1.-"
FT                   /note="COG1830"
FT                   /db_xref="GI:118575404"
FT                   /db_xref="GeneID:6370380"
FT                   /translation="MLCIPMDHGISSGPIEGLEDPHAPIYSCEQHGLTSVIINKGVLKT
FT                   MPRPAKIGILVHFSSSTSLSLAPNRKMLTGTAAEAARMGADGVSVHINVGGKEEPEMLE
FT                   QLGVISGQCHRWGMPLMAMMYPRGENIKDPHDPAVVAHASRLGAECGADIVKTLYTGDP
FT                   DSFKTVVRGTPVPVVIAGGPQMDSDRDLLNMTEDAMRAGAKGVTYGRNIFGHANPPAVV
FT                   RALSRVIFDGATAGEAASELG"
FT                   /transl_table="11"
FT                   /protein_id="YP_875147.1"
FT   gene            182496..183512
FT                   /db_xref="GeneID:6370381"
FT                   /locus_tag="CENSYa_0201"
FT   CDS_pept        182496..183512
FT                   /locus_tag="CENSYa_0201"
FT                   /gene_family="HOG000015603" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="3-dehydroquinate synthase"
FT                   /EC_number="4.2.3.4"
FT                   /note="COG1465"
FT                   /db_xref="GI:118575405"
FT                   /db_xref="GeneID:6370381"
FT                   /translation="MPRAQLQRFLSGISAEGIRTVYLDPKDAAKAKLDAMHSSPSSRYV
FT                   VLEGRAAKPRGKKVGRRFKILSNKDIDGVLQEAQKGLDFVITEVQDWKIIPLENMIAKL
FT                   HKIHTRLYAVARSPAEVRKMFSILDVGVDGVIFTASTVGDVREALVHLGTKSFRLQPAR
FT                   ITEIREVGDGERVCVDTASMLERGEGMLVGSRSNFMFLVHNESVGSSFTSPRPFRVNAG
FT                   AVHSYTLGTDGNTLYLSEVETGTEVLVLDSHGRARRAAVGRSKIERRPMLMIKAEADGE
FT                   IGGIIAQDAETIRFVRPGGGLVSVTHLKKGDKVLVHSKPAAGRHFGMEVADEYILEK"
FT                   /transl_table="11"
FT                   /protein_id="YP_875148.1"
FT   gene            183509..184162
FT                   /db_xref="GeneID:6370382"
FT                   /locus_tag="CENSYa_0202"
FT   CDS_pept        183509..184162
FT                   /locus_tag="CENSYa_0202"
FT                   /gene_family="HOG000105515" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /EC_number="4.2.1.10"
FT                   /note="COG0710"
FT                   /db_xref="GI:118575406"
FT                   /db_xref="GeneID:6370382"
FT                   /translation="MRYSTCVSIAEEGPAEMAKALRTALKKSDYAELRLDYLEPEDVPK
FT                   MLKKAGTMLGHCICTLRPRIEGGRFPGTEKERRDILADISRYKPYLVDVEYDTIRKSPA
FT                   LRRRLGRKVLVSWHDFKGTPQTGMLRRRLRAMSAYSTHVKMVCTAKKPADSSRMLALYS
FT                   DAGRTKLVAFAMGEQGKMSRLLCLYLGSPFTYVYVSRPTALGQFGLKEIGRYIA"
FT                   /transl_table="11"
FT                   /protein_id="YP_875149.1"
FT   gene            184217..185023
FT                   /db_xref="GeneID:6370383"
FT                   /locus_tag="CENSYa_0203"
FT   CDS_pept        184217..185023
FT                   /locus_tag="CENSYa_0203"
FT                   /gene_family="HOG000237875" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="COG0169"
FT                   /db_xref="GI:118575407"
FT                   /db_xref="GeneID:6370383"
FT                   /translation="MIGDPINHSLSPTLHNAAFMELGMDCTYIAYRIPRGELEEGIGSL
FT                   KDTGVEGFNVTIPHKVAVMKYMDRLDETCSMAGAANTVSIKDGVLKGYNTDMGGFLDPI
FT                   KKRGIGIEGTEALVLGAGGAARAVTVALAGEGARRITIANRTQQGAREIALLARRLGAD
FT                   AVPADLEDVGRLARRSKFIVNCTPVGMGGEPSLVPEESIQDTSVVYDIVYMPLETDMIK
FT                   KAKARNAVYIRGFEMLLGQACRAFEIWHEVEAPYKAMKQMMVGDLA"
FT                   /transl_table="11"
FT                   /protein_id="YP_875150.1"
FT   gene            185020..185865
FT                   /db_xref="GeneID:6370384"
FT                   /locus_tag="CENSYa_0204"
FT   CDS_pept        185020..185865
FT                   /locus_tag="CENSYa_0204"
FT                   /gene_family="HOG000105526" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="archaeal shikimate kinase"
FT                   /EC_number="2.7.1.71"
FT                   /note="COG1685"
FT                   /db_xref="GI:118575408"
FT                   /db_xref="GeneID:6370384"
FT                   /translation="MRVRAEVHGAISIVNGIAAGKGATLGIGLRVIAEAEAVPGRGIVI
FT                   ESPGRRLSSRLITKTIERSVPRRELDRNKLRISLDSEIPTGYGLKSSSAISTSVALACM
FT                   GLFGKPEDSKVLMAGVRASIETKVSITGAYDDACACYYGGFAVTDNYKKRLVRSEKAPS
FT                   DLGILIFIPRGKRRGKPLKLRPIKGAFEAAWSMAKRADYWGAMLVNGLAAAPILGPDPE
FT                   LLVRLMERGALGASVSGNGPAVAAVVRKGQMGAVRKVFSDEGRIITSSVNNRKADVREL
FT                   "
FT                   /transl_table="11"
FT                   /protein_id="YP_875151.1"
FT   gene            185867..187111
FT                   /db_xref="GeneID:6370385"
FT                   /locus_tag="CENSYa_0205"
FT   CDS_pept        185867..187111
FT                   /locus_tag="CENSYa_0205"
FT                   /gene_family="HOG000247372" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="5-enolpyruvylshikimate-3-phosphate synthase"
FT                   /EC_number="2.5.1.19"
FT                   /note="COG0128"
FT                   /db_xref="GI:118575409"
FT                   /db_xref="GeneID:6370385"
FT                   /translation="MGKSELRGTVSCPPSKSYTHRMVFLASLSEGTSRIKNILHSEDAE
FT                   ATMRACRGFGADITEDGSDLVIRGNPEVKPADIDVANSGTTIRIAAAVAALAGGRSNMT
FT                   GDSSIQKRPMGPLLEALEAIGARCVSEEGSPPLSVEGPIQGGAASIRGDVSSQFISALL
FT                   MAAPLTPMGVELSITGEPVSRPYIGATISAMAKFGVQVVAAADHKKYGVRPGGYKGTEV
FT                   VVPPDYSTLSLLLAASVLTGDGLEIEAENSDLPQGDKAFLGILEQLGVTLRPGKRIATS
FT                   SPPRLNGGTFDLGDTPDLLPPLSILALKCDRMEIVNVGHARLKETDRIGILCRELGKLG
FT                   LDIEERKDGMLIRTGGGLHGAELDPEGDHRLFMAFCIAGMHLGDCVIRDTDSVAVSYPG
FT                   FVQDMKSVGAVIKPD"
FT                   /transl_table="11"
FT                   /protein_id="YP_875152.1"
FT   gene            complement(187108..187920)
FT                   /db_xref="GeneID:6370386"
FT                   /locus_tag="CENSYa_0206"
FT   CDS_pept        complement(187108..187920)
FT                   /locus_tag="CENSYa_0206"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG3586"
FT                   /db_xref="GI:118575410"
FT                   /db_xref="GeneID:6370386"
FT                   /translation="MFPRLQFLESEYTIDNIRPDSIVYDDNANSFAIIEYKNVRNKGVV
FT                   DQGMSYYKLIKDRPSDFVLLAQKKKLNINREDVNWDEARIIFIAPEYTIHQRRAASLAM
FT                   LPIELYRISKYEGGVFGLELLEKKTEGKMSTSVVEEYSTEKFLNGDYDNTGTDEDRKKL
FT                   FYTIRKIIMERFPDIEFRQRKWYAGFHSTENKSYVCTISTKATSLSVTYSTKANLFAGD
FT                   PFVESLIDELGKKKGNLGIGSYRSTIKSESDVEKMLFLVSKVYDDNKN"
FT                   /protein_id="YP_875153.1"
FT   gene            complement(188034..188243)
FT                   /db_xref="GeneID:6370387"
FT                   /locus_tag="CENSYa_0207"
FT   CDS_pept        complement(188034..188243)
FT                   /locus_tag="CENSYa_0207"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575411"
FT                   /db_xref="GeneID:6370387"
FT                   /translation="MARYLLILISDGRIEPTHMLVVNRQGGIGRQHVEWCETGAPGVKS
FT                   IITVKKPSLIMSNLVGRVFGERKH"
FT                   /protein_id="YP_875154.1"
FT   gene            complement(188290..189969)
FT                   /db_xref="GeneID:6370388"
FT                   /locus_tag="CENSYa_0208"
FT   CDS_pept        complement(188290..189969)
FT                   /locus_tag="CENSYa_0208"
FT                   /gene_family="HOG000105527" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Rad3-related DNA helicase"
FT                   /transl_table="11"
FT                   /note="COG1199"
FT                   /db_xref="GI:118575412"
FT                   /db_xref="GeneID:6370388"
FT                   /translation="MLKSFPGELVPRPIQKEILSEIDSVLGSGYTKIVLCAPTGSGKSP
FT                   IAVALAAKFESSFVVTATKSLQDQYSRDFPMLKPVKGKDNFACPKLMEEDKFDMGDYPG
FT                   AIRAGLTCNKGECIEKRVENGKEVERTCRFKPAIADYEKGPSGTVCPYYGQKYAALLAP
FT                   HSIWNYASYFQMMKYTRKAYESYLDRKVAVFDEAHRIEDQIINFVGITIRASQVEECGL
FT                   ILGDYELGEIEGVTSLLDDLAGSYAKAIQEVQEHESRRPNPDYSKLVPLENKYERAARA
FT                   KISVYSDGENFVVNDPQMSQGEFSSITLTPLDISGYVEDLCLSPYQVFMSATISRDPFC
FT                   ETTGIDPDKVAFVDVEHSPFSMESRRIEFMDIARLNYSSPPSDEQKVIKAIDGIMKDLH
FT                   PGERGLILTSSIKRCYDILAGLSPSSKARVRLCHSTNEGGRTQDQVLAEHADTPGSVLL
FT                   SASLWEGVDLKDDRSRFQIIAKAPYPGLGDKRTKIKQKKYPLWYSSQALTKLLQGFGRS
FT                   IRNEDDRAVTYVLDSGVKDLIRRARRMVPKSYHDVLKFEHFS"
FT                   /protein_id="YP_875155.1"
FT   gene            complement(190000..190977)
FT                   /db_xref="GeneID:6370389"
FT                   /locus_tag="CENSYa_0209"
FT   CDS_pept        complement(190000..190977)
FT                   /locus_tag="CENSYa_0209"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HD-superfamily hydrolase"
FT                   /transl_table="11"
FT                   /note="COG3481"
FT                   /db_xref="GI:118575413"
FT                   /db_xref="GeneID:6370389"
FT                   /translation="MKAQYVKKLEEGQTVNDYFAILTKEAPRKYSSKAGVWFAFDVADK
FT                   TGPIRVKYWGVDKDTTEELYGTLKAGDVVTISGGTVKMDKFDRGLAIHLSEGACQVAKT
FT                   AEYEEDELVAAGEKDVAGMVTKLWEEIAGIKDDDIRRFLESLFKDKELLKKYSECPASR
FT                   RNHHNYKGGLLEHVLSMSAMSRTIAAQYSPELDVDLMVAGCILHDIGKIYSYDVKPFIE
FT                   HTTDGRLLGHIPIGAEMISGRMNELGDFPPGLKTKLIHMILSHHGSLMAGSPVEPKFPE
FT                   AAALHKIDDCDAFVKNQVQMRRSVGEMDDEWARPGGRGREMYLK"
FT                   /protein_id="YP_875156.1"
FT   gene            191086..191286
FT                   /db_xref="GeneID:6370390"
FT                   /locus_tag="CENSYa_0210"
FT   CDS_pept        191086..191286
FT                   /locus_tag="CENSYa_0210"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575414"
FT                   /db_xref="GeneID:6370390"
FT                   /translation="MVGLGVFSTDGLGPPVAPYGTALILHGNLWPGKTHNGDKPCGSFQ
FT                   CDLGVYLIDGFQVGGVKYSIC"
FT                   /protein_id="YP_875157.1"
FT   gene            complement(191438..192010)
FT                   /db_xref="GeneID:6370391"
FT                   /locus_tag="CENSYa_0211"
FT   CDS_pept        complement(191438..192010)
FT                   /locus_tag="CENSYa_0211"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575415"
FT                   /db_xref="GeneID:6370391"
FT                   /translation="MDMIFEYIFPNFSEFIASITLIISTATIVGSAVKYFHDKDMEKVM
FT                   TSRNLYAEMKNGRDTLEDKNALIECNITLDDEGRDSDYYFKKMLLNHDIYDSAIYSGII
FT                   NSLETKLQQSIQDIFRIVKRRNEYIVQVLYPNSRSTEEERIRNDRMYSKWLNEHEKILK
FT                   KRIPVVMEELEIYRHIFAKRMWVRLWS"
FT                   /protein_id="YP_875158.1"
FT   gene            192343..193434
FT                   /db_xref="GeneID:6370392"
FT                   /locus_tag="CENSYa_0212"
FT   CDS_pept        192343..193434
FT                   /locus_tag="CENSYa_0212"
FT                   /gene_family="HOG000060335" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="COG0082"
FT                   /db_xref="GI:118575416"
FT                   /db_xref="GeneID:6370392"
FT                   /translation="MPGSSIGERLVLTSFGESHGRCVGAVLDGCPAGLELSERDIQYML
FT                   DQRRPGQSSITTQRKEADRVEIISGVFRGHTTGAPIATVIWNTDQKSEAYDELEHVPRP
FT                   GHSDYPAMIKYGKFNDHRGGGRFSGRLTATHVMGGAIARKLLEKALKVRTISYVTSIGK
FT                   VSVQVKPPKTSKPVYSNDVRCPDAAAAARMRKAIVSAKTGGDSLGGIIESVTTGLPVGL
FT                   GEPVFGSLESDLSRAIYSIPSVKGVEFGSGFAGAASTGSENNDPFRIKSGKITTITNNS
FT                   GGILGGLSIGTPITMRVAFKPVSSIPQKQSTVDTKANKPAVLRVKGRHDPCVVPRAPPV
FT                   VDALVSLVIADHAIQGGFIRGVL"
FT                   /transl_table="11"
FT                   /protein_id="YP_875159.1"
FT   gene            193434..194783
FT                   /db_xref="GeneID:6370393"
FT                   /locus_tag="CENSYa_0213"
FT   CDS_pept        193434..194783
FT                   /locus_tag="CENSYa_0213"
FT                   /gene_family="HOG000105538" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="aspartate/tyrosine/aromatic aminotransferase"
FT                   /EC_number="2.6.1.1"
FT                   /note="COG0436"
FT                   /db_xref="GI:118575417"
FT                   /db_xref="GeneID:6370393"
FT                   /translation="MPDIEDLRNRMDDVTLLMERLLKERIEISRKIGRMKMDAGLDVTD
FT                   GRREAALRTKVAEFCDLEGLDTAAAARLLAFLLEESVHLQAEDRPSHLSIFLKAKKLEE
FT                   QGRRIIHMEVGDPDFGPPKGVEHALAEACRMGQTGYGPPAGEPVLRAALAHHARRFGPV
FT                   PGPENVIVSPGARFAIFSAMSHLLGPGDGVIVVGPAWPAYSACADHVGAKVSVVDTRME
FT                   DNWDPKIAEIEAAMDRSAKMMVINYPNNPTGRVPPKGTMDGIMGLARERGLYVLSDEIY
FT                   SSYSTPEWASVLEYGYERAIAVQSFSKSHAMTGFRVGYAVADPGVIRGMARIHALCLTS
FT                   VPGPIQHAALRALDYDVSEWPGTVRKRLEMMSDEAESMGLEFVRPDGAMYLFVKTGTDG
FT                   SALADTLLEQGLAVAPGEGFGKYKDFIRLSACADEGRLAEGMRILRGALG"
FT                   /transl_table="11"
FT                   /protein_id="YP_875160.1"
FT   gene            194795..195640
FT                   /db_xref="GeneID:6370394"
FT                   /locus_tag="CENSYa_0214"
FT   CDS_pept        194795..195640
FT                   /locus_tag="CENSYa_0214"
FT                   /gene_family="HOG000105549" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="prephenate dehydrogenase"
FT                   /EC_number="1.3.1.12"
FT                   /note="COG0287"
FT                   /db_xref="GI:118575418"
FT                   /db_xref="GeneID:6370394"
FT                   /translation="MAVIGAGGRMGSWFAKFFADAGYEVTGYDSENKVTGRAVIKSESL
FT                   VGCVLKADYVLLCTPTRRTPEIIRLIAKEMRRGAYMIEISSQKSKTVSALSRMPPKINP
FT                   ICVHPMFGPGTRRIANRNMISIPVRDAKKELTVAKELFPGASFVTIDAAEHDKRMAVIL
FT                   GLTHLVNLVFASVISRDDKSALTERMSGTTFRAQKIISESILTESPELIETVISNPEIR
FT                   RYAEEFWKDIGRLLTAIQEAKTEEITEYIRACHDRLTEHSDLDDSYKRLYTMVNALDRK
FT                   "
FT                   /transl_table="11"
FT                   /protein_id="YP_875161.1"
FT   gene            195726..196031
FT                   /db_xref="GeneID:6370395"
FT                   /locus_tag="CENSYa_0215"
FT   CDS_pept        195726..196031
FT                   /locus_tag="CENSYa_0215"
FT                   /gene_family="HOG000105560" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="translation initiation factor eIF 2B alpha
FT                   subunit"
FT                   /transl_table="11"
FT                   /note="COG0182"
FT                   /db_xref="GI:118575419"
FT                   /db_xref="GeneID:6370395"
FT                   /translation="MRGLWGGISGKIEDGEDPLYRAVTEVYEEAGIGDMILLKSAGGVP
FT                   IEGEGKKWLVHPFLFGVDDDTVRLNWENDEYKWVGPDLSGLATVPGLQGLLLGLVG"
FT                   /protein_id="YP_875162.1"
FT   gene            complement(195975..197330)
FT                   /db_xref="GeneID:6370396"
FT                   /locus_tag="CENSYa_0216"
FT   CDS_pept        complement(195975..197330)
FT                   /locus_tag="CENSYa_0216"
FT                   /gene_family="HOG000224483" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thiamine biosynthesis protein"
FT                   /transl_table="11"
FT                   /note="COG0422"
FT                   /db_xref="GI:118575420"
FT                   /db_xref="GeneID:6370396"
FT                   /translation="MSTQMASARRGVATDEMKRVAQDEDVTLEWLLPKMAQGSIIIPHN
FT                   VERKEKVHRVGIGTGLKTKVNVNIGTSTLNVNPDEEAEKARTAVKYHADTIMDLSDGGP
FT                   VAEIRRRLLTEAPITFGTVPIYEAYSRGVEEHHNPLLITEDDFISAFENNAKDGVDYTT
FT                   IHSGITKEIAERIMKVKRHGGVVSKGGTITAAWMLKHNKENPYYSNYDYLIEIARKYDV
FT                   TFSLGDALRPGSILDSHDELQVQEMINIARLTKRAHESDVQVMVEGPGHVPLDQVAANV
FT                   KLAKSLIGAVPYYVLGPLVTDIASGHDHIASAIGAAVSAAEGVDLLCYLTPSEHLALPN
FT                   AEEVKAGLIAYRIAAHAGDLVKLRDKAIKWDIKMAEARRTLDWESQLALSIDPEEAARI
FT                   HTRTGQHPGNGVPCTMCGSACVYIMLPKQREYDESADKPQEKPLQARDGSKP"
FT                   /protein_id="YP_875163.1"
FT   gene            complement(197332..197676)
FT                   /db_xref="GeneID:6370397"
FT                   /locus_tag="CENSYa_0217"
FT   CDS_pept        complement(197332..197676)
FT                   /locus_tag="CENSYa_0217"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575421"
FT                   /db_xref="GeneID:6370397"
FT                   /translation="MRLNIQSWSVQARYQRARSSQVPICQRIHRTAGHRIQLWNGTMCG
FT                   SWDGAVHLMGCDAYRERRHGFQASRHDRLPAVPNHSIADHARPMQDQGRTLRFDMPPAR
FT                   YYLNSGGFIP"
FT                   /protein_id="YP_875164.1"
FT   gene            197779..198351
FT                   /db_xref="GeneID:6370398"
FT                   /locus_tag="CENSYa_0218"
FT   CDS_pept        197779..198351
FT                   /locus_tag="CENSYa_0218"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575422"
FT                   /db_xref="GeneID:6370398"
FT                   /translation="MWPDPEGLSLFMTWCNAPDEYKKSIKELSFTYAMHVGGEWNPSTG
FT                   VMKVNPEIPDMAQADFMRDELIHATWTLWGANRHKEFQNGIQDMEPLTPHSASWKSSNH
FT                   KVIWERVSQLVTDAISSGDKAGHGARIPLRLIDIELGFTDDDYKPEGRAQKWAEHGLSY
FT                   AEHIYANMSYSVLMKIRTEKKPDKDDG"
FT                   /protein_id="YP_875165.1"
FT   gene            complement(198437..198685)
FT                   /db_xref="GeneID:6370399"
FT                   /locus_tag="CENSYa_0219"
FT   CDS_pept        complement(198437..198685)
FT                   /locus_tag="CENSYa_0219"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575423"
FT                   /db_xref="GeneID:6370399"
FT                   /translation="MARCETLSEKNDTGEPAIDPNELWFYMDPYYGITDKKNSAWVRKM
FT                   HINKENEIVYTMEWKFIPKSMKPADIVDGWRKPSPEP"
FT                   /protein_id="YP_875166.1"
FT   gene            198939..199538
FT                   /db_xref="GeneID:6370400"
FT                   /locus_tag="CENSYa_0220"
FT   CDS_pept        198939..199538
FT                   /locus_tag="CENSYa_0220"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575424"
FT                   /db_xref="GeneID:6370400"
FT                   /translation="MITLSDEQHETIQLLLGRDLCCHGIRGRLLHRILPWFRYGARVEY
FT                   MKAHVGPHYLMVMPAQTYRDILGELEAGGWTYDDLLRDQPPSPSLREGKLVKEYFLEKS
FT                   VVLHLSLKDGGGWAYYSDIPQYQYWWQELLINIAGNEFKVEWPPMPMPEDVSRWVHARL
FT                   DEDNLTIDWLARDCIKHITDRMGAEDRRWDTLGGYG"
FT                   /protein_id="YP_875167.1"
FT   gene            199804..201120
FT                   /db_xref="GeneID:6370401"
FT                   /locus_tag="CENSYa_0221"
FT   CDS_pept        199804..201120
FT                   /locus_tag="CENSYa_0221"
FT                   /gene_family="HOG000225273" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hydroxymethylpyrimidine phosphate kinase"
FT                   /EC_number="2.7.4.7"
FT                   /EC_number="2.7.1.49"
FT                   /note="COG1992"
FT                   /db_xref="GI:118575425"
FT                   /db_xref="GeneID:6370401"
FT                   /translation="MAKRAAPYVLTVAGSDPSSGAGIQGDLGTISRMGCTGLSVITAIT
FT                   AQNSSGFTGAEPVPTSMVALQMQAVLSDYDVSAVKVGMVLTVPVIRAVSRGLEELDVPV
FT                   VLDPVMHSTTGGRLLDDAALPALSKHLVSRADVVTPNASELAVLSGMKAGTAVQARTAA
FT                   TKLLDRGAGAVAVTGLAGRGKIYDQVVTSKEHFEVSGRRIRGESHGGGCAYSAAMAASL
FT                   ARGMGLKAAAREAAEHSRRSIASTRSGRGLPTVSHGPRDRIEEELQESIGDFVLDDNAW
FT                   RHIPECQTNFVYSKERPRSISGILGVEGRIVRCGNRAVMAGRLEYGGSRHVAAAVLEAG
FT                   RAHPSIRSAANIRYDIRTIKIMKKKGMMVLSYDRTSEPASSKSREGSSVRWGVRAALAG
FT                   SRDIPDAIYHTGDHGKEPMIIIFGKKPSDVMDKIRAILT"
FT                   /transl_table="11"
FT                   /protein_id="YP_875168.1"
FT   gene            complement(201117..201524)
FT                   /db_xref="GeneID:6370402"
FT                   /locus_tag="CENSYa_0222"
FT   CDS_pept        complement(201117..201524)
FT                   /locus_tag="CENSYa_0222"
FT                   /gene_family="HOG000105571" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="small membrane protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575426"
FT                   /db_xref="GeneID:6370402"
FT                   /translation="MLVPLLIISEFVFYEPYLIGHVPAGTELSLVLIVVLAGLSGLIIP
FT                   MNIHRMRMLGASRKSGSWRFSGSVVGAMAGACGCGPVGFALFSTFGSVGAAASAFLTNY
FT                   EVPIRAAAIAVLLLAYFTTVKSLKTECKTAS"
FT                   /protein_id="YP_875169.1"
FT   gene            complement(201595..202233)
FT                   /db_xref="GeneID:6370403"
FT                   /locus_tag="CENSYa_0223"
FT   CDS_pept        complement(201595..202233)
FT                   /locus_tag="CENSYa_0223"
FT                   /gene_family="HOG000105582" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein-disulfide isomerase"
FT                   /transl_table="11"
FT                   /note="COG1651"
FT                   /db_xref="GI:118575427"
FT                   /db_xref="GeneID:6370403"
FT                   /translation="MKKAVIGGIAAAVIIGIAVAGVSMSGQGAAGMIDTSNGSPVVGNA
FT                   DAPITIVEFGDYQCHQCYNWFHNTKPGITEEYIETGMVKFVFVDMAFLGRDSLPASVAA
FT                   YCAGDQGMYWEYHDMLYTLQDPQIDSGWASRERLKAFAFDLGLDPGVFDGCLDSNKHQG
FT                   RVQSNVAEAREFGVSGTPTFAIIFEDGRTETIVGAQPFSVFKNVLDSTV"
FT                   /protein_id="YP_875170.1"
FT   gene            202420..203106
FT                   /db_xref="GeneID:6370404"
FT                   /locus_tag="CENSYa_0224"
FT   CDS_pept        202420..203106
FT                   /locus_tag="CENSYa_0224"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575428"
FT                   /db_xref="GeneID:6370404"
FT                   /translation="MALCVALHMALEPLPRVKDLIALFTVHFCGFAAFLIFHGTLRGRT
FT                   LINILYGGPRDMRDESLEAKCNGSREQLWDKLRRHRSKLFHGRSEMSCVINAAASIGDL
FT                   QVKLVLASAQLPDKNNLTVWMHLLNNGNRPAVMEQDRSAIVVSLKESAESEEYYPTDYD
FT                   GVGGLSKPEVVFPETSKYRGLQFPWLAGACGLYLVVDQMYHKIEVFIPPIPDVPEAGFS
FT                   RLGTPC"
FT                   /protein_id="YP_875171.1"
FT   gene            203225..204172
FT                   /db_xref="GeneID:6370405"
FT                   /locus_tag="CENSYa_0225"
FT   CDS_pept        203225..204172
FT                   /locus_tag="CENSYa_0225"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575429"
FT                   /db_xref="GeneID:6370405"
FT                   /translation="MTNPQWGHEYIESCFDCSLSICLPETDLMRTISELETTAKFLPSP
FT                   IESRNSLMAVITSVLSTGSSSMGESTNSWSFTAGMAATLSETYMSSSCFMDSTSLQSTV
FT                   IMQVPRGSCYFSLTRCLASQADLKLWCHARRLGRAPPSAAQRAPRLKAPLLCLDAAEKT
FT                   RLPCLYDQSPKLSPGIRAKVCQTAPAGQPPQRPCYARSAGMPAYGLVSVMTKVRSAPST
FT                   VSLSVVNGFSSVPAAGSISTGSEQLAATPPTAIASATRPIPRARLLFAMRGFLSLIAAY
FT                   TITPPTTFIKTGSRYHALEFLARYLLHSGHLTAP"
FT                   /protein_id="YP_875172.1"
FT   gene            204290..204472
FT                   /db_xref="GeneID:6370406"
FT                   /locus_tag="CENSYa_0226"
FT   CDS_pept        204290..204472
FT                   /locus_tag="CENSYa_0226"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575430"
FT                   /db_xref="GeneID:6370406"
FT                   /translation="MENLCLKEEYAGGNKPPLTFRNNAITAATDLRRPYARQIRINAGK
FT                   LLIHSWNLEREAPLT"
FT                   /protein_id="YP_875173.1"
FT   gene            204508..205557
FT                   /db_xref="GeneID:6370407"
FT                   /locus_tag="CENSYa_0227"
FT   CDS_pept        204508..205557
FT                   /locus_tag="CENSYa_0227"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575431"
FT                   /db_xref="GeneID:6370407"
FT                   /translation="MEAAKKGVTYFPKQGTYHGDVYGDLAFTNEYDSPVIGIDRADLIR
FT                   DSEAEPISSYIDFNDNADPAYRILSNFVAPINNDKYCSLDRAYNRLHLDKSGMRQNLLH
FT                   IPGSEDDAAKPITRQIQLTLLDHPIETLHSGSERYSYQDMVIQAQTIRYNRNKRERRAL
FT                   ECLKELKYYYTKDKAGREAFGSTSRPDNMQNLSYYDSTSPDDEHRSIMIDEIQDMCDKF
FT                   YDSYRVRLTHFVTNLKMMHALAINAFPSDTHNLEPYQRCIGIKKFPGMPDARLVASPYC
FT                   DDYKLYAVSQPHNVMTLIEGPKRVKTWIGTDGTEHIQMLDYCQYACLQGSPDGRLHGCM
FT                   AAFDSGEMK"
FT                   /protein_id="YP_875174.1"
FT   gene            205590..205976
FT                   /db_xref="GeneID:6370408"
FT                   /locus_tag="CENSYa_0228"
FT   CDS_pept        205590..205976
FT                   /locus_tag="CENSYa_0228"
FT                   /gene_family="HOG000105594" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575432"
FT                   /db_xref="GeneID:6370408"
FT                   /translation="MADSESYGVEKGHSAQFIEWLNKAAGERGIKFEARLYGYTLETDN
FT                   FGSFEMFSWIGDARQSRRLIVRASKRFKVKVIEGGYKTREQMFHTSRTDYAMVRKGDRV
FT                   IGRLQLEASRFRNDHWKIKNEERT"
FT                   /protein_id="YP_875175.1"
FT   gene            complement(205985..206575)
FT                   /db_xref="GeneID:6370409"
FT                   /locus_tag="CENSYa_0229"
FT   CDS_pept        complement(205985..206575)
FT                   /locus_tag="CENSYa_0229"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575433"
FT                   /db_xref="GeneID:6370409"
FT                   /translation="MTFRICGLPTGPVEYITAFYNPAGMPPPNPRMKRPYPRQFITNIE
FT                   YRGTMSNEDMEPGDLFYPDHLVKSSQPYKGLEIVKGCLYTKGDNGLLKWPDLKFTRGLY
FT                   QAAESASLDLTRKTVGCFGPGSRVGIRSRDGVIVGDLVRWDSRHSRVDRPSDLDPFTSM
FT                   VGRVMEICAKDDSGSPRTITENGDIVVIELGRT"
FT                   /protein_id="YP_875176.1"
FT   gene            206615..207463
FT                   /db_xref="GeneID:6370410"
FT                   /locus_tag="CENSYa_0230"
FT   CDS_pept        206615..207463
FT                   /locus_tag="CENSYa_0230"
FT                   /gene_family="HOG000105605" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /EC_number="1.1.1.31"
FT                   /note="COG2084"
FT                   /db_xref="GI:118575434"
FT                   /db_xref="GeneID:6370410"
FT                   /translation="MLGTGIGLRLLKTGINVIAYNRTADKTKALEDAGARIAKSPGEAA
FT                   GLSDTVITCVTDADALEQVSFGENGIAQGAHKDLVLCDMSTINPEGAVSISKKLADAGI
FT                   RMVDAPVMGGPGAAMRGELVIMASGDKGAYEERRGILGAVSRKMFYLGGSGTAYSIKLA
FT                   MNLQIAMLAISLSEGITLARGASVDPHKFLEVLNSTYFNTGMSNNKAYKMIEGSFEPSF
FT                   LLRNLKKDLHTINDHAESSRLKLPLSTLAEEVYSEAVKGGFGDLDYTGILAYLKESTRL
FT                   K"
FT                   /transl_table="11"
FT                   /protein_id="YP_875177.1"
FT   gene            207460..208083
FT                   /db_xref="GeneID:6370411"
FT                   /locus_tag="CENSYa_0231"
FT   CDS_pept        207460..208083
FT                   /locus_tag="CENSYa_0231"
FT                   /gene_family="HOG000291639" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG2096"
FT                   /db_xref="GI:118575435"
FT                   /db_xref="GeneID:6370411"
FT                   /translation="MNTASAVSASVSEIQYCELNIYGKILCDAVKIYTKTGDDGTTGLQ
FT                   GGRRVPKSDPRISAYGGVDEINSLLGVVLSHGLEGDIESIMARIQNELFVTGADLSNPN
FT                   LEDGKNRVTEQMVKRLEDDIDMLEEKLEPLTSFILPGGDVAAAFIHLARTAARRAETLV
FT                   VILEEKEKINPWCRIYLNRLADILFVMARIRNSQQDCPDVPWVP"
FT                   /protein_id="YP_875178.1"
FT   gene            208125..208201
FT                   /db_xref="GeneID:6370412"
FT                   /locus_tag="CENSYa_0232"
FT   tRNA            208125..208201
FT                   /db_xref="GeneID:6370412"
FT                   /locus_tag="CENSYa_0232"
FT                   /product="tRNA-Phe"
FT   gene            208297..208422
FT                   /db_xref="GeneID:6370413"
FT                   /locus_tag="CENSYa_0233"
FT   CDS_pept        208297..208422
FT                   /locus_tag="CENSYa_0233"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575436"
FT                   /db_xref="GeneID:6370413"
FT                   /translation="MSEKSSCPYCDSIFEDKDELSKHIDRIHHGSGLLEGDGRKF"
FT                   /protein_id="YP_875179.1"
FT   gene            208426..209232
FT                   /db_xref="GeneID:6370414"
FT                   /locus_tag="CENSYa_0234"
FT   CDS_pept        208426..209232
FT                   /locus_tag="CENSYa_0234"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HD superfamily hydrolase"
FT                   /transl_table="11"
FT                   /note="COG1896"
FT                   /db_xref="GI:118575437"
FT                   /db_xref="GeneID:6370414"
FT                   /translation="MIEDFFKAAALLKTVPRQGWIEKTGIANPESVADHSYSASVISMV
FT                   FGDMLGLDADKMVRMSLLHDLAETVTSDITPEKMEGHDKQELENKVMLGILSTLPAALQ
FT                   ERYLGIWDEFSAGKSPESRLFHEIDKLEMAIQATAYSGQYPGRSFAPFVQSADSVIQTP
FT                   ELRKIFLSITGGMQTAVADKVLAKSGGAPEDGPVDKDVVIEVQRQVIGVLFEVIKRFQE
FT                   NNGLDDEYFKIISSGRAGTEQKRLDEITKKRKDNALVVDKLLSQLE"
FT                   /protein_id="YP_875180.1"
FT   gene            209286..209642
FT                   /db_xref="GeneID:6370415"
FT                   /locus_tag="CENSYa_0235"
FT   CDS_pept        209286..209642
FT                   /locus_tag="CENSYa_0235"
FT                   /gene_family="HOG000105616" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575438"
FT                   /db_xref="GeneID:6370415"
FT                   /translation="MQYFAALTQGKKRVEAARVYLNDIPEAGGRAMPALALKPASKDNV
FT                   WTPVGTEMLYAFVDESSGFVLTDKSGHILAIVDNDGLSKTVIQGVTPPQKEALIKSFQA
FT                   DNIPEYKGMVTLPV"
FT                   /protein_id="YP_875181.1"
FT   gene            209687..210319
FT                   /db_xref="GeneID:6370416"
FT                   /locus_tag="CENSYa_0236"
FT   CDS_pept        209687..210319
FT                   /locus_tag="CENSYa_0236"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG1915"
FT                   /db_xref="GI:118575439"
FT                   /db_xref="GeneID:6370416"
FT                   /translation="MGSFSREIEVRGHLIDSSILTRIFDGVMDLKGDFEVLEITIGKRK
FT                   GDPSYARLMVQGGTQVHLDRILDIAYRAGATSKVERDAHLARAPKNMAMPDNFYSTTNN
FT                   RTQIFLGNRWTDVQDMMMDKCIVVKGKRAACVPIREVKRGDLVVVGESGVKVTPPERPR
FT                   EGVNVFEFMGSSSSSERPTQHIARRVAEDMYRTKAKGGRIVLVAAPP"
FT                   /protein_id="YP_875182.1"
FT   gene            210319..210912
FT                   /db_xref="GeneID:6370417"
FT                   /locus_tag="CENSYa_0237"
FT   CDS_pept        210319..210912
FT                   /locus_tag="CENSYa_0237"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG1915"
FT                   /db_xref="GI:118575440"
FT                   /db_xref="GeneID:6370417"
FT                   /translation="MHTGAADSVAELVKKGYIRGVLAGNALAVHDIEYATLGTSLGMNV
FT                   HDGTLAVRGHRNHMEAINSVFRAGSIPRMVSSGALKRGIMYQCIKKKIPLVLAGSIRDD
FT                   GPLPDVITDVTEAQKEYKKVLKDAQMVMMVSTMLHSIATGNMLPADVKVIVVDISQPTV
FT                   TKLMDRGTWQALGIVSDVGAFLPMVAAEIKKLEG"
FT                   /protein_id="YP_875183.1"
FT   gene            complement(210958..212352)
FT                   /db_xref="GeneID:6370418"
FT                   /locus_tag="CENSYa_0238"
FT   CDS_pept        complement(210958..212352)
FT                   /locus_tag="CENSYa_0238"
FT                   /gene_family="HOG000223742" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Asp-tRNAAsn/Glu-tRNAGln amidotransferase B
FT                   subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="COG0064"
FT                   /db_xref="GI:118575441"
FT                   /db_xref="GeneID:6370418"
FT                   /translation="MIGLEIHCQLTSLNSKLFCPCRADYRGLEPNTNICPVCTGLPGAL
FT                   PLPNKRAIEKAATVALALGCRVPPRLAFFRKNYFYPDLPKNFQITQLDAYGETCAGSGG
FT                   SIDSGGRTIRIRRVQLEEDPGRIIYEGAPGKAQHTLVDYNRAGVPLVEIVTEPDFEGPA
FT                   QVRLFLNELSGLLGGLGVADPSLEGALRADGNVSVHGGAKVEVKNVNSFHDLEKALHYE
FT                   ITRQQSLVDRGIEVVQETRQWDDRRRITVSARKKEEETDYRYFVEGDIPWITIDDDTLA
FT                   SLRAGIPEGAASRKDRYASLGIPAQVAEVLSSDPFFSRMFEEAHSAANAKEVANLITTD
FT                   LMGLLDTREKRGSSKLEAAHLGQLADAVLDGSMTRSSAKVALHEMISGKSLSEVSGGRD
FT                   TGSISDGDELGRIIDGVISAEPGAVQDAKANPQAINYLLGMVMKETQGRADPAAALEIL
FT                   QKKISS"
FT                   /transl_table="11"
FT                   /protein_id="YP_875184.1"
FT   gene            complement(212349..213788)
FT                   /db_xref="GeneID:6370419"
FT                   /locus_tag="CENSYa_0239"
FT   CDS_pept        complement(212349..213788)
FT                   /locus_tag="CENSYa_0239"
FT                   /gene_family="HOG000116699" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Asp-tRNAAsn/Glu-tRNAGln amidotransferase A
FT                   subunit"
FT                   /EC_number="6.3.5.-"
FT                   /note="COG0154"
FT                   /db_xref="GI:118575442"
FT                   /db_xref="GeneID:6370419"
FT                   /translation="MLPESLVEYVREVGSGGTTCEEFTAGAIERTKKQGLDAYITLNEK
FT                   ALDEARRIDSRIKKGEKVGRCLGAPIAVKDNICVRGMRTTCASKMLEGYESPYDATVVT
FT                   RLLAEDAIITGKTNMDEFAMGLTTEFSAYGPSRNPWNKECTPGGSSGGSAAAVGGLECI
FT                   ASLGSDTGGSVRNPASFCGMVGFKPTYGLVSRYGLVSYANSIEQIGPITRTVEDAAFMM
FT                   DVISGADPNDATTIECKGGFLDGIDAGIKGKKVGLITEMAGEGIDPRVAEATRDAMAAL
FT                   EDAGARCGKVSLDMVKYSVAAYYTITATEAASNLARYDNTMYGYDMPIESYEFHSYISK
FT                   ARRKFGPEVTRRMILGGFVSSSGHGGRYYHRALKVRGLLAREAEEALAEYDLLLSPTVP
FT                   ILPFKLGEKMGDPVGLFLVDYNTVTANLTGKPAASVPYTVCDGLPVGMQLMGRPSGDAE
FT                   VLQAAYSLQERSRMPEAPPWQ"
FT                   /transl_table="11"
FT                   /protein_id="YP_875185.1"
FT   gene            complement(213788..214054)
FT                   /db_xref="GeneID:6370420"
FT                   /locus_tag="CENSYa_0240"
FT   CDS_pept        complement(213788..214054)
FT                   /locus_tag="CENSYa_0240"
FT                   /gene_family="HOG000017523" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575443"
FT                   /db_xref="GeneID:6370420"
FT                   /translation="MSAKVSIEEAERIARLMRIEVDDHEVHMDEAQKMIVYMEILDEAA
FT                   GAEEYSPRVVPHSELREDKAVPFEGALGCLRIRDGYVRSPRLS"
FT                   /protein_id="YP_875186.1"
FT   gene            complement(214051..215619)
FT                   /db_xref="GeneID:6370421"
FT                   /locus_tag="CENSYa_0241"
FT   CDS_pept        complement(214051..215619)
FT                   /locus_tag="CENSYa_0241"
FT                   /gene_family="HOG000226032" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="aspartyl/asparaginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /note="COG0017"
FT                   /db_xref="GI:118575444"
FT                   /db_xref="GeneID:6370421"
FT                   /translation="MTSPLIPSGTALSTKSISETPSGRELLSLYREYTAMPFETRAIAF
FT                   SLDERDMQDNDPRRYLLGTGVSRRHGGGPFPHEKVNYAPVCRACMEDSLGGLRRTHYSS
FT                   GLGPSMDGKDVTVMGWVMAVRGHGAISFMTIRDRDGRIQVVAKSGSCPDETRERISGLK
FT                   PHSVVAVTGTVRASEKAPSGFELVPNELKVFADVQKIPPFEPQAKTVKNIETRLEIRPI
FT                   DLRRDALLELFHARSAVLRETREYFYENGFVEASTPKMISTATEGGAALFPIFYYNKEA
FT                   FLAQSPQLYKEQLTMSLERVFEIGPIFRAEPSRTNRHLAEAISIDLEEAFVDYNDIMDR
FT                   ISDIVKRAASAATPYAGGPGAQFAVPDVPAEIPRYTYADLLDRIKGAGAKAEWGDDLYP
FT                   SALKKAGLEGFYFITDWPAGPKPFYVKVGPDGRTSESFDLMFGDLEISSGSTRIDNRAE
FT                   LEERMAAKGMNAGSFGHHLAAFDYGVPPHAGCGIGLERLMMALTGTENIRDVTFYPRDV
FT                   DRLTP"
FT                   /transl_table="11"
FT                   /protein_id="YP_875187.1"
FT   gene            215698..216723
FT                   /db_xref="GeneID:6370422"
FT                   /locus_tag="CENSYa_0242"
FT   CDS_pept        215698..216723
FT                   /locus_tag="CENSYa_0242"
FT                   /gene_family="HOG000228474" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATP-utilizing enzyme of ATP-grasp superfamily"
FT                   /transl_table="11"
FT                   /note="COG1759"
FT                   /db_xref="GI:118575445"
FT                   /db_xref="GeneID:6370422"
FT                   /translation="MKSVSTLGSHCSLQLLKGAKDEGFRTLLVCERRRERFYRRFGFID
FT                   ELVLVDGFGELLGDECQSVLAENDSILIPHGTLVAQMSPDQIESIGVPVFGNKWILRWE
FT                   SDRSLKERLMREARLRMPRSIDSPGDIDTLVIVKRQGAAGGKGYFMANSEEEYESKRLS
FT                   LIESGVISTDEDLYIQEYVPGVLAYLQFFYSPLKADIEFFGADQRHESDIEGLARIPAP
FT                   VQMGSSGIPSFNVIGNSPLVLRESLLEGAYRMGEDFVEASSRLVAPGMNGPFCIEGVYG
FT                   DDGRFTSFEFSARIVAGTNIYMNGSPYYGLLFDEPISMGRRIAREIKSAIAEERLDETV
FT                   T"
FT                   /protein_id="YP_875188.1"
FT   gene            216769..217278
FT                   /db_xref="GeneID:6370423"
FT                   /locus_tag="CENSYa_0243"
FT   CDS_pept        216769..217278
FT                   /locus_tag="CENSYa_0243"
FT                   /gene_family="HOG000105627" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575446"
FT                   /db_xref="GeneID:6370423"
FT                   /translation="MEVRILSDGGVQVLKYRPHQSKRPKRGRYASRYTVAEQKLAAMQD
FT                   YERCINMWAGLATTDRNSTHVLYYDWEQAVYVVISIKKPMLTPAKWIAVACFNMFGYRS
FT                   GRSCEHITTLGDLIDEIEDANITGGSHNSYPDDIARLAARHLLYAEPSIMEPESGRTTA
FT                   ALVELT"
FT                   /protein_id="YP_875189.1"
FT   gene            complement(217358..217678)
FT                   /db_xref="GeneID:6370424"
FT                   /locus_tag="CENSYa_0244"
FT   CDS_pept        complement(217358..217678)
FT                   /locus_tag="CENSYa_0244"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575447"
FT                   /db_xref="GeneID:6370424"
FT                   /translation="MQHNQSQPDEAYKLKVLFNLDHSARCVFIYIFLCPKLYCECGYVE
FT                   SKSHLGHIVLTCKNSVSVMEEPRELDLYPVLSFIRMIEDSLIELSGKAYEHMLPNCPRC
FT                   PA"
FT                   /protein_id="YP_875190.1"
FT   gene            217727..218170
FT                   /db_xref="GeneID:6370425"
FT                   /locus_tag="CENSYa_0245"
FT   CDS_pept        217727..218170
FT                   /locus_tag="CENSYa_0245"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575448"
FT                   /db_xref="GeneID:6370425"
FT                   /translation="MGIVIGTDSGIARMIKHLNYVLGSDEWTKTTTDRRLLVRNMIFDE
FT                   KNIIAFCINLSMNKIIRDVNSSMRGRHKRISSDATLRAYRRLLWKTIRENILEFVNMHN
FT                   HSFDDVAFQCDSDCVKFLKDNGLHRAGAGDAYLAFRSRGVGKQ"
FT                   /protein_id="YP_875191.1"
FT   gene            218413..218742
FT                   /db_xref="GeneID:6370426"
FT                   /locus_tag="CENSYa_0246"
FT   CDS_pept        218413..218742
FT                   /locus_tag="CENSYa_0246"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575449"
FT                   /db_xref="GeneID:6370426"
FT                   /translation="MCLKDDADLPRNTGSPDVAPGDLIVVNKDSNILGGFNNSYPGDIA
FT                   RLAARYLLDVERSVMGLESGWPVPLAGLSLCICEFEKVVAPTQCPRSPARLILRVRARL
FT                   YTHGV"
FT                   /protein_id="YP_875192.1"
FT   gene            218903..219304
FT                   /db_xref="GeneID:6370427"
FT                   /locus_tag="CENSYa_0247"
FT   CDS_pept        218903..219304
FT                   /locus_tag="CENSYa_0247"
FT                   /gene_family="HOG000105627" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575450"
FT                   /db_xref="GeneID:6370427"
FT                   /translation="MEVHIFYGGGAQVLKYRPRQSKRPKRGRYASRYTVAEQKMAAERD
FT                   YERCINMWAGLAATDRNSTHILHYDWEQAGYAVISIKKPVITPAKWIDVACFDMFEYGP
FT                   GRSGEEITPLGDLIDEIEDSNITGGGGAQ"
FT                   /protein_id="YP_875193.1"
FT   gene            219643..220482
FT                   /db_xref="GeneID:6370428"
FT                   /locus_tag="CENSYa_0248"
FT   CDS_pept        219643..220482
FT                   /locus_tag="CENSYa_0248"
FT                   /gene_family="HOG000174613" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="L-asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /note="COG1446"
FT                   /db_xref="GI:118575451"
FT                   /db_xref="GeneID:6370428"
FT                   /translation="MDRCAVIVHGGAANQGPGDWFKKGYIRDVAKSAWEKIGKGAAAIE
FT                   VAEQAVIDLEDSRLFNAGMGSYATKENTLEMDAGIMDGRTLACGGVGAISDVKNPVAVA
FT                   SKVMSLSDHSVIVGPGALSFALSHGMEKYTMELRENMDHEKLGTVGAAILDTHGDMAAA
FT                   VSTGGTGTMPSGRVGASAIAGSGYYAKNGAGAAATTGNGDTLLMSGTARRCCELMEKKS
FT                   AAQAASDLSVKELGALPGGMGGIISVDANGEIGFSFNTTSMTYACINDRMDEIWVSL"
FT                   /transl_table="11"
FT                   /protein_id="YP_875194.1"
FT   gene            220479..220763
FT                   /db_xref="GeneID:6370429"
FT                   /locus_tag="CENSYa_0249"
FT   CDS_pept        220479..220763
FT                   /locus_tag="CENSYa_0249"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575452"
FT                   /db_xref="GeneID:6370429"
FT                   /translation="MMPRYMKGRLAHLWYARAWKMACNRPGPQTRNQCPGDALGTSTSG
FT                   ARRLPAVMLCRPGHSSAWSLGVTPGILQTGHLRLPAMPESAPDQSVYMV"
FT                   /protein_id="YP_875195.1"
FT   gene            220780..221976
FT                   /db_xref="GeneID:6370430"
FT                   /locus_tag="CENSYa_0250"
FT   CDS_pept        220780..221976
FT                   /locus_tag="CENSYa_0250"
FT                   /gene_family="HOG000227426" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RecA/RadA recombinase"
FT                   /transl_table="11"
FT                   /note="COG0468"
FT                   /db_xref="GI:118575453"
FT                   /db_xref="GeneID:6370430"
FT                   /translation="MNIENFDLSDLEGVGPVTKKKLEDSGVHSMMDLVVRGPVELGEIS
FT                   SMSSEICEKIVTIARKRLAETGAITKDFASGSEIYKRRQSIGMITTGTDALDALLGGGI
FT                   ETQAITEVFGEFGSGKTQFCHTMCVTTQKPKEEGGLGGGVMYIDTEGTFRPERVVTIAK
FT                   ANNMDPAKLLDGIIVARAYNSSHQVLILEEAGKTIQEENIKLIISDSTTGLFRSEYLGR
FT                   GTLASRQQKLGRYIRLLARIAETYNCAVLATNQVSSSPDSFFGDPTRPVGGNVVGHAST
FT                   YRIYFRKGGKNKRVAKIIDSPHHPASEAVFELGERGVQDTEEHLKQLDKEAKKAEKEAA
FT                   KPVKKSKAKAKADGPEGVDATPAIEPEGIDTAAAEPEDIGTIVSESADAGEPADPELE"
FT                   /protein_id="YP_875196.1"
FT   gene            complement(222040..223887)
FT                   /db_xref="GeneID:6370431"
FT                   /locus_tag="CENSYa_0251"
FT   CDS_pept        complement(222040..223887)
FT                   /locus_tag="CENSYa_0251"
FT                   /gene_family="HOG000073571" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="threonyl-tRNA synthetase"
FT                   /EC_number="6.1.1.3"
FT                   /note="COG0441"
FT                   /db_xref="GI:118575454"
FT                   /db_xref="GeneID:6370431"
FT                   /translation="MRILQLHCDRIEYSPVKKEIAAAEEPATGGKLEDAVLAFVAVEKG
FT                   DGPGEAARAAAELRQALGRIGCKKLLIYPYAHLSSTLAAPSIALGLISEMEAALHDLEV
FT                   SRAPFGWTKSYTISVKGHPLAEGFKVITGDARGTGAPKALESESSMKSTWHVLTPDGNM
FT                   TDASEFDFAGCPKLKALARYEASKKRGTDEPPPHVALMKRMGIADYEPASDAGNMKFFP
FT                   NGRLIKSLIERYVTERVVEYGGYEVETPIMYDSNHPSMVSYFNRFPARQYSIDSEGKSL
FT                   FLRFAACFGQFLMAGDYQLSYKNLPFRLYELTRYSFRREQSGELVGLRRLRAFTMPDCH
FT                   AFCTDMAQAVREAGVRFELSRDVIGQLGLDAADYEMAIRLTEEFYAENGGAVREMVRRH
FT                   GRPVLVEMWKERFFYFVLKWEFNYIDGAGKASALSTDQIDVENGKRYGIEFVDENNGRQ
FT                   HPVILHNSPSGAIERVIYTLLEKAAADSARGTKPELPLWLSPVQARIIPVGEELVRNAT
FT                   ELAKEMAGHGIRADVDDRNESMGKRIREAEKEWVRYILVVGEKEAASGRLSVRDRRTGK
FT                   STEMGLDDLVEAVREQTAGKPSAGLNSPFYLSKRPQVML"
FT                   /transl_table="11"
FT                   /protein_id="YP_875197.1"
FT   gene            complement(223920..224339)
FT                   /db_xref="GeneID:6370432"
FT                   /locus_tag="CENSYa_0252"
FT   CDS_pept        complement(223920..224339)
FT                   /locus_tag="CENSYa_0252"
FT                   /gene_family="HOG000105638" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575455"
FT                   /db_xref="GeneID:6370432"
FT                   /translation="MVVVIHVVAGRGGNLNDGRRQPLPVKIIDLYDPARVAREPDDMID
FT                   VLSGSFEEGGHTVHKVQLRLYTEGDGGELGPYSLITSYVEADAGSVEMIYDEGYRGADA
FT                   LGRAAKFLAESMGVSGVVLRSMMALEGGASPADHS"
FT                   /protein_id="YP_875198.1"
FT   gene            224381..225442
FT                   /db_xref="GeneID:6370433"
FT                   /locus_tag="CENSYa_0253"
FT   CDS_pept        224381..225442
FT                   /locus_tag="CENSYa_0253"
FT                   /gene_family="HOG000228839" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="deoxyhypusine synthase"
FT                   /EC_number="2.5.1.46"
FT                   /note="COG1899"
FT                   /db_xref="GI:118575456"
FT                   /db_xref="GeneID:6370433"
FT                   /translation="MGIEELVEAYSKTGFNGRQLGEAAKLFGKMISEDATICLTISGAL
FT                   TPVGFGGIFKELIERGLVDWIITTGANVYHEDHFAWGLPVRQGHHEVDDMQLYDKGIVR
FT                   IRDVFIKFYETLEVEDQIMQRMFRDRLLDSSFTSAEFCNVIGEISSAKAPHPERSFVAA
FT                   AHKYDVPVYVSTLKDSSLALNLAVHRLRGKEHSLDFVREILEQAAIVHGSKKSGIVELG
FT                   GGVPKNAAQQTGPLLDQILRRDHGGQDYIIQVTDARPDTGGLSGATLQEGKSWGKVQDA
FT                   HEGMVTVYSDATIAFPIMALYAMSVGGRRRHKRLYKNLGRLYSDLKDAYFSEPDKYYGL
FT                   LGDDYNMGSWPKT"
FT                   /transl_table="11"
FT                   /protein_id="YP_875199.1"
FT   gene            complement(225439..225651)
FT                   /db_xref="GeneID:6370434"
FT                   /locus_tag="CENSYa_0254"
FT   CDS_pept        complement(225439..225651)
FT                   /locus_tag="CENSYa_0254"
FT                   /gene_family="HOG000105649" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575457"
FT                   /db_xref="GeneID:6370434"
FT                   /translation="MGIVSKGAKCGVAGCGKDGARSLNSKKVEGAGLDVATSAKKAVLC
FT                   KEHYKEWKKETKDDRALERARYDRF"
FT                   /protein_id="YP_875200.1"
FT   gene            225650..226111
FT                   /db_xref="GeneID:6370435"
FT                   /locus_tag="CENSYa_0255"
FT   CDS_pept        225650..226111
FT                   /locus_tag="CENSYa_0255"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575458"
FT                   /db_xref="GeneID:6370435"
FT                   /translation="MQVNRALFYLCMRAGTAGKVPVSTAALYSPVYPGLNPASFVYKGT
FT                   EPTHPMGGSKNKSPAQREKAQGRSPDPKKGKKGDKGDGSVPKAAIRVTLTDEQASKILK
FT                   ESKVITIQHLGTSAGVKASASKAYLRDAERRGLVKAVGGRRGHILYQLA"
FT                   /protein_id="YP_875201.1"
FT   gene            226151..226462
FT                   /db_xref="GeneID:6370436"
FT                   /locus_tag="CENSYa_0256"
FT   CDS_pept        226151..226462
FT                   /locus_tag="CENSYa_0256"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575459"
FT                   /db_xref="GeneID:6370436"
FT                   /translation="MDGSSSILPIGVITFPGTASSAKKHMQPPAGKNAISPALNSLRAL
FT                   SMPDFTGVSMYVMAPSNLWALPSRGRARSTSPAVLGERCLLSSHRIFPACGLEDQLGL"
FT                   /protein_id="YP_875202.1"
FT   gene            226468..227448
FT                   /db_xref="GeneID:6370437"
FT                   /locus_tag="CENSYa_0257"
FT   CDS_pept        226468..227448
FT                   /locus_tag="CENSYa_0257"
FT                   /gene_family="HOG000105660" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sugar kinase"
FT                   /transl_table="11"
FT                   /note="COG0063"
FT                   /db_xref="GI:118575460"
FT                   /db_xref="GeneID:6370437"
FT                   /translation="MRRPIRTGRYAGYISLRGGWPLLSYTMRRNLWTSLLRRFMAARMI
FT                   GEDDVRKFVPSRRRDSRKGENGKVLVVGGSYIYHGAPIFSSVAALRSGCDLVYTAVPKI
FT                   NAPATRAASPSMIVIPLADQKLTRGAARKLAGQIPTGLDSATIGMGLAIAERSALKVLV
FT                   VALVDMDVRISLDAGALVREILGDISGKNCLVTPHAGEFKRLFGESPPADIEGRASMVE
FT                   RLAQEHGITILLKGPTDVISDGNRTLLNDRGAPAMTVGGTGDVLSGIAAGILARNRSPL
FT                   ESAAAAAYINGLAGEAAQEMHGLHITAMDLCELLPSVMKPFDRLE"
FT                   /protein_id="YP_875203.1"
FT   gene            227451..228560
FT                   /db_xref="GeneID:6370438"
FT                   /locus_tag="CENSYa_0258"
FT   CDS_pept        227451..228560
FT                   /locus_tag="CENSYa_0258"
FT                   /gene_family="HOG000216706" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acetylornithine
FT                   deacetylase/succinyl-diaminopimelate desuccinylase"
FT                   /transl_table="11"
FT                   /note="COG0624"
FT                   /db_xref="GI:118575461"
FT                   /db_xref="GeneID:6370438"
FT                   /translation="MKALREVDRGFPGTIDTLQELIRQPSVSAKNEGIEECALLVHRIL
FT                   KRSGITPEILRIKGAAPLVYGEVRSRANPGRTLLFYNHYDVQPAEPLDPWDHPPFGGTV
FT                   RGNKIFGRGATDDKGELVTRIKAVEACLRAEGDVPCNVKFVIEGEEETGSEHIGAYLKK
FT                   YRKKFACDGVIWEFGYVDSSDRPVISLGMKGLLYVELSVTGANQDAHSSLAVLIENPAW
FT                   RLVCALNTMRGPAGTVLIKDWYREVKPLGKRDVRLVSKEPFDEAAFRREFGIDRFVGGI
FT                   RGTAAKKALVSGATCNIAGFHSGYGGEGAKTVLPAKAVAKVDFRLVPGMDPKKQEARLR
FT                   RHLLSHGFGDISVKVFHGEAAARTDLGTS"
FT                   /protein_id="YP_875204.1"
FT   gene            228639..228797
FT                   /db_xref="GeneID:6370439"
FT                   /locus_tag="CENSYa_0259"
FT   CDS_pept        228639..228797
FT                   /locus_tag="CENSYa_0259"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575462"
FT                   /db_xref="GeneID:6370439"
FT                   /translation="MHQFSILNAPCVAIGSTHVFSRIHSANEYARTDLLKKTTKCICIL
FT                   LDRFAQD"
FT                   /protein_id="YP_875205.1"
FT   gene            complement(228794..229225)
FT                   /db_xref="GeneID:6370440"
FT                   /locus_tag="CENSYa_0260"
FT   CDS_pept        complement(228794..229225)
FT                   /locus_tag="CENSYa_0260"
FT                   /gene_family="HOG000198397" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG2259"
FT                   /db_xref="GI:118575463"
FT                   /db_xref="GeneID:6370440"
FT                   /translation="MPTAEFKENKLVDVTFMGMRSAIGVIFIVHGFGKFGSERFFGMVD
FT                   SMVGIPDIGPVLGTLVALGEFVGGILLIIGVLSRISAAVISAIMVGAIFVVKGAGSLTG
FT                   EGAYELDLILLASCLVIMLAGPGRIALAQIVKKLPRYIH"
FT                   /protein_id="YP_875206.1"
FT   gene            229403..229984
FT                   /db_xref="GeneID:6370441"
FT                   /locus_tag="CENSYa_0261"
FT   CDS_pept        229403..229984
FT                   /locus_tag="CENSYa_0261"
FT                   /gene_family="HOG000091083" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="20S proteasome, alpha and beta subunit"
FT                   /EC_number="3.4.25.1"
FT                   /note="COG0638"
FT                   /db_xref="GI:118575464"
FT                   /db_xref="GeneID:6370441"
FT                   /translation="MPGATAVGITYAGGVILASEKRIAYGNFLVSKNTRKTFQITPYVG
FT                   AACAGLVADMQILSLQISALAKIRKMDLKRDIPPNSVAKMMSNMMYERRFFPLLTQVIV
FT                   GGVVGEPAIYTLDSLGSVLPDEYAAVGTGAEMALGVLDPQFKSGMSEKDAVDLAVRGIR
FT                   SAALRDSFSGDGLDILALDANGAREIAQAA"
FT                   /transl_table="11"
FT                   /protein_id="YP_875207.1"
FT   gene            complement(229981..230454)
FT                   /db_xref="GeneID:6370442"
FT                   /locus_tag="CENSYa_0262"
FT   CDS_pept        complement(229981..230454)
FT                   /locus_tag="CENSYa_0262"
FT                   /gene_family="HOG000223987" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA-binding protein"
FT                   /transl_table="11"
FT                   /note="COG2016"
FT                   /db_xref="GI:118575465"
FT                   /db_xref="GeneID:6370442"
FT                   /translation="MKSNFVSKSESNAILGEIGAAWGIAIPKTRNLRVHEVAGAQLIVG
FT                   DGFKALKAGDDYLPFLSDTDTLEKFPSVTVDMGAVSFMCKGANVMRPGITGFAEFGLGD
FT                   IVCVVEESQHKFIAVGRSLATSSEGEAMKKGEIVKNLHYISDKYWNAAKETGA"
FT                   /protein_id="YP_875208.1"
FT   gene            complement(230451..231458)
FT                   /db_xref="GeneID:6370443"
FT                   /locus_tag="CENSYa_0263"
FT   CDS_pept        complement(230451..231458)
FT                   /locus_tag="CENSYa_0263"
FT                   /gene_family="HOG000076616" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /note="COG0460"
FT                   /db_xref="GI:118575466"
FT                   /db_xref="GeneID:6370443"
FT                   /translation="MRIIICGFGVVGQSLAKLIESRSEDLYARYGIKARIVGVADSGGS
FT                   ATDPSGLDPERLVAAKKAGSVRGYPGAGGGLTGGELIEGLDADVMIETTVSDYTNAEPG
FT                   TAHITGAMGRGMHVISVNKGPLALSFPSLTELAEYNRVMLRFSGTVGGGTPILDFAKKS
FT                   LRGERITSFAGILNGTTNYILTGMAGGSSYEEALADAKGRGYVERNEALDLDGLDAAAK
FT                   LVILANWVMGMKVTLGDVDRTGIRNVDTGDIREAAAAGSAVKLVATCDGGLRVAPERIP
FT                   VGDPLCVDGTLNAVAFTSEHSGTQTIIGRGAGGIETASSIIRDLLDIRAGMARE"
FT                   /transl_table="11"
FT                   /protein_id="YP_875209.1"
FT   gene            complement(231486..231938)
FT                   /db_xref="GeneID:6370444"
FT                   /locus_tag="CENSYa_0264"
FT   CDS_pept        complement(231486..231938)
FT                   /locus_tag="CENSYa_0264"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575467"
FT                   /db_xref="GeneID:6370444"
FT                   /translation="MELKPLIIIGVAVAAAVGIVYAVGVDTLSERVENSLLASLLSGYG
FT                   STNWDEVHERYIVKSFIPVNLMERNGGTCTVSAERFQPIIEHSYFAQGERLAADLRFDN
FT                   DTETIMLPCDQLHGDKSALNVWYVTPDSPVHAERYQYFLTEWDNDS"
FT                   /protein_id="YP_875210.1"
FT   gene            complement(232064..232441)
FT                   /db_xref="GeneID:6370445"
FT                   /locus_tag="CENSYa_0265"
FT   CDS_pept        complement(232064..232441)
FT                   /locus_tag="CENSYa_0265"
FT                   /gene_family="HOG000243424" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /EC_number="1.8.4.11"
FT                   /note="COG0229"
FT                   /db_xref="GI:118575468"
FT                   /db_xref="GeneID:6370445"
FT                   /translation="MQRRGSRRNSTRCASTRERRRPFRGSIWPARTAGHTCASAAAKSS
FT                   LDRMQSSTPGPAGRALPRRLPGSGIEHIEDRSLGMMRTEVNCGGCGAHLGHVFDDGPKP
FT                   SGLRYCINSLSLDFEKDGRVS"
FT                   /transl_table="11"
FT                   /protein_id="YP_875211.1"
FT   gene            complement(232489..234069)
FT                   /db_xref="GeneID:6370446"
FT                   /locus_tag="CENSYa_0266"
FT   CDS_pept        complement(232489..234069)
FT                   /locus_tag="CENSYa_0266"
FT                   /gene_family="HOG000105671" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="COG1351"
FT                   /db_xref="GI:118575469"
FT                   /db_xref="GeneID:6370446"
FT                   /translation="MRGHFSNHDRPVFAITTPRQADRGALMSRYSRTGKSMRRVFLDEF
FT                   RGKKGRGEKFYERVLVEYGDDSVAELGEAQIAIEGLSNIAVKSIEDRRLGLSYLEKSSR
FT                   YVSWDAKEGGKYRFYRGPGIMESRHADTYVNACNLSFDTYSRLLKEMIPYIKERNPIGR
FT                   YSFQDSSDGSRKLFGRLKEKDDIKSAEAAYSRSTKAKALDVLRGLLPASALTNVGITGN
FT                   GRAFEYLLSVLRASKLHEERRLAELIRAELEGVLGAFVRRADGAHGVEMQEYLQRVRRA
FT                   SKWLASNRFVNSGGPKSKVKLVEWEPESRAMDRVVAALAYDQAPGSPLGAMISAAKKIP
FT                   MNEKGKIISGFAGLRRNRRHRPHRAFEMTYYTFDLLTNFGMFRDLHRHRVLTMERQLLT
FT                   TDHGYEVPREVPDIGREKEYTECLDGSKSAFEKMRGRMPEEAQYVVNFGYNYPYFMRLN
FT                   LREAAHLIELRTSPQGHEDYRRTAQDMLYMVRKKHPLLSSIIKYADMRGRGLERISSEK
FT                   RAEEKRKGL"
FT                   /transl_table="11"
FT                   /protein_id="YP_875212.1"
FT   gene            complement(234154..234441)
FT                   /db_xref="GeneID:6370447"
FT                   /locus_tag="CENSYa_0267"
FT   CDS_pept        complement(234154..234441)
FT                   /locus_tag="CENSYa_0267"
FT                   /gene_family="HOG000105682" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575470"
FT                   /db_xref="GeneID:6370447"
FT                   /translation="MLDRSGLDQILEVVSKRWMDLAKDPENKALQSLPNDFWMNAAGGR
FT                   AGMGKWVTVVMYTENEADAETFRSVLQKWQAKGNQERTEGAPDVLKMGKQ"
FT                   /protein_id="YP_875213.1"
FT   gene            234581..235402
FT                   /db_xref="GeneID:6370448"
FT                   /locus_tag="CENSYa_0268"
FT   CDS_pept        234581..235402
FT                   /locus_tag="CENSYa_0268"
FT                   /gene_family="HOG000105693" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575471"
FT                   /db_xref="GeneID:6370448"
FT                   /translation="MSNDDMRIIGKAVKDMYGTPVGKVVGAMTDIDGTVLSAGVDCGSR
FT                   GLVQVPFEQLVIQGDVVIFIPKWRLDSQRLLREKGLTLRRLRALMEIVSENDEMKDDAS
FT                   MVNEKYRSQLATFDEPEKEINSRLQERLSELDEQMKSVKMLVFDARIQFKSGEIPESVF
FT                   ESVRAQTAGMIERITHENAEISNVQRRIADLGIDVREALDASPAHLQDSALSYLGDQPE
FT                   AESKLPEAPQAEPQPAISAEAFPEPPQSGTAEVEHAAQPERADWLTRMETQ"
FT                   /protein_id="YP_875214.1"
FT   gene            complement(235440..236177)
FT                   /db_xref="GeneID:6370449"
FT                   /locus_tag="CENSYa_0269"
FT   CDS_pept        complement(235440..236177)
FT                   /locus_tag="CENSYa_0269"
FT                   /gene_family="HOG000105705" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575472"
FT                   /db_xref="GeneID:6370449"
FT                   /translation="MYEAVPSDAAVLGAEPGHLEMLHRFARSSPLYESSFEEVISGERC
FT                   TVYEGDINNHWLDSTKHDTSYAPFYPTWIISAYLLAKTALRMGCSGMVDVGSGDGRIAY
FT                   CAAVLGMNSTGIEIDPGLVSLQEKMADSTGARFDPVIADATRYDYSAVRYESTCFAIGG
FT                   LPEVGEMLAGGVMDGVSRVPRLEGSVFVLAGGRARGARHRELSGWGPLIEKHGLHVKET
FT                   VILPTMWTVDQTEGTPYLFASAG"
FT                   /protein_id="YP_875215.1"
FT   gene            complement(236246..237268)
FT                   /db_xref="GeneID:6370450"
FT                   /locus_tag="CENSYa_0270"
FT   CDS_pept        complement(236246..237268)
FT                   /locus_tag="CENSYa_0270"
FT                   /gene_family="HOG000193852" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="5'-3' exonuclease"
FT                   /EC_number="3.-.-.-"
FT                   /note="COG0258"
FT                   /db_xref="GI:118575473"
FT                   /db_xref="GeneID:6370450"
FT                   /translation="MGLDLKALVSREPTRLESFATKVVAIDAYNAIYQFLATIRGPDGM
FT                   QLTDARGRVTSHLSGLLYRNASFLSMGIKPVYVFDGRPPTLKSAEIERRRNVKKGAAVK
FT                   YAAAVDAGNMDDARKYAQQTTSMRDGMVDDSKQILKLFGIPYIDAPSEGEATAAYLTQT
FT                   GDAYASASQDFDSVLFGAKRLVRNFTNSGRRKIPNRNMYVDVQPEIIETEKTLTTLDLT
FT                   REQLVDVGILIGTDFNPDGFERIGPKTALKLVHEHGRLEDIPRIQDELGSVSYAEIRKI
FT                   FLEPESPGNIEIEFGATDYDGITKYLVGERSFSEDRVAAALNRLRRALEKRSQNLDQWF
FT                   "
FT                   /transl_table="11"
FT                   /protein_id="YP_875216.1"
FT   gene            237350..237431
FT                   /db_xref="GeneID:6370451"
FT                   /locus_tag="CENSYa_0271"
FT   tRNA            237350..237431
FT                   /db_xref="GeneID:6370451"
FT                   /locus_tag="CENSYa_0271"
FT                   /product="tRNA-Ser"
FT   gene            complement(237457..237534)
FT                   /db_xref="GeneID:6370452"
FT                   /locus_tag="CENSYa_0272"
FT   tRNA            complement(237457..237534)
FT                   /db_xref="GeneID:6370452"
FT                   /locus_tag="CENSYa_0272"
FT                   /product="tRNA-Arg"
FT   gene            complement(237590..237922)
FT                   /db_xref="GeneID:6370453"
FT                   /locus_tag="CENSYa_0273"
FT   CDS_pept        complement(237590..237922)
FT                   /locus_tag="CENSYa_0273"
FT                   /gene_family="HOG000105716" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575474"
FT                   /db_xref="GeneID:6370453"
FT                   /translation="MSDMRFILIGVGIVFVGYLLFALFSDQFIGPVVKAEQFEDCLAYF
FT                   EDRPPEPVPCEAALQGKVAFFVVISAVLGAGGVALIKGMRGDWDRRVKPEDMVGPGGSD
FT                   PDDSKE"
FT                   /protein_id="YP_875217.1"
FT   gene            complement(237929..238366)
FT                   /db_xref="GeneID:6370454"
FT                   /locus_tag="CENSYa_0274"
FT   CDS_pept        complement(237929..238366)
FT                   /locus_tag="CENSYa_0274"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575475"
FT                   /db_xref="GeneID:6370454"
FT                   /translation="MVSFRAASRDIKLTAAPIASDAAIVTVDCTMSLLLRYFTKLARLT
FT                   NDLILTVEQSEGKYSGMAQNPASRSCKNPETARHQVSRRGKTHLRDRRRDARSESQRDI
FT                   QRALGMPACACRRWPPETKCRLRSGPGPRAQPAKCKIQQAP"
FT                   /protein_id="YP_875218.1"
FT   gene            238182..239948
FT                   /db_xref="GeneID:6370455"
FT                   /locus_tag="CENSYa_0275"
FT   CDS_pept        238182..239948
FT                   /locus_tag="CENSYa_0275"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575476"
FT                   /db_xref="GeneID:6370455"
FT                   /translation="MPEYLPSDCSTVKIRSFVRRASLVKYLRSRDIVQSTVTIAASLAI
FT                   GAAVSLMSLDAALKLTIELAISASAAVLLFVQYVVRTRKWLLGGLEVDKAISRFNGENL
FT                   RKVMRGYVNEALARDIEIVNNLSRGNVELSRRQVERLMVEMFKTDARYMEIDYNLPSYY
FT                   YDVYHYYLDHHIELATRIKDKGFRITVRDDHELRRDSRKSSYSKFLKWHKDNGVKLKWA
FT                   PAEVAEKELQKTGVDPNDRTGSICIWEGEFALLFARSKPDPDARPEYDMIRITLIEGKR
FT                   LEELTEACNSIEKNAKGIEELDLQQNIPDLLAKEWEDYVRPKERWDRIGGFLCNSLEKC
FT                   RVNNWWIMDVAAGMGVEYQNLNDEKFHVVANEAQENFRKAGEVYAREEWPDVRYDPSHY
FT                   EWEEMHNYGKVGYGAVLAIGHSLRALPAGEEQEKALKTFHDMLVDGGSIIIDETNFARL
FT                   HEKVRDCLHRCNQNPDDKDMFKEMIKFVDKSPSPLYRGNTVKAIPSLIDADAGVARLVY
FT                   YKRTKGIDTFAEAVSERLHEREFHYSGSLHEMLENAGFKNIRKYADYDLSLERKPGDKD
FT                   SDASMFVYVADK"
FT                   /protein_id="YP_875219.1"
FT   gene            complement(239994..241007)
FT                   /db_xref="GeneID:6370456"
FT                   /locus_tag="CENSYa_0276"
FT   CDS_pept        complement(239994..241007)
FT                   /locus_tag="CENSYa_0276"
FT                   /gene_family="HOG000105727" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dehydrogenase"
FT                   /transl_table="11"
FT                   /note="COG0644"
FT                   /db_xref="GI:118575477"
FT                   /db_xref="GeneID:6370456"
FT                   /translation="MRIAVMGMGVAGSYLMARLEGSGHDVTGYERNPQERHDSICAWGT
FT                   IKPVLKGFCTKVGRDFDDFLIHDGKSMHVRMNNGVKFDIGLRGLCTYDKLALIKDFIKD
FT                   SKVEYGRAPELKELEEKYDMIVDCTGFARKYLPKLKEDFFLPTYEYKVEYEDGVPYDDF
FT                   YIEPFPGMTGYFWYFPLGEKWAHVGAGDYHKNHIKATDAFIKKHGGKVLATKGRPIRLA
FT                   TPDRCKPYYSGKVVGVGESIGTVYALLGEGIIPSMQCVEIFLENMDDFEAYEKAVERHY
FT                   AVYGKVFNFVRSKIHGKFSMIKSLPDFLSIFRYMKKHEERFGMDIRMGDLIKVAKA"
FT                   /protein_id="YP_875220.1"
FT   gene            complement(241100..241705)
FT                   /db_xref="GeneID:6370457"
FT                   /locus_tag="CENSYa_0277"
FT   CDS_pept        complement(241100..241705)
FT                   /locus_tag="CENSYa_0277"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575478"
FT                   /db_xref="GeneID:6370457"
FT                   /translation="MPRPCAQMPYSGTNSSHPELHGLFITPSHLPCSSWAIRWWPQSLH
FT                   FVLKSALSLSRGIPDLRTSSKTSSYSDMADNGPLADLNLPISRAGNLEMQWRRKRTMAG
FT                   RLLFLCSCTGIELSTAVGVCGYLLYLGEWFLALISAAVFAKLIVFHVIVNHYDKRGIKS
FT                   TRAAPDGRIMHLVRPRCACTVQETARNIRPPRQVAVPA"
FT                   /protein_id="YP_875221.1"
FT   gene            complement(241761..241916)
FT                   /db_xref="GeneID:6370458"
FT                   /locus_tag="CENSYa_0278"
FT   CDS_pept        complement(241761..241916)
FT                   /locus_tag="CENSYa_0278"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575479"
FT                   /db_xref="GeneID:6370458"
FT                   /translation="MDGHHRIIVEFENQADFVKCHDSEEHAKLHGTAVTYMESPPSPNM
FT                   YNVLAG"
FT                   /protein_id="YP_875222.1"
FT   gene            complement(242033..242293)
FT                   /db_xref="GeneID:6370459"
FT                   /locus_tag="CENSYa_0279"
FT   CDS_pept        complement(242033..242293)
FT                   /locus_tag="CENSYa_0279"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575480"
FT                   /db_xref="GeneID:6370459"
FT                   /translation="MQDRRPASLKAIHWSHQVGRPARIFSTRQFSKHRMRAWRPCRHQP
FT                   GLCLRPRNVRPRPPAGGTIGPESRPIRNLSEKRRTIARCLL"
FT                   /protein_id="YP_875223.1"
FT   gene            complement(242395..244872)
FT                   /db_xref="GeneID:6370460"
FT                   /locus_tag="CENSYa_0280"
FT   CDS_pept        complement(242395..244872)
FT                   /locus_tag="CENSYa_0280"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phage related minor tail protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575481"
FT                   /db_xref="GeneID:6370460"
FT                   /translation="MHRLHLAIVAVIPLLIITGAAYGAQAEGKPNGRYGTSTSDVICGD
FT                   RLCAEFGDRSVYDKFVKYGHLVCSAGEPRMESGSSEKTDALMLSERHVQEHLGVSSLMT
FT                   LGKFVGEIDVHNDEHRNDGDSIRHEHGEYLTEHLDGHMADDGHIVEHKMHVIGHMAIDH
FT                   GGDATGYVMEADRVNSKHIQEHLDASDDSLDEFVQVMDGHRDMHADGRIDQHLFDHILY
FT                   FMVHMEGHDAGDGHISEHKMHISEHIASGHSGKYDKGTYNKTSHYENHNGSKQYSEEYA
FT                   EEASMMSREHVQEHLDASDSAHEVYARMIGTHYDKHSQDRTVQHLKEHKEYLAEHMEEH
FT                   DAGDGHIIGHKVHATGHMIGHGDDTHMEKGMHEDGHMGKMNDRMEKGMHDKYGNMTDKM
FT                   GERMGHMKDKMGDKMGHMEKGMHDKYGNMTDKMGYMEKGMHDKYGNMTDKMGDRMGHME
FT                   KGMHDKYGNMTDKMGDRMGHMEKGMHDKYGNMTDKMGDRMGHMEKGMHDKYGNMTDKMG
FT                   DRMGHMEKGMHDKYGNMTDRMGHMEKGMCGKSGHDMSERMGHMEKGMCGKSGHDMSERM
FT                   GHMDGEGCSCGKMGHKMYDDGIHGNLEISEEEFVRRVAMVEEEHLKEHEEAQMIGMDEL
FT                   SLDNVVMHNELHSQLTFGGHLMEHAEFVVDHMESHDTSDGHGTEHHEYLVEHLVDHDSF
FT                   VSEIFDIGEWDYDIHDRSDKDYGMHSGMGDKGHGMHSGMGDKGHGMHDRSDKDYGMHSG
FT                   MGDKGHGMHDRSDKDYGMHSGMGDKGHGMHSGMGDKGHGMHDRSHKDYGMGDRSHMLNS
FT                   LNASDIQELQRFC"
FT                   /protein_id="YP_875224.1"
FT   gene            complement(245178..245420)
FT                   /db_xref="GeneID:6370461"
FT                   /locus_tag="CENSYa_0281"
FT   CDS_pept        complement(245178..245420)
FT                   /locus_tag="CENSYa_0281"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575482"
FT                   /db_xref="GeneID:6370461"
FT                   /translation="MVLAGFLNRWLARTIHIRPNAINRHAVTMYMSDVPTQPQSGSTVT
FT                   RPDAVLNPAANRTKNAAEMCAGFGMTGNVATLIYY"
FT                   /protein_id="YP_875225.1"
FT   gene            245421..245614
FT                   /db_xref="GeneID:6370462"
FT                   /locus_tag="CENSYa_0282"
FT   rRNA            245421..245614
FT                   /db_xref="GeneID:6370462"
FT                   /locus_tag="CENSYa_0282"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(245772..247238)
FT                   /db_xref="GeneID:6370463"
FT                   /locus_tag="CENSYa_0283"
FT   CDS_pept        complement(245772..247238)
FT                   /locus_tag="CENSYa_0283"
FT                   /gene_family="HOG000243132" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="leucyl aminopeptidase"
FT                   /EC_number="3.4.11.1"
FT                   /note="COG0260"
FT                   /db_xref="GI:118575483"
FT                   /db_xref="GeneID:6370463"
FT                   /translation="MKITADASDPAKRKTAALCGFVLEGAAGAAGLGGPGLDDLIKEAI
FT                   GKNGGKKGRISMTGTPGMPSERVILAGLGPAGKVTSDGIRSEAGRLARQVRDMGLADFA
FT                   VAAPSILDPAEEAALIVEGAELALYSFDEFKAEKAGNSPRLHILGGGPSAARAIKDAQS
FT                   ITAGVAFARGLANMPPNECPPDKLGRAAVKMCTGKKMRCIVLKKPELKKGGFGGIIAVG
FT                   QGSSNEPRLIIVEYNGGKKGQKPIVLVGKAVTFDTGGISIKPGEKMDEMKFDKCGGCTV
FT                   LGIMKAVEDLALPVNVIGIVPSVENMPGGSSYRPGDIVKLYSGKTAEILNTDAEGRLIL
FT                   ADALSYGEKKYAPSEIIDFATLTGACIVALGNNVAGMVSNDDAFAKRIEGASERTAEEV
FT                   WRLPINDDYMSMIKSEVADMRNLGMGRAAGTITAAAFLKNAIGDTPWVHLDIAGTAWNQ
FT                   PATKKKPYNPGGATGFGVRLVAGYLKGRAQ"
FT                   /transl_table="11"
FT                   /protein_id="YP_875226.1"
FT   gene            247243..248373
FT                   /db_xref="GeneID:6370464"
FT                   /locus_tag="CENSYa_0284"
FT   CDS_pept        247243..248373
FT                   /locus_tag="CENSYa_0284"
FT                   /gene_family="HOG000227597" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pyruvate-formate lyase-activating enzyme"
FT                   /EC_number="1.97.1.4"
FT                   /note="COG1180"
FT                   /db_xref="GI:118575484"
FT                   /db_xref="GeneID:6370464"
FT                   /translation="MRQGPADFIDYPPPVYIGTRGIPPMRKEAVLYEKLPGDKVRCTAC
FT                   ARYCELADGQVGLCGVRGNEAGKLDLYVYGKVVAGHTDPVEKKPVTHYRPGTQVYSIAT
FT                   TGCNWLCRYCQNHDISQRRKAEGRDMSPRQVVAEALAQGADGIAYTYNQPSIFIEFARD
FT                   CGVEARRRGLFNVFVSNGYDTPETVSMMGEFLDCITVDFKGSAEPEFTKKYIGVPDPQP
FT                   IFDTLRGIRDETSIHVEITDLIIPGVGDSLEHAKKLCRFVLDELGPDVPVHFLRFHPDY
FT                   KMMEFPPTPVETLVAHHRMAKEEGLRYAYIGNVPGHPLEDTYCHGCGEVAVKRNSFDIS
FT                   SWNLDAQNRCRSCGCQVPITGSPPPGYKKRWFHLLE"
FT                   /transl_table="11"
FT                   /protein_id="YP_875227.1"
FT   gene            complement(248375..249004)
FT                   /db_xref="GeneID:6370465"
FT                   /locus_tag="CENSYa_0285"
FT   CDS_pept        complement(248375..249004)
FT                   /locus_tag="CENSYa_0285"
FT                   /gene_family="HOG000219455" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="metal-dependent hydrolase"
FT                   /transl_table="11"
FT                   /note="COG1878"
FT                   /db_xref="GI:118575485"
FT                   /db_xref="GeneID:6370465"
FT                   /translation="MGPVDLTMTVSDGMPAFPGSPEPRFIPWNAIGADGFAMELLFMSS
FT                   HTGTHMDAPSHFAKGGRSMEKIPPGRLVSKGVLVDACGPRVITRGRILEHEKRAGRIPR
FT                   GSAVVLKTGWSDDPGRKSYFGSCPGLAADAARHIASRGVNIVGIDSPSIDAGGRGYPAH
FT                   HILARADIPIVENLANLGKIRGEFTLAVLPLKLRGATGAPARALAL"
FT                   /protein_id="YP_875228.1"
FT   gene            249085..249345
FT                   /db_xref="GeneID:6370466"
FT                   /locus_tag="CENSYa_0286"
FT   CDS_pept        249085..249345
FT                   /locus_tag="CENSYa_0286"
FT                   /gene_family="HOG000225449" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="COG1522"
FT                   /db_xref="GI:118575486"
FT                   /db_xref="GeneID:6370466"
FT                   /translation="MPITFVLLNSDLGSDDSVIDSIREILEKEDAIEYEVLAVYGVYDV
FT                   ILKLTSADADKLRMVITNRIRRISKVQSTLTMMVIEEQGRS"
FT                   /protein_id="YP_875229.1"
FT   gene            complement(249340..250464)
FT                   /db_xref="GeneID:6370467"
FT                   /locus_tag="CENSYa_0287"
FT   CDS_pept        complement(249340..250464)
FT                   /locus_tag="CENSYa_0287"
FT                   /gene_family="HOG000017511" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cysteine desulfurase/selenocysteine lyase"
FT                   /EC_number="2.8.1.7"
FT                   /note="COG0520"
FT                   /db_xref="GI:118575487"
FT                   /db_xref="GeneID:6370467"
FT                   /translation="MGADQGGDFPRGKICMNNASVSPNPAGMVRAVARFLEEYSVMGPD
FT                   TEASDEFVTSMLGRTRDAVSRLIGCRPAEIVLTQSTTDGINAVSRGLSMPRGSSVIIRG
FT                   GAHEHHANYYPWLRTGAEVRSIPIDKHGSFDTSLLRGMIDGGTRVAALSHALYNTGAVM
FT                   PAEETGEILESAGVPYFVDAAQTVGCMKVDVSRLRCSFMSFNGSKWLCGPMGTGLFYCR
FT                   EDAADTLEPISTGGESADLGDSGLEYKKMPERFQTGFRNYAGMAGLEYSLGIISDVGVG
FT                   AIQERAARLSRRLRDGIGRIPGSMLYGPEEGRTSIVPFNLQGVDPADAVKRLEEQGIVL
FT                   ALREITDLKIIRASPHFFNTGEEVDRVLEALAGL"
FT                   /transl_table="11"
FT                   /protein_id="YP_875230.1"
FT   gene            250539..251102
FT                   /db_xref="GeneID:6370468"
FT                   /locus_tag="CENSYa_0288"
FT   CDS_pept        250539..251102
FT                   /locus_tag="CENSYa_0288"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575488"
FT                   /db_xref="GeneID:6370468"
FT                   /translation="MLPDGRVSSVICTDPYLKASFLDGLASCKSDVHYLDLDLLYSGMV
FT                   SAGILPRREITVYRPGTGGLYSSLDRMLGRASSAGSLIIIDTLNGLFNILEDRDAGRMI
FT                   DSYIMLLGLACRSSGSRAVMASMSLRRDGAWALSPTGRRVIGAGTISTIRLEREGRGAT
FT                   AYSAGGGSVISADLGIPESNPKAL"
FT                   /protein_id="YP_875231.1"
FT   gene            251173..251472
FT                   /db_xref="GeneID:6370469"
FT                   /locus_tag="CENSYa_0289"
FT   CDS_pept        251173..251472
FT                   /locus_tag="CENSYa_0289"
FT                   /gene_family="HOG000105738" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575489"
FT                   /db_xref="GeneID:6370469"
FT                   /translation="MPVAILPDIGEQMCIGCALCVEICTTLGPDVLRVKPVEGWKRGKA
FT                   FVFYPERCIADGACIGVCPTKAIFWMRPMDFTVGQPVPLYKNSVFVKGWTELVD"
FT                   /protein_id="YP_875232.1"
FT   gene            complement(251584..252135)
FT                   /db_xref="GeneID:6370470"
FT                   /locus_tag="CENSYa_0290"
FT   CDS_pept        complement(251584..252135)
FT                   /locus_tag="CENSYa_0290"
FT                   /gene_family="HOG000004976" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thiol-disulfide isomerase"
FT                   /transl_table="11"
FT                   /note="COG0526"
FT                   /db_xref="GI:118575490"
FT                   /db_xref="GeneID:6370470"
FT                   /translation="MVLMESAVSLKTGEQAPGFSLKGTDGAVHSLGDYSKYEGILVIFM
FT                   CNHCPYVKAKLDTIISLHREFGDKIAIVGINSNDSIKYPDDSLENMKKVAAEKGIEFDY
FT                   LVDETQEVAKSYGATCTPDPFLFDGEGKLIFHGRIDDAMKPEDKATDKTMAHNINDFLA
FT                   GREIRKDFDPSIGCSIKWKD"
FT                   /protein_id="YP_875233.1"
FT   gene            252238..252314
FT                   /db_xref="GeneID:6370471"
FT                   /locus_tag="CENSYa_0291"
FT   tRNA            252238..252314
FT                   /db_xref="GeneID:6370471"
FT                   /locus_tag="CENSYa_0291"
FT                   /product="tRNA-Ala"
FT   gene            252466..253737
FT                   /db_xref="GeneID:6370472"
FT                   /locus_tag="CENSYa_0292"
FT   CDS_pept        252466..253737
FT                   /locus_tag="CENSYa_0292"
FT                   /gene_family="HOG000268680" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphomannomutase"
FT                   /EC_number="5.4.2.8"
FT                   /note="COG1109"
FT                   /db_xref="GI:118575491"
FT                   /db_xref="GeneID:6370472"
FT                   /translation="MAMSISAHLGGGPVLVGHDGRHSGPAVAKAVCSALNYAGADCSLA
FT                   GLVPTPCLEYSTRKLGYRGGIMVTASHNPPEYNGMKVVASDGVEIPREDEEKIEGIYRD
FT                   KAFRPGEKYGVMRAEDGAIPAYLDGIKSQVDASAVRARGPSVVIDAGNGAQAVAAPQLC
FT                   RDLGCTVEVINSGIDGDFPGRGPEPTPANLGGLSEAVLRTGADLGVAFDGDGDRSLFCD
FT                   DKGEVLTGDRSALLLAGFVLGSSPGSAVVTCLNSGGAIEGVAAGHGSPVIRTKVGSVAV
FT                   SRRMVSEDALVGFEENGGFMYGRHGQVRDGAMSLALMLGLVSSSDMPLSSMAAALPPSF
FT                   TSKEKIPCSAADAERVLDVLRSEHPEADTTDGIRIAQGGSWTMVRPSGTEPLIRVYAES
FT                   HSEAALSELLSGQVRRIREILDGG"
FT                   /transl_table="11"
FT                   /protein_id="YP_875234.1"
FT   gene            253819..254199
FT                   /db_xref="GeneID:6370473"
FT                   /locus_tag="CENSYa_0293"
FT   CDS_pept        253819..254199
FT                   /locus_tag="CENSYa_0293"
FT                   /gene_family="HOG000055225" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein H6-type"
FT                   /transl_table="11"
FT                   /note="COG1358"
FT                   /db_xref="GI:118575492"
FT                   /db_xref="GeneID:6370473"
FT                   /translation="MAKGYYVKFETPKDLVNPILEALRAATQSGKVKKGTNEATKAIER
FT                   GTSKLVVIAEDVEPPEVVAHLPILCDEQGAAYAFVPSKQDLGKALGIDITSAAAILDSG
FT                   DAQHIVDQVISSIAKIKGETGK"
FT                   /protein_id="YP_875235.1"
FT   gene            254196..254408
FT                   /db_xref="GeneID:6370474"
FT                   /locus_tag="CENSYa_0294"
FT   CDS_pept        254196..254408
FT                   /locus_tag="CENSYa_0294"
FT                   /gene_family="HOG000224552" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein S28E/S33"
FT                   /transl_table="11"
FT                   /note="COG2053"
FT                   /db_xref="GI:118575493"
FT                   /db_xref="GeneID:6370474"
FT                   /translation="MSTETDEVTSAEIIQIVGRTGIAGEVIQVRVKIMAGKDQGRILTR
FT                   NVKGSVRMGDILRLRETEREAKKIK"
FT                   /protein_id="YP_875236.1"
FT   gene            254420..254617
FT                   /db_xref="GeneID:6370475"
FT                   /locus_tag="CENSYa_0295"
FT   CDS_pept        254420..254617
FT                   /locus_tag="CENSYa_0295"
FT                   /gene_family="HOG000105759" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein L24E"
FT                   /transl_table="11"
FT                   /note="COG2075"
FT                   /db_xref="GI:118575494"
FT                   /db_xref="GeneID:6370475"
FT                   /translation="MSLIIKPCNFCNRPVAKGSGTMFAKNDGTVMWFCSSKCRKNMTVL
FT                   KRDPRKFKWTGKYVKGGIRK"
FT                   /protein_id="YP_875237.1"
FT   gene            254730..255020
FT                   /db_xref="GeneID:6370476"
FT                   /locus_tag="CENSYa_0296"
FT   CDS_pept        254730..255020
FT                   /locus_tag="CENSYa_0296"
FT                   /gene_family="HOG000224564" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="COG0105"
FT                   /db_xref="GI:118575495"
FT                   /db_xref="GeneID:6370476"
FT                   /translation="MFRFTKEQAEEFYAVHKERPFFNELVSFITSGSVVAAVIEGNNAV
FT                   TAVRTMIGSTKSSEAAPGSIRGDLGLGFTDNIVHASDSAESFSHEERVAFQ"
FT                   /transl_table="11"
FT                   /protein_id="YP_875238.1"
FT   gene            255027..256808
FT                   /db_xref="GeneID:6370477"
FT                   /locus_tag="CENSYa_0297"
FT   CDS_pept        255027..256808
FT                   /locus_tag="CENSYa_0297"
FT                   /gene_family="HOG000105770" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="translation initiation factor 2"
FT                   /transl_table="11"
FT                   /note="COG0532"
FT                   /db_xref="GI:118575496"
FT                   /db_xref="GeneID:6370477"
FT                   /translation="MKVRQPIVTVLGHVDSGKTSLLDKIRGTGVQGREAGGITQHIGAS
FT                   FLPREIIKKRCGPLYGKISGSDVQVPGVLVIDTPGHEVFTNLRARGGSAADIAILVVDV
FT                   NRGFQPQTSESLRVLQARKVPFVVALNKVDQIPGWRKSDAPFITGAIEIQDASIRADLE
FT                   QKIYDVVGTLSVLGYSSEAFYNVKDFAKEVAIVPMSARSGVGIPELLAVLVGLTQQYLS
FT                   ARLEQGSKESRGIVLEVNDEVGIGPSANMILIDGELGMNDTILVAKRDGVVSTKPKAIL
FT                   LPKPLDEMRDPRDKFRPVERVEAAAGIKVASPDLGGVLPGSAVYITSDAAEVGRLKKEM
FT                   EAEMKSVFIETETDGVTLKCDTIGSLEAVTSMLRRQQVPIAKADIGPVNRRDVMGARAV
FT                   KENDRHLGVVLAFNVRVLPDAETESDDYHVRIFSDKIIYSLVDGYSKWVEEDALHEEDA
FT                   AFSELTPLSRFVFLGGFVFRNSDPAVFGIRVDVGTLRQKTAFMNERGKKVGHIHQLQED
FT                   KKTVKSAKAGSEVACSVQGVTIGRQINEGETFYTLPHSYEAKMLLRRFAQRLGPEERKV
FT                   LDHIVEVQRRSDPAYAY"
FT                   /protein_id="YP_875239.1"
FT   gene            complement(256809..257180)
FT                   /db_xref="GeneID:6370478"
FT                   /locus_tag="CENSYa_0298"
FT   CDS_pept        complement(256809..257180)
FT                   /locus_tag="CENSYa_0298"
FT                   /gene_family="HOG000047646" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="flavin-nucleotide-binding protein"
FT                   /transl_table="11"
FT                   /note="COG3576"
FT                   /db_xref="GI:118575497"
FT                   /db_xref="GeneID:6370478"
FT                   /translation="MAGAAENIGQLKYISLETFKKSGEGVKTPVWFVATEGVIYVATGR
FT                   STGKAKRIANNPRVRFAPCTFRGGIKGDWTEGSAEQLSGEEEISIMGLRKKKYGVMSLL
FT                   SGLAGRSKGGMTVYRIKED"
FT                   /protein_id="YP_875240.1"
FT   gene            257294..257368
FT                   /db_xref="GeneID:6370479"
FT                   /locus_tag="CENSYa_0299"
FT   tRNA            257294..257368
FT                   /db_xref="GeneID:6370479"
FT                   /locus_tag="CENSYa_0299"
FT                   /product="tRNA-Val"
FT   gene            complement(257603..258754)
FT                   /db_xref="GeneID:6370480"
FT                   /locus_tag="CENSYa_0300"
FT   CDS_pept        complement(257603..258754)
FT                   /locus_tag="CENSYa_0300"
FT                   /gene_family="HOG000105771" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="asparagine synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.4"
FT                   /note="COG0367"
FT                   /db_xref="GI:118575498"
FT                   /db_xref="GeneID:6370480"
FT                   /translation="MFDMRSSLILWVPASFLASMARSAGMRVLDSISAGSSNDSTMPSC
FT                   DLKHASPPGQAKLGYYNSAKGAAAMESMMARLRDELRAAVRACGSKNLALSGGLDSTVI
FT                   ACLLGEGAEAAAVIADDFVGTDLAYHQMAAAMMGAPPRIIRATTPEILDAIEGTIRVLG
FT                   SFNDIEIRNSAAMYLLIERVAGTGWTSMITGDGADELFAGYDFFGRLGPAEIEEEQQRI
FT                   LGVMHFDSHRIGKALGVRIESPFLAPKVAEIARSVPAEYKVREEGGRTYGKWILRKAFE
FT                   DAIPRAIAWRPKAALQDGSGTAGLTGLFESVVSDGTFESKRGAIEASDGIRVRSKESLH
FT                   YYEAYRRIFGKPEPPAGGRPCPYCRHPVPDGYKFCAMCGAYPA"
FT                   /transl_table="11"
FT                   /protein_id="YP_875241.1"
FT   gene            258753..259058
FT                   /db_xref="GeneID:6370481"
FT                   /locus_tag="CENSYa_0301"
FT   CDS_pept        258753..259058
FT                   /locus_tag="CENSYa_0301"
FT                   /gene_family="HOG000105782" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="COG2522"
FT                   /db_xref="GI:118575499"
FT                   /db_xref="GeneID:6370481"
FT                   /translation="MLGVTQAAVSNYIRGTRGDPKLMEKLGRETRIAAMLEELSEDLAS
FT                   SMEYTPSSLAKFIGLCNYIKSSLFICEIHHNLESNIDEKVCKECENMLLKGPGSVY"
FT                   /protein_id="YP_875242.1"
FT   gene            complement(259055..259333)
FT                   /db_xref="GeneID:6370482"
FT                   /locus_tag="CENSYa_0302"
FT   CDS_pept        complement(259055..259333)
FT                   /locus_tag="CENSYa_0302"
FT                   /gene_family="HOG000105803" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575500"
FT                   /db_xref="GeneID:6370482"
FT                   /translation="MMVGKQGGIFKVEDDPVMRVAIDVLERLGSLGRITLKASGENIPN
FT                   AVAIANIITDKMMKGTSSVEKIHVDSENIMVMGQILSTIEITLAKNI"
FT                   /protein_id="YP_875243.1"
FT   gene            complement(259382..259849)
FT                   /db_xref="GeneID:6370483"
FT                   /locus_tag="CENSYa_0303"
FT   CDS_pept        complement(259382..259849)
FT                   /locus_tag="CENSYa_0303"
FT                   /gene_family="HOG000105804" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA-directed RNA polymerase, subunit K/omega"
FT                   /EC_number="2.7.7.6"
FT                   /note="COG1758"
FT                   /db_xref="GI:118575501"
FT                   /db_xref="GeneID:6370483"
FT                   /translation="MSDANDQELVVEGSEAAGEPEIDIGLSKALESYRRLAEVNELTEE
FT                   QQEELEVRIKEIQERDVIEIDTVHEPQELTSDKKILIGPPVLTRFEKARIMGARALQLS
FT                   LGAPPFIEIPADARTSLDIAMGELEKRIIPIVIRRVLPNGDYQNIPISYFK"
FT                   /transl_table="11"
FT                   /protein_id="YP_875244.1"
FT   gene            complement(259927..260145)
FT                   /db_xref="GeneID:6370484"
FT                   /locus_tag="CENSYa_0304"
FT   CDS_pept        complement(259927..260145)
FT                   /locus_tag="CENSYa_0304"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575502"
FT                   /db_xref="GeneID:6370484"
FT                   /translation="MSCKGICLRYKAKKPVSGGRYENGQKRCQMCDIFINWDGIHCPCC
FT                   GYRTRGVPRNVKWKKRLRTKMTGAAQT"
FT                   /protein_id="YP_875245.1"
FT   gene            260350..262320
FT                   /db_xref="GeneID:6370485"
FT                   /locus_tag="CENSYa_0305"
FT   CDS_pept        260350..262320
FT                   /locus_tag="CENSYa_0305"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="PPE-repeat protein"
FT                   /transl_table="11"
FT                   /note="COG5651"
FT                   /db_xref="GI:118575503"
FT                   /db_xref="GeneID:6370485"
FT                   /translation="MRGPGIVLAILALAVLVPGVVLAANFTDAPKGPTTTCLDPGVSDG
FT                   QPGGTDCTAMHADNGTEWAGSHMHGNASVQEIHVVCNEDGCSTHTHYYNMEAGGPAMPH
FT                   GADGAHSASPDPAEEPGPPPSLGTSALTDSSPALSDTYSLTARPGVKAAPVMDDAASAG
FT                   TDSDMPDDAAPARDAALNDTDSGAPAMDDAAPEGAGAAGPVANDPVPTVTSAPPEPAAT
FT                   VPAPTVPDVPEPVVPEPAATVPAPTVPDVPEPVVPEPAANVPAPTVPDVPEPVVPEPAA
FT                   TVPAPTVPDVPEPVVPEPAANVPAPTVPDVPEPVVPEPAANVPAPTVPDVPEPVVPEPA
FT                   ATVPAPTVPDVPEPVVPEPAANVPAPEGAGAPTDPPAMLITPLVENARVEGNFTYGPHP
FT                   RNTFELYLTDGHGRTPVMVYFHQGMPANSSIPRGEWHVTTDELLSRGISVIHADYPFID
FT                   ETDIKGMVGNASLVIDYIAVNGLDIGVDPERMGVYGSGAGGGIALYIATGSRTGLIDAV
FT                   GHFNAPSTFDIGSWPAIIGLPLTDLTREVGADVPALYGVDSFDDLARGEALRLRVSLDM
FT                   LGNMDAGSPPIVVWTDGVAGGDSLESLMMHPGHARALLDRCRELGILCVDNALGGRIFV
FT                   ERLGAGAHDFMIRGGGFGTLG"
FT                   /protein_id="YP_875246.1"
FT   gene            262391..263173
FT                   /db_xref="GeneID:6370486"
FT                   /locus_tag="CENSYa_0306"
FT   CDS_pept        262391..263173
FT                   /locus_tag="CENSYa_0306"
FT                   /gene_family="HOG000223628" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG1478"
FT                   /db_xref="GI:118575504"
FT                   /db_xref="GeneID:6370486"
FT                   /translation="MRPVALTVIPIRARRETGRFGLLGAVLCAIKDGGAELQDGDVLVV
FT                   SSKYVANSQGRMVDLGGISPSREGADLARRYRIDPEMAEIVLRESDAVLGGTAGFVLTS
FT                   GGGMMAPNAGIDRSNTAGGTAVLYPEDPYGTAEALRRGIFLACGAHVGVILSDSRLMPA
FT                   RVGTTGVAISCAGMEPVEDARARPDLDGNPLKVTFQAVADSLASAANHGMGEAAESVPI
FT                   AVLRGSGARLTGRRILPAESAVHHDTCVYVRGLSGTNP"
FT                   /protein_id="YP_875247.1"
FT   gene            263185..263760
FT                   /db_xref="GeneID:6370487"
FT                   /locus_tag="CENSYa_0307"
FT   CDS_pept        263185..263760
FT                   /locus_tag="CENSYa_0307"
FT                   /gene_family="HOG000105815" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575505"
FT                   /db_xref="GeneID:6370487"
FT                   /translation="MAARGAAAMEYHTKYPKTLSLGGGEKDRVRVDGGAGVEHLYLVVK
FT                   KSADELASIFKSEGFTRVKFEHRKPFQIGRGLNLKLKKPWEMHVRFVEIKKGLVAIQGE
FT                   VEVSRDYLQHLFCQNTPVVYEIEEMLKKHRIDYRIWNSRISRYVHSVLDNYKIRLSAPN
FT                   IPVFAWKPMVPFIGTVGIFYLWKYVQTI"
FT                   /protein_id="YP_875248.1"
FT   gene            263824..264330
FT                   /db_xref="GeneID:6370488"
FT                   /locus_tag="CENSYa_0308"
FT   CDS_pept        263824..264330
FT                   /locus_tag="CENSYa_0308"
FT                   /gene_family="HOG000105826" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575506"
FT                   /db_xref="GeneID:6370488"
FT                   /translation="MSSSGVSPWELEVAYGYFVAMFAVRQEELEPDPDFISVLKIEIPV
FT                   QFSQEFFDWFGFRRWDKIKSLFKEMKRRRGSRKAIKLQLIFAGSPSVTFVADAMDKGLY
FT                   DNSIEKIDFVLELLPYHLGPGRLPANTTDVSYRYDGDARRWRFGSATADGAEYEFKGEG
FT                   WKKVS"
FT                   /protein_id="YP_875249.1"
FT   gene            complement(264323..264724)
FT                   /db_xref="GeneID:6370489"
FT                   /locus_tag="CENSYa_0309"
FT   CDS_pept        complement(264323..264724)
FT                   /locus_tag="CENSYa_0309"
FT                   /gene_family="HOG000105837" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575507"
FT                   /db_xref="GeneID:6370489"
FT                   /translation="MFRRSIITGYFEPQLLGLDFLRSDVRHPSITDGGLMQSGLLHVFF
FT                   DVDTGADYPDGDEWVIVEYLLPLDASLPDSLKGTDHFTTISAGSKTYWHHRELVRFKYG
FT                   KSKKLSESLVFIESKYKELHGMLEPLELS"
FT                   /protein_id="YP_875250.1"
FT   gene            complement(264842..265771)
FT                   /db_xref="GeneID:6370490"
FT                   /locus_tag="CENSYa_0310"
FT   CDS_pept        complement(264842..265771)
FT                   /locus_tag="CENSYa_0310"
FT                   /gene_family="HOG000007086" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase, beta
FT                   subunit"
FT                   /EC_number="1.2.7.3"
FT                   /note="COG1013"
FT                   /db_xref="GI:118575508"
FT                   /db_xref="GeneID:6370490"
FT                   /translation="MHNDWCAGCGDFGIANAIQMALAEMEIPRHKAALFSGIGCSGKTS
FT                   HYVNVYGIHTLHGRVLTFAQGAKLANPDMTVVAAGGDGDGLGIGAGHFVAAGRRNIDMT
FT                   YVLFNNGVYGLTKGQASPTLRLGEKTKSLPSPNTNYNVNPIGLAVASGYTFVARGYAYD
FT                   VRHLKDLIIAAVRHKGLAFLDVLQPCPTYNDINTRDWYAGLDAAEGSAERHSRIYKLED
FT                   TGYDPEVHYNEESEINERLSQALIKSLEWDKKIPTGIFYRNEIITPYETRLSDKVPNYL
FT                   ENHPSEQRITSHGKPAADISGLLDGLEV"
FT                   /transl_table="11"
FT                   /protein_id="YP_875251.1"
FT   gene            complement(265794..267722)
FT                   /db_xref="GeneID:6370491"
FT                   /locus_tag="CENSYa_0311"
FT   CDS_pept        complement(265794..267722)
FT                   /locus_tag="CENSYa_0311"
FT                   /gene_family="HOG000007071" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="2-oxoglutarate ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /EC_number="1.2.7.3"
FT                   /note="COG0674"
FT                   /db_xref="GI:118575509"
FT                   /db_xref="GeneID:6370491"
FT                   /translation="MPYKPAHFVDTDISWLIGGPQGSGVESAANIFSHVCSAAGYQVFG
FT                   KREFYSNIKGEHSYFLVRVADGTIRSNVNDVNLITSYDAETIFRHAEEVPAGGAILYDT
FT                   ELGKITTDAVATLDGPFRKRLDGHLADKGKPATVDGMLETVSDAGVKLIPVSFSSILQE
FT                   LAEKEDNPKLRNMKRMFNVIGVSLSLGVLGMSPEPLYGSVMSIFAKKPKVAELNRKVAR
FT                   MAHEMGAGLDCGCKLGNTSKKPHTMLVQGYQGTALGKIACGCRFQPYYPITPASDESVY
FT                   LETNETFEVAGDRPGSLLVVQTEDEISAMGMAIGGSLTGTRSATCTSGPGFSLMAEMLG
FT                   WSGINEVPLVVTNYQRSGPSTGLPTRHGQDDLLFAIHAGHGEFPRVVYSSGDVEESFYD
FT                   TAMCFNLADIYQLPVIHMMDKAMASSVTTCPRFEPDRMTINRGKLLESMEPGDYRRFAL
FT                   VPDGISPRSKIGLENGIFWNTGDESDEYGHITEDPVVRVQMMDKRHSKLGRILREVPDE
FT                   DQAISYGVHEYTVIGWGSSKGPVLDAISMLEQEGKKVGFVQVKMLQPFPADYLRFLLGD
FT                   ARVIIDVESNQTGQLGGLLRQHLGREPDHYILKYTGRAMTSTEVHGALKDILRGGAKKR
FT                   EVLMHGA"
FT                   /transl_table="11"
FT                   /protein_id="YP_875252.1"
FT   gene            complement(267807..267896)
FT                   /db_xref="GeneID:6370492"
FT                   /locus_tag="CENSYa_0312"
FT   CDS_pept        complement(267807..267896)
FT                   /locus_tag="CENSYa_0312"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575510"
FT                   /db_xref="GeneID:6370492"
FT                   /translation="MLDNCQCVCPFCGERDKCDCAVDDAGTGG"
FT                   /protein_id="YP_875253.1"
FT   gene            267895..268941
FT                   /db_xref="GeneID:6370493"
FT                   /locus_tag="CENSYa_0313"
FT   CDS_pept        267895..268941
FT                   /locus_tag="CENSYa_0313"
FT                   /gene_family="HOG000136700" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="2 lactate dehydrogenase"
FT                   /EC_number="1.1.1.28"
FT                   /note="COG1052"
FT                   /db_xref="GI:118575511"
FT                   /db_xref="GeneID:6370493"
FT                   /translation="MLPQLMQHANSSMSGSICLGLHTNLINGFRSDSYVRKRILLTRRL
FT                   QDFAQARLGRRYDLEVYSGRVPMPRRALIRAISGAHALVCFPYDVIDAGVMDAAPDLET
FT                   IATYSVGYDHIDVAHARGRGITVGYTPDVLTDATADLTMALMLDLLRRVTEGDRIIRAG
FT                   RWRQIYGADDYLGTDVGGKTLGILGMGRIGSRVAKRAAAFGMKVIYHSRSSTGPGTRVT
FT                   LGRLLERSDVLSIHVPHTPDTHEMMDMSRLRKMKRSAYLINTSRGRVVHEKDLAAALRQ
FT                   GIIAGAALDVFHSEPVGPANPLVKMQNVVLAPHIGSSTDGTRRKMAELTVKNLELGLSG
FT                   REPAYSVK"
FT                   /transl_table="11"
FT                   /protein_id="YP_875254.1"
FT   gene            complement(268926..269327)
FT                   /db_xref="GeneID:6370494"
FT                   /locus_tag="CENSYa_0314"
FT   CDS_pept        complement(268926..269327)
FT                   /locus_tag="CENSYa_0314"
FT                   /gene_family="HOG000105848" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575512"
FT                   /db_xref="GeneID:6370494"
FT                   /translation="MIAAPNGHAQNGLMDLLGVSDILFIIRGGGAVAEIRSNSLGIRRK
FT                   EQWITIGDNDGPCHMHIDSGKIASARFVAEEKPGRTSYSVRFLDDDGERVLGAFFTKMY
FT                   DTEGALSQDRKALYDGLSSKYGTEVYFTE"
FT                   /protein_id="YP_875255.1"
FT   gene            complement(269324..269605)
FT                   /db_xref="GeneID:6370495"
FT                   /locus_tag="CENSYa_0315"
FT   CDS_pept        complement(269324..269605)
FT                   /locus_tag="CENSYa_0315"
FT                   /gene_family="HOG000105859" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575513"
FT                   /db_xref="GeneID:6370495"
FT                   /translation="MIPDRCSIREEGKRCVNPPGFVVSVVSESDEYMIGVTCNKHRQAV
FT                   TGKIGVLQGEGKIPSGKVNFEVLKAVGTDCVNGSCGDDLVQIDGIRNA"
FT                   /protein_id="YP_875256.1"
FT   gene            269701..271068
FT                   /db_xref="GeneID:6370496"
FT                   /locus_tag="CENSYa_0316"
FT   CDS_pept        269701..271068
FT                   /locus_tag="CENSYa_0316"
FT                   /gene_family="HOG000105870" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dehydrogenase"
FT                   /transl_table="11"
FT                   /note="COG0579"
FT                   /db_xref="GI:118575514"
FT                   /db_xref="GeneID:6370496"
FT                   /translation="MRHCTATATIIPAQVAAYAMTKRFDVVIVGAGILGTSIAYFLGHL
FT                   NPSREIAVVEQALRVAFHTSGRNTGKVHAPYLYDPKKKALTARASFHGYAMWEEYSKNR
FT                   GLPFKRDGVVEVAMDADATGVLDRHLQWGMENGLGEDEIMLLDRAEMEKREPNVKCEAA
FT                   IYCGRDASVDYAAFTRALGGDTTAAGVRFLLNTRATGISRIDDGWNVTLDGEHEVEAGL
FT                   LINAAGGEAVDLAHAAGVAKDLTDVHFRGEYWRAPAEYSGLTHSSVYSVPARPEYPFLD
FT                   PHWIVRSDGTCEVGPNAVPVFSPYGYTGRENARRLVPKMFEMLSSGARKMVFDRQFQKL
FT                   ALGEVRSSLSKSAMIGRVQSFLPGIDPGRFTERGSAGIRSSVVDSGGHFVPDAVLAPGH
FT                   SSFHILNYNSPGATGALPFAAHIVGRLGAEGLLKNEMEDAQCGPWRFGEVAAHMAG"
FT                   /protein_id="YP_875257.1"
FT   gene            complement(271071..271171)
FT                   /db_xref="GeneID:6370497"
FT                   /locus_tag="CENSYa_0317"
FT   tRNA            complement(271071..271171)
FT                   /db_xref="GeneID:6370497"
FT                   /locus_tag="CENSYa_0317"
FT                   /product="tRNA-Ser"
FT   gene            271390..272073
FT                   /db_xref="GeneID:6370498"
FT                   /locus_tag="CENSYa_0318"
FT   CDS_pept        271390..272073
FT                   /locus_tag="CENSYa_0318"
FT                   /gene_family="HOG000105881" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575515"
FT                   /db_xref="GeneID:6370498"
FT                   /translation="MNRQWRTVHFRCTWRSLGFFHAHDFNSRLVCMINMYNNHLRSRRF
FT                   MDPIEWVALIVSTLAAIGTIVTVVISAYKYFGKKNAEKIRSIQNLYCELNDTLKGLDIL
FT                   KYPHNVLSMKIDVSAGNEKIAYFMNRSLNHDFYDSLISSGAIYLLDQDIQQTIQHIFRL
FT                   IKTHNNYLEIAMRMLRQPQPVMEEIWPYVYWLEQNQPRITMIIREVMDKLEERFMIDEC
FT                   LPSAV"
FT                   /protein_id="YP_875258.1"
FT   gene            complement(272229..273338)
FT                   /db_xref="GeneID:6370499"
FT                   /locus_tag="CENSYa_0319"
FT   CDS_pept        complement(272229..273338)
FT                   /locus_tag="CENSYa_0319"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575516"
FT                   /db_xref="GeneID:6370499"
FT                   /translation="MASTTEKRAEEKPPYGDKGTKIVSVYGVKITVSRPDKSGKTTIHI
FT                   ERDPKATDSPDKQGGRSIQEAEEPSYVSIKLAEVPEKYSVKAGDPVAVERLGEASVRRA
FT                   AKSSYDGTRLAEVPEKYSVKAGDPVAVERLGEASVRRAAKSSYDGTRLAEVPEKYSVKA
FT                   GDPVAVERLGEASVRRAAKSSYDGTRLAEVPEKYSVKAGDPVAVERLGEASVRRAAKSS
FT                   YDGTRLAEVPEKYSVKAGDPVAAERLGRSKMPEVDRTSYDSIELAEVPQKYRVKAGDPV
FT                   AAERLGRSKMPEVDRTSYDSIELAEVPEKYRVKAGDPVAAERLGRSKMPEVDRTSYDSI
FT                   ELAEVPEKYRVKAGDPVAAERLGRSKEKN"
FT                   /protein_id="YP_875259.1"
FT   gene            complement(273498..273935)
FT                   /db_xref="GeneID:6370500"
FT                   /locus_tag="CENSYa_0320"
FT   CDS_pept        complement(273498..273935)
FT                   /locus_tag="CENSYa_0320"
FT                   /gene_family="HOG000105892" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575517"
FT                   /db_xref="GeneID:6370500"
FT                   /translation="MMPAGLVLAVCVGAAAGGIAGALLVDTGGGPLVFVEGPSLSVLAD
FT                   KQGFGRGEEILIRIINTGSVPLEFDDSSYGVRVVQLDGIELYAPESSGGERTMGPGEEA
FT                   ALVWDQIKSDGDAALHGTYKIIATAVSGELEVEGTATVNIF"
FT                   /protein_id="YP_875260.1"
FT   gene            complement(273932..274933)
FT                   /db_xref="GeneID:6370501"
FT                   /locus_tag="CENSYa_0321"
FT   CDS_pept        complement(273932..274933)
FT                   /locus_tag="CENSYa_0321"
FT                   /gene_family="HOG000231224" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pseudouridine synthase"
FT                   /EC_number="4.2.1.70"
FT                   /note="COG0130"
FT                   /db_xref="GI:118575518"
FT                   /db_xref="GeneID:6370501"
FT                   /translation="MTLAQLSGLRVIDQDVTDDAHGTYHDKRSVEQLLEYGIVLLDKPP
FT                   GPTSHEAVAWAKRILEIPKAGHSGTLDPQVSGVLPLGLGEATKALGVLLIGPKEYVAVG
FT                   RFHALQDSEKLGELARLFTGPIHQKPPQRSSVLRRTRVKTIHEIEVLEQKERLVLMRVS
FT                   CEAGTYIRKLLYDMGEVVGSGASMIELRRTRVDHFTEGSGLVTMHELAEAYAVWKEGDG
FT                   SRLQRIIRPVEEALAGIKAVVIRDSAVDALCHGAQLAIPGILQVSDNLRIGDLAGVYTQ
FT                   KGEVVALAEAEMEAEVIADATKGHAFKTKRLIMKTDTYPKSWHSKGTYKEKE"
FT                   /transl_table="11"
FT                   /protein_id="YP_875261.1"
FT   gene            complement(274930..275487)
FT                   /db_xref="GeneID:6370502"
FT                   /locus_tag="CENSYa_0322"
FT   CDS_pept        complement(274930..275487)
FT                   /locus_tag="CENSYa_0322"
FT                   /gene_family="HOG000105913" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /note="COG1102"
FT                   /db_xref="GI:118575519"
FT                   /db_xref="GeneID:6370502"
FT                   /translation="MRSVVISGPPAVGKTTVARALAGEFGLEYLSGGDVLKGIAREEGF
FT                   DSGGDDWWDTEEGMRFLDKRSKNPEFDRRVDDSLRALFDEGGKVITSYTLPWLVDDGIK
FT                   IWLAGSHENSSRRMGSRDSIGMAEALAITRRRYLANKVLYKKMYDFEFGEDSSIFNVVI
FT                   NTDNLDADQVIQSAKSQVREML"
FT                   /transl_table="11"
FT                   /protein_id="YP_875262.1"
FT   gene            complement(275487..276113)
FT                   /db_xref="GeneID:6370503"
FT                   /locus_tag="CENSYa_0323"
FT   CDS_pept        complement(275487..276113)
FT                   /locus_tag="CENSYa_0323"
FT                   /gene_family="HOG000105914" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="membrane protein"
FT                   /transl_table="11"
FT                   /note="COG1422"
FT                   /db_xref="GI:118575520"
FT                   /db_xref="GeneID:6370503"
FT                   /translation="MIETILLFLGDVILQDGGFFGMGGGGALGSDDPVIKGAVAVLFSV
FT                   VGFGILLNLFNSAIRKKMIDQTKLRRIMKETRAWQKERMAAFKSKDQAKQAELSKKSSY
FT                   MNKMNMEMMQMNMRPMMITMVPLLLIFYFVLPELFPYTVAVSPIPLNVLPGDWFQLTCT
FT                   AEQAADPEHVCQEENAIYLWAWYFLSSIAFSGINMKLTKTTMDLS"
FT                   /protein_id="YP_875263.1"
FT   gene            complement(276119..276655)
FT                   /db_xref="GeneID:6370504"
FT                   /locus_tag="CENSYa_0324"
FT   CDS_pept        complement(276119..276655)
FT                   /locus_tag="CENSYa_0324"
FT                   /gene_family="HOG000105936" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="archaeal adenylate kinase"
FT                   /EC_number="2.7.4.3"
FT                   /note="COG2019"
FT                   /db_xref="GI:118575521"
FT                   /db_xref="GeneID:6370504"
FT                   /translation="MGKSTLVSKLVEILKENGRTVNVVSFGTVMFDEARKRGVTDRDKL
FT                   RKLPMSEQQDLQRTAADSIARLTEDYVIVDTHAFISTPSGYYPGLPEHVLKAIRPSNFI
FT                   SVYARPEDIYNRRLQDDTRSRDKVTLDGIKKELNFHQSMISTCSVISGSPVKAVQNAEG
FT                   KVELAAQKAIDAIGL"
FT                   /transl_table="11"
FT                   /protein_id="YP_875264.1"
FT   gene            complement(276684..278120)
FT                   /db_xref="GeneID:6370505"
FT                   /locus_tag="CENSYa_0325"
FT   CDS_pept        complement(276684..278120)
FT                   /locus_tag="CENSYa_0325"
FT                   /gene_family="HOG000231248" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="preprotein translocase subunit"
FT                   /transl_table="11"
FT                   /note="COG0201"
FT                   /db_xref="GI:118575522"
FT                   /db_xref="GeneID:6370505"
FT                   /translation="MAEGTATALIRKMVLVAEPYLPQVPKPKKKLSLQTRLLWCGLALL
FT                   IYMVMAQTPLFGATVPEFDFLAFARVIFASQQGTLVELGIGPIVTAGLLMQLLRGSEIL
FT                   KFDFKKPEERGIFQTATKMVSYVVIVVESSIYGIAVYGPGIADPSVLYILIGQLMASSI
FT                   IIMFLDELIQKGWGLGSGISLFIMAGVAQQILWSLFSPLPAGDGFAVGIFPFIGQWASV
FT                   GMGNFEDIFFRYNQLPSIFGLLLTGGVLLILVYTQGMKIEIPIVSTKYRGFSATYPIKL
FT                   MYVSNIPVILASALTANAIFIGQMFWSNFNPRNDNIFLNVLAQFDLTNPSTPIGGIVYY
FT                   ITPPRGLDIAALDPMRAVGYVLFMIGIVVVFGKLWVELGGLSPKSAAKNLLDADVQIPG
FT                   FRRSNQPIEVLLNKYIPSVTIIGSMILGALAGASDVLGVFGSGIGILLMVDILINYYNQ
FT                   LVREQVEVVMPRLGALLGRK"
FT                   /protein_id="YP_875265.1"
FT   gene            complement(278121..278537)
FT                   /db_xref="GeneID:6370506"
FT                   /locus_tag="CENSYa_0326"
FT   CDS_pept        complement(278121..278537)
FT                   /locus_tag="CENSYa_0326"
FT                   /gene_family="HOG000231263" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein L15"
FT                   /transl_table="11"
FT                   /note="COG0200"
FT                   /db_xref="GI:118575523"
FT                   /db_xref="GeneID:6370506"
FT                   /translation="MATRNRKTRKLRGSRTHGWGQVGQHRASGHKGGVGVSGQLKHHFS
FT                   SMLKEDPGHFGHDSTHPPHSNAAKKWASVRDLDDFHTRFGTEEGGKKVIDLAASGYDKL
FT                   LGGGTVSGAYSVKISRLTASAEEKIKRAGGEVLS"
FT                   /protein_id="YP_875266.1"
FT   gene            complement(278538..279005)
FT                   /db_xref="GeneID:6370507"
FT                   /locus_tag="CENSYa_0327"
FT   CDS_pept        complement(278538..279005)
FT                   /locus_tag="CENSYa_0327"
FT                   /gene_family="HOG000170918" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein L30/L7E"
FT                   /transl_table="11"
FT                   /note="COG1841"
FT                   /db_xref="GI:118575524"
FT                   /db_xref="GeneID:6370507"
FT                   /translation="MAGAYIVVRIKGQADVPHWAETTLKLLRLEKKHRATIIQSKENTR
FT                   GMLDKVKHYVAWQEIDAGLAMELLTKRGRGPGYKKLTEKDLEGTDYPGIKELADALATG
FT                   KASMSKIDRIKPWFALAPPRHGFKRSTKKMYGQKGVLGANRELSELVRSMI"
FT                   /protein_id="YP_875267.1"
FT   gene            complement(279010..279669)
FT                   /db_xref="GeneID:6370508"
FT                   /locus_tag="CENSYa_0328"
FT   CDS_pept        complement(279010..279669)
FT                   /locus_tag="CENSYa_0328"
FT                   /gene_family="HOG000072596" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein S5"
FT                   /transl_table="11"
FT                   /note="COG0098"
FT                   /db_xref="GI:118575525"
FT                   /db_xref="GeneID:6370508"
FT                   /translation="MSHPQSRPGGRDGRPRRRREPREEAPWVPKTALGKRVNAGEITSL
FT                   EEIQEAGARIQESGIIKKLLPDLKTEVVDVGIIQKMTSNGQSTRFKAIVAAGNENGYLG
FT                   IGQGKAKQMRIAIEKANNQALLNVGPIKLGCGSWECRCDQKHSVPFKVRGKGGSVVIEI
FT                   LPAPRGLGLVAGGKIRRLLELAGLKDAYTTAKGSTPTTNSTSKAVLECLRQTFSQG"
FT                   /protein_id="YP_875268.1"
FT   gene            complement(279669..280148)
FT                   /db_xref="GeneID:6370509"
FT                   /locus_tag="CENSYa_0329"
FT   CDS_pept        complement(279669..280148)
FT                   /locus_tag="CENSYa_0329"
FT                   /gene_family="HOG000105947" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein L18"
FT                   /transl_table="11"
FT                   /note="COG256"
FT                   /db_xref="GI:118575526"
FT                   /db_xref="GeneID:6370509"
FT                   /translation="MAHSRILRRLREEKTNYKKRRSMLMGRRDFVTVHISNENAQVQIH
FT                   APKMDGDVVIASGHSRYLASKGWKGSRKSIPASYLTGYLAGKRAVKKGAKSAIMYTGTR
FT                   RYTDRISAALKGVSDAGVDVPIDPSTFPPDERISGEHLTVKNDVKQIKTVIDGDM"
FT                   /protein_id="YP_875269.1"
FT   gene            complement(280183..281088)
FT                   /db_xref="GeneID:6370510"
FT                   /locus_tag="CENSYa_0330"
FT   CDS_pept        complement(280183..281088)
FT                   /locus_tag="CENSYa_0330"
FT                   /gene_family="HOG000022686" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="COG0078"
FT                   /db_xref="GI:118575527"
FT                   /db_xref="GeneID:6370510"
FT                   /translation="MKIRSKDLLTGAELDRKEILGIIESAIRLKKGGRSKAHPLDGRTL
FT                   AMVFQKPSTRTRVSFAAGMFQLGGEAIYLPPGDMQLSRGETIPDTARALSGYVDVIVAR
FT                   VFGHETIEEIAASASVPVINGLSDTFHPCQILADLMTIKERKGRLKGLRAAWIGDGNNV
FT                   CNSLLYGCAAVGIDISVATPAVFRPIPGVVDKCRESIDVKLTTDPAEAAAGADIVFTDT
FT                   FASIHNMDKERERKFLPKYRVNAPLMKKAADDAIFMHCLPAKRGQEVDGEVIDGPQSAV
FT                   WDEAENRLHSQKALLLALGI"
FT                   /transl_table="11"
FT                   /protein_id="YP_875270.1"
FT   gene            complement(281085..282353)
FT                   /db_xref="GeneID:6370511"
FT                   /locus_tag="CENSYa_0331"
FT   CDS_pept        complement(281085..282353)
FT                   /locus_tag="CENSYa_0331"
FT                   /gene_family="HOG000105948" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="signal recognition particle GTPase"
FT                   /transl_table="11"
FT                   /note="COG0552"
FT                   /db_xref="GI:118575528"
FT                   /db_xref="GeneID:6370511"
FT                   /translation="MLDELEISLLESDVAAEVADSIKEDLKGRLVGTSVDKHVIGEHVR
FT                   ESLIGIISDLFDGAGAVDLLERIRAKKDDPYIIVFVGINGTGKTTSVAKIAHMLRDSKL
FT                   SVVLAAADTFRAGAIEQLREHAKRLNLKIVAQNYGSDPAAVARDAVLYARSHGVDCVLV
FT                   DTAGRMQTSKNLMEQIEKIIRVVQPDLKIFVGDSLAGNDTVNQAGEFHEHIKFDCSILT
FT                   KNDADARGGAALSIVKTTSTPVIYVGTGQEYGDIRPFSKETFIETVFGSEGVQGTEAAK
FT                   SGGAPPAGEIPETVRETEVAVVNSGSSVEEEEMEANKRREQKTDAQAAKEREQEEMEAN
FT                   KRREQEQAAEQSPHDGKEHPKGGDPFDGIDTKDIEAYLELHDTPPPETDDEAERAASKI
FT                   KSWISEGRQGKEAKGSWKGRFRR"
FT                   /protein_id="YP_875271.1"
FT   gene            complement(282430..282951)
FT                   /db_xref="GeneID:6370512"
FT                   /locus_tag="CENSYa_0332"
FT   CDS_pept        complement(282430..282951)
FT                   /locus_tag="CENSYa_0332"
FT                   /gene_family="HOG000115515" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="prefoldin, molecular chaperone"
FT                   /transl_table="11"
FT                   /note="COG1730"
FT                   /db_xref="GI:118575529"
FT                   /db_xref="GeneID:6370512"
FT                   /translation="MWIGAAMPVCNPSTRMPTNQFITCDGPAPNMSEEEAQKMLYQLQM
FT                   LETYVADMSQRESALVGVMKEAAAAVSAVKGIGEKGESEVLVPLGLGTFAKSKVSSGEK
FT                   IVINIGAGAAVEKDKDAALSYLESRIKEIEIALRDTSAKRQEAAANLEHGKAHLDQMMG
FT                   QHSHSTSGNV"
FT                   /protein_id="YP_875272.1"
FT   gene            283075..283419
FT                   /db_xref="GeneID:6370513"
FT                   /locus_tag="CENSYa_0333"
FT   CDS_pept        283075..283419
FT                   /locus_tag="CENSYa_0333"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575530"
FT                   /db_xref="GeneID:6370513"
FT                   /translation="MDEKQKRAEIKERFVMTGGCPMPRLPSYLGAKQGVIKPPAKRPVE
FT                   DKGFVMTGGYPMPRLPSYLGAKQGVIKPPAKRPVEDKGFVMTGGYPMPRLPSYLDVKRS
FT                   NPTGKRPLRT"
FT                   /protein_id="YP_875273.1"
FT   gene            complement(283683..284048)
FT                   /db_xref="GeneID:6370514"
FT                   /locus_tag="CENSYa_0334"
FT   CDS_pept        complement(283683..284048)
FT                   /locus_tag="CENSYa_0334"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575531"
FT                   /db_xref="GeneID:6370514"
FT                   /translation="MPPLRTARHEGPAPYRFRDQAPHTPAPEGSACIGGGRMIGHHTPA
FT                   CPQPLGRVLEVGKMPMAFNHDFYDSMISSGMINFLEPQLQQSIQNLFRIIKSHNNYLSI
FT                   TTRARYCLLIVSKNSPL"
FT                   /protein_id="YP_875274.1"
FT   gene            complement(284273..284935)
FT                   /db_xref="GeneID:6370515"
FT                   /locus_tag="CENSYa_0335"
FT   CDS_pept        complement(284273..284935)
FT                   /locus_tag="CENSYa_0335"
FT                   /gene_family="HOG000105959" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575532"
FT                   /db_xref="GeneID:6370515"
FT                   /translation="MFKTYPYLTYIMDILENFYANFISDPLEDISYIAAIIVLTLTATK
FT                   YFREKKAAEDKYSREKKAAEDKYIAERDADRSRASENLYFEIADTLQTIKGKKDSISRK
FT                   EMEILDSNGKKKTVHFINMLFNHDFYDSMISSGIINFLDPQLQQSIQNIFRIIKLHNKY
FT                   LDITTRAPILSAYSVKELSVIKEQNQRYYEWMNDAEDALRDKIPDIMKKLEKYVKAA"
FT                   /protein_id="YP_875275.1"
FT   gene            complement(285044..285664)
FT                   /db_xref="GeneID:6370516"
FT                   /locus_tag="CENSYa_0336"
FT   CDS_pept        complement(285044..285664)
FT                   /locus_tag="CENSYa_0336"
FT                   /gene_family="HOG000013583" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="superoxide dismutase"
FT                   /EC_number="1.15.1.1"
FT                   /note="COG0605"
FT                   /db_xref="GI:118575533"
FT                   /db_xref="GeneID:6370516"
FT                   /translation="MGEYTLPEMPYAYDALEPHIDARTMEIHHTKHHQTYTTKLNAALK
FT                   DCPADIQGKDVTEILANIGQVPEAQRKAINFNAGGYDNHRLFWNNMKPNGGGEPGGAVA
FT                   DAINSSFGSFADFKEKFSSTTAVIQGSGWGWLVYNPSSSKVEYKAMPNQTSPRTEKLVP
FT                   LLGCDVWEHAYYLKYQNKRPDYISAWWNVINWDEVESRLSKAK"
FT                   /transl_table="11"
FT                   /protein_id="YP_875276.1"
FT   gene            complement(285725..287344)
FT                   /db_xref="GeneID:6370517"
FT                   /locus_tag="CENSYa_0337"
FT   CDS_pept        complement(285725..287344)
FT                   /locus_tag="CENSYa_0337"
FT                   /gene_family="HOG000271471" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number="4.1.1.49"
FT                   /note="COG1866"
FT                   /db_xref="GI:118575534"
FT                   /db_xref="GeneID:6370517"
FT                   /translation="MPHGGITYLDGQVEARLLSQLQATGMLPGRAHRNLEPQELIRIAV
FT                   EKGDGVVTSTGSLSVRTGKYTGRSPGDRYIVYDGTTRDTVDWGKVNHKFDPGRFAEIFE
FT                   RMKGFVKGKELYVFDGFVGADPENRIAVRVINDHAWQSLFARQLFIRPSPEELEAHKPE
FT                   FTILCVNDFEAVPERDGTNSNVFIVIDLTRKTVLIGGTRYAGEIKKSMFSVMNYVLPAK
FT                   GVLPMHCSANIGRGGDTALFFGLSGTGKTTLSADPDRMLIGDDEHGWSEKGSFNFEGGC
FT                   YAKCINLSEEAEPQIWNAVKSGAVLENVVVDGETSRPNFDDGSLTENTRAAYPLEYIPG
FT                   AVIPSMGTNPKVVVFLTADAMGVLPPVSRLTKEGAMYHFMSGYTSKLTGTERGIKEPQA
FT                   VFSECFAAPFMPRPAAVYARMLGEKIGKHDAAVYLINTGWSGGPYGVGRRIKIKYSRAM
FT                   VTAVLTGALSGVEYRHDGLFNLDVPVECPGVPQGILDPRRQWEDGEAYDAAARDLARMF
FT                   AENFEKFKETPDEIQRAGPSAP"
FT                   /transl_table="11"
FT                   /protein_id="YP_875277.1"
FT   gene            287516..287920
FT                   /db_xref="GeneID:6370518"
FT                   /locus_tag="CENSYa_0338"
FT   CDS_pept        287516..287920
FT                   /locus_tag="CENSYa_0338"
FT                   /gene_family="HOG000231289" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein L32E"
FT                   /transl_table="11"
FT                   /note="COG1717"
FT                   /db_xref="GI:118575535"
FT                   /db_xref="GeneID:6370518"
FT                   /translation="MPINKEKLLQRSEVAKHRPDFVRAESWRYKRIKPAWRKPKGVDNH
FT                   QRKQKSRGRPGLVKVGYGGPRAARGLHPSGYTDNLVYNTADISVLDPATDGLRIGHSVG
FT                   ARKRKIIAAFAVEKKFKIFNARVSPDGNQS"
FT                   /protein_id="YP_875278.1"
FT   gene            287904..288356
FT                   /db_xref="GeneID:6370519"
FT                   /locus_tag="CENSYa_0339"
FT   CDS_pept        287904..288356
FT                   /locus_tag="CENSYa_0339"
FT                   /gene_family="HOG000231276" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein L19E"
FT                   /transl_table="11"
FT                   /note="COG2147"
FT                   /db_xref="GI:118575536"
FT                   /db_xref="GeneID:6370519"
FT                   /translation="MVINLRTKKRLASRVTGAGIHRIYFDPTHLDDIADAITRNDIRSL
FT                   ITANTIKIKPVSGTSRGRAQHKRRQKAKRGSKAGSKQGRMGARVGKKQVYVKKVRALRY
FT                   LLAVFKDRKDITNPEFWALYKKVGGNTVRNKAHLHLLVDEIKAKRS"
FT                   /protein_id="YP_875279.1"
FT   gene            complement(288353..288667)
FT                   /db_xref="GeneID:6370520"
FT                   /locus_tag="CENSYa_0340"
FT   CDS_pept        complement(288353..288667)
FT                   /locus_tag="CENSYa_0340"
FT                   /gene_family="HOG000244138" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methylated DNA-protein cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /note="COG0350"
FT                   /db_xref="GI:118575537"
FT                   /db_xref="GeneID:6370520"
FT                   /translation="MKLDERVYKELCRVPRGKVTTYGALARAVGLPNGQRIIGRIMKNN
FT                   PYPGIVPCHRVVRSDGKVGGYSPGGMSGGEMIKSAMLEKEGIGISGGKIRDLDGSLFEF
FT                   "
FT                   /transl_table="11"
FT                   /protein_id="YP_875280.1"
FT   gene            complement(288664..289440)
FT                   /db_xref="GeneID:6370521"
FT                   /locus_tag="CENSYa_0341"
FT   CDS_pept        complement(288664..289440)
FT                   /locus_tag="CENSYa_0341"
FT                   /gene_family="HOG000015484" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG1650"
FT                   /db_xref="GI:118575538"
FT                   /db_xref="GeneID:6370521"
FT                   /translation="MDLLVAHGGDPAGSNMARYLAEGMEPDGKIWHGRHFDLVIIDSPA
FT                   ISADWIGGEYEYDGYVFLSRHGAESGKLALTCHSTGNFAEAQFGGSDREVAIPYPGFQR
FT                   RYMRRLSERREKFNGFDITIEATHHGPTGLDKPSIFVEVGTTEKQWNDKGLCGAVAELV
FT                   RETAEEQDEKTPFVICVGGTHYPEKFTDVLLKGEYALGTVVPKRALVNLDDKMFSHILE
FT                   RNAGAAAVLVDEGGLGPEKRRILNMLEGSGLEVISA"
FT                   /protein_id="YP_875281.1"
FT   gene            289492..289653
FT                   /db_xref="GeneID:6370522"
FT                   /locus_tag="CENSYa_0342"
FT   CDS_pept        289492..289653
FT                   /locus_tag="CENSYa_0342"
FT                   /gene_family="HOG000105970" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575539"
FT                   /db_xref="GeneID:6370522"
FT                   /translation="MTLKNMVNTMKMAKKSDKEDYMQHLRLVLLGIGGVGTIGFIIQFV
FT                   FSVATFGN"
FT                   /protein_id="YP_875282.1"
FT   gene            289715..290110
FT                   /db_xref="GeneID:6370523"
FT                   /locus_tag="CENSYa_0343"
FT   CDS_pept        289715..290110
FT                   /locus_tag="CENSYa_0343"
FT                   /gene_family="HOG000229920" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein L24A"
FT                   /transl_table="11"
FT                   /note="COG0250"
FT                   /db_xref="GI:118575540"
FT                   /db_xref="GeneID:6370523"
FT                   /translation="MVMNILEAKARMNKIDIQSVFVVDNLKGYVVVEANDPNAAYQATD
FT                   GVRHIKGQLRGELDFKDIEGYLVKKSTVTSLEKDQTVEITGGPFKGMKASITRIDHEKE
FT                   EATVVLLDASYQLPVTVDANYLQVSSS"
FT                   /protein_id="YP_875283.1"
FT   gene            290143..290625
FT                   /db_xref="GeneID:6370524"
FT                   /locus_tag="CENSYa_0344"
FT   CDS_pept        290143..290625
FT                   /locus_tag="CENSYa_0344"
FT                   /gene_family="HOG000082124" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein L11"
FT                   /transl_table="11"
FT                   /note="COG0080"
FT                   /db_xref="GI:118575541"
FT                   /db_xref="GeneID:6370524"
FT                   /translation="MGGIQKIAALVTGGQASAGPPLGPAMGPLGVNIMEVIAAINDETK
FT                   DFEGMKVPVTVSVDTDTKKWEVEVGIPSAAALLLKEAGIQKGSGTPGTEWVGDVTMDSV
FT                   AKVARTKLESSYASSVKQVAKVVAGTCVPLGIKIEGKTPREITAEINEGKWDEKFA"
FT                   /protein_id="YP_875284.1"
FT   gene            complement(290622..291101)
FT                   /db_xref="GeneID:6370525"
FT                   /locus_tag="CENSYa_0345"
FT   CDS_pept        complement(290622..291101)
FT                   /locus_tag="CENSYa_0345"
FT                   /gene_family="HOG000115326" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="COG1522"
FT                   /db_xref="GI:118575542"
FT                   /db_xref="GeneID:6370525"
FT                   /translation="MWADQSAMHRFDELDMRLLYELAKDSSVSVPSLSKKLNINSSVLY
FT                   SRIKRLVRKKLIKRFTIVIDDSLLGIDVKASVGINRDPKFKESIHQKLMETPEVASISE
FT                   VTGRFDMMIRVLARNLESLHSVVIDKIGKIEGIQNTETFVELQKTDKDPVYPGGA"
FT                   /protein_id="YP_875285.1"
FT   gene            complement(291169..291993)
FT                   /db_xref="GeneID:6370526"
FT                   /locus_tag="CENSYa_0346"
FT   CDS_pept        complement(291169..291993)
FT                   /locus_tag="CENSYa_0346"
FT                   /gene_family="HOG000245274" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="L-isoaspartate methyltransferase/tRNA
FT                   (1-methyladenosine) methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="COG2519"
FT                   /db_xref="GI:118575543"
FT                   /db_xref="GeneID:6370526"
FT                   /translation="MAGKSDKIKANEHVLFYYNRTKKWLVKITKNAKLHTHIGIISHAD
FT                   AIGKEYGSRLTTNKDKYVYLLRPTTYDYTMKLQHSTQIVYPKESGYMASRMGIQSGQTI
FT                   VEIGTGSGALTTFLASIVKPRGRVHTFDVDADFMAIAEKNIARAGMTKYVIMNKMDIRK
FT                   SRTVPVADADAAVIDLGDPWTALPQVRRMLKGSAPMVAVCPTMNQLEKLVSELVANEFT
FT                   DIECSEQILRQIEAREGKTRHSFQGIGHTAYLCFARKAYFGTKRRRTAKDPD"
FT                   /transl_table="11"
FT                   /protein_id="YP_875286.1"
FT   gene            complement(292037..293860)
FT                   /db_xref="GeneID:6370527"
FT                   /locus_tag="CENSYa_0347"
FT   CDS_pept        complement(292037..293860)
FT                   /locus_tag="CENSYa_0347"
FT                   /gene_family="HOG000247213" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="COG0018"
FT                   /db_xref="GI:118575544"
FT                   /db_xref="GeneID:6370527"
FT                   /translation="MADAMSRCGHKAAEFSVTPSKPGFGDLSCNVPFLLAKSRGRAPFE
FT                   IAQELAVQYKTGGVIAGAEAHPGGYLNFSLDWGIAAKEIVIEAAGGGPAPAGGGPVTVE
FT                   HTSVNPNKALHIGHVRNIVIGDSVARILSREGYKVSVLNYIDDSGLQVADIILGFTELG
FT                   IPEEPPGGKKFDQYCGDDVYAKAAGACEEDPGLKEKRAVILRGLEDGTSETAHLADRIT
FT                   RRVLDGQLETCWGLGVQYDCLNFESQIVRSGLWDEVFERLKKMGLLELEKDGKNAGCWV
FT                   FRSGTDDKVVVRSDGTATYIAKDIPYAAWKLGLLDDPFRYVKHHREQPGGKELWETTLS
FT                   GGEMRAGPAGGRVVTVIDTRQSRLQQIIASLMGRFKSDEGAYVHLGYESVSLSPGTAAA
FT                   LGADTGGKSAQMSGRRGLYVNADTVLGVLAEKARAETSRRNPEMDKVELGRISADIASA
FT                   TIRYEMARQDLNRAITFDMEKSLSLEGDTASYIQYSHARAARVMEKAGAEPDYNAEYAL
FT                   LEDPRERALLREIGMFGIHLGDAAGSLSPKIIARYCHGLAVAFNGFYEHVRVIDAGNPA
FT                   LSNARLCLVRAFMHAVSGALYLIGISAPDRM"
FT                   /transl_table="11"
FT                   /protein_id="YP_875287.1"
FT   gene            complement(293881..294684)
FT                   /db_xref="GeneID:6370528"
FT                   /locus_tag="CENSYa_0348"
FT   CDS_pept        complement(293881..294684)
FT                   /locus_tag="CENSYa_0348"
FT                   /gene_family="HOG000184780" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hydrolase of the HAD superfamily"
FT                   /transl_table="11"
FT                   /note="COG0561"
FT                   /db_xref="GI:118575545"
FT                   /db_xref="GeneID:6370528"
FT                   /translation="MCMIPTEVILSFVARPACEAIIMPDPGPAAMEHATFAVDIDGTLT
FT                   EDGGGGRIHLGALSALRHLATSGHNVILVTGRSSVEAYMLAVYGGITRLAVGENGGCIT
FT                   TGPSEHLLLGDMDVCERAFEVIGPEFGAVRKGTFPRMTEIVLESTFDVGAAREFAKKRG
FT                   LGIGLADSGYAVHLNPEGIDKESGLRKALDMLGARGKVIAIGDSETDVPMFRTADTSIA
FT                   LGNAPPGVRSAATIRTRAEAGDGVVEALDLLAPMMARSGEWDTGR"
FT                   /protein_id="YP_875288.1"
FT   gene            294723..295793
FT                   /db_xref="GeneID:6370529"
FT                   /locus_tag="CENSYa_0349"
FT   CDS_pept        294723..295793
FT                   /locus_tag="CENSYa_0349"
FT                   /gene_family="HOG000112078" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="GTPase"
FT                   /transl_table="11"
FT                   /note="COG1163"
FT                   /db_xref="GI:118575546"
FT                   /db_xref="GeneID:6370529"
FT                   /translation="MSRTQINKATEHHIGLLKAKIAKLRREQEDDQTKKSSAKSDGFDV
FT                   RRAGDATVVFIGMPSVGKSTLLNRLTGANSAVGAFQFTTLTVVPGMMEYKGARIQILDL
FT                   PGIIKGASGGKGLGKRILSVARSADLVLLVLDVFQPYHEDVLINELGNMGIRLNQDPPN
FT                   IVIEKTSTGGIAVAQQKRLTKTSEAFLRDILHLYGYTSARVVIREDVGSEQLVDYISGN
FT                   KTYARALTVVNKIDLVDASALEGLAKGLGPGAIRVSADSNENMDMLKERIYQELAFIRI
FT                   YMRPKGGPTDYEEPLIMRKNATVGAVCDKLHRRMRGDFRYALVWGSSVKFGGQRVGISH
FT                   TLYDEDVLTIVKARGS"
FT                   /protein_id="YP_875289.1"
FT   gene            295920..296288
FT                   /db_xref="GeneID:6370530"
FT                   /locus_tag="CENSYa_0350"
FT   CDS_pept        295920..296288
FT                   /locus_tag="CENSYa_0350"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575547"
FT                   /db_xref="GeneID:6370530"
FT                   /translation="MKRKAVKKTATRRKAPGRKPGPKKGSTKRRKSPGRKPAGRKPAGR
FT                   KPAAKKGAKRRKSPGRKPAGRKPAGRKPAAKKGAKRRKSPGRKPAGRKPAGRKPAAKKG
FT                   VKRRKTTKKTAAKRKVRR"
FT                   /protein_id="YP_875290.1"
FT   gene            complement(296305..296469)
FT                   /db_xref="GeneID:6370531"
FT                   /locus_tag="CENSYa_0351"
FT   CDS_pept        complement(296305..296469)
FT                   /locus_tag="CENSYa_0351"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575548"
FT                   /db_xref="GeneID:6370531"
FT                   /translation="MQQLQNMALCACNPGRTGCIAQAPHGQKLEGKTFPELNKTELKRQ
FT                   TAAGQAGGC"
FT                   /protein_id="YP_875291.1"
FT   gene            complement(296630..298036)
FT                   /db_xref="GeneID:6370532"
FT                   /locus_tag="CENSYa_0352"
FT   CDS_pept        complement(296630..298036)
FT                   /locus_tag="CENSYa_0352"
FT                   /gene_family="HOG000105981" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="collagen type XI alpha 2"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575549"
FT                   /db_xref="GeneID:6370532"
FT                   /translation="MSDSGSKLRVRGSAPFSQSGVFEVTIAITESRPPEEAIISRDFAA
FT                   LWRGDYHLRVDGGTFSEVLGTDANPLPPTVFARASVCIVVMDHFSSLHSAFDVALSSTP
FT                   PGAAQPRYEQSAPRQEQPPAEPPASSRGEKGPAGQPGERGDKGPAGAPGEHGDKGPIGP
FT                   PGERGIPGSPGPQGDKGPAGDKGITGDMGDRGDKGPAGEPGETGPDGPAGDKGDRGPLG
FT                   PQGLPGERGDAGPHGPPGDKGPTGERGPTGTKGETGPPGTPGDKGLQGPAGPEGGKGPA
FT                   GVEGGKGPAGPPGPQGNTGPEGTGGPQGDKGPQGPQGEPGDKGLTGVPGPQGDKGDKGA
FT                   IGPQGDKGMNGPLGPHGDKGPQGPQGPQGERGMQGPPGDKGPQGIQGPQGERGPLGPAG
FT                   PLGEPGPRGEPGPLGPVGPRGPPGPPGDKGSAGGLSEQQKALFKEMLEILRSKDIVTTE
FT                   EEIRLMSYLY"
FT                   /protein_id="YP_875292.1"
FT   gene            complement(298139..298399)
FT                   /db_xref="GeneID:6370533"
FT                   /locus_tag="CENSYa_0353"
FT   CDS_pept        complement(298139..298399)
FT                   /locus_tag="CENSYa_0353"
FT                   /gene_family="HOG000033801" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575550"
FT                   /db_xref="GeneID:6370533"
FT                   /translation="MPEFEILVTIGNKPGISDPEGDTILKDLVLRGGYKTVSRIRTAKT
FT                   LKFTITEETKEEAIEAVKKACDGLRIYNPLVSAATIRVSGA"
FT                   /protein_id="YP_875293.1"
FT   gene            complement(298378..298767)
FT                   /db_xref="GeneID:6370534"
FT                   /locus_tag="CENSYa_0354"
FT   CDS_pept        complement(298378..298767)
FT                   /locus_tag="CENSYa_0354"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575551"
FT                   /db_xref="GeneID:6370534"
FT                   /translation="MPVGALFRGDPARHTGLSGVRLAAASYKSEGSIKEKDHVSVQQGA
FT                   RSGMYPTRSTNARHEDTYACHKGGAGARTVTTHGASLEVTSWADRTRADPQEYKHAQVQ
FT                   YALHPRNHGLITPGTAPGSCQSSRY"
FT                   /protein_id="YP_875294.1"
FT   gene            complement(298806..299471)
FT                   /db_xref="GeneID:6370535"
FT                   /locus_tag="CENSYa_0355"
FT   CDS_pept        complement(298806..299471)
FT                   /locus_tag="CENSYa_0355"
FT                   /gene_family="HOG000105992" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575552"
FT                   /db_xref="GeneID:6370535"
FT                   /translation="MISKTTKKTTYKATAIGFAAFFALMMTPSGAFSTSTDSAITAYGM
FT                   AEVVQRNGDGEILSSSVVHNRLLDAGEEFTLNAIFRTTGTGPTDANRIDQVCISSTDGE
FT                   TVLPTVNGVGTDPLDDALTTSDFTLVTPVGAFNACAQSAAAITLAGDGTAVIGPLTFTT
FT                   GEQITVGQTVDTVLVCYGDDVDGACTTAFAAVDVTDVSPTGTDTVDVTYTFDLSSSMT"
FT                   /protein_id="YP_875295.1"
FT   gene            299772..301424
FT                   /db_xref="GeneID:6370536"
FT                   /locus_tag="CENSYa_0356"
FT   CDS_pept        299772..301424
FT                   /locus_tag="CENSYa_0356"
FT                   /gene_family="HOG000106003" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transposase"
FT                   /transl_table="11"
FT                   /note="COG3436"
FT                   /db_xref="GI:118575553"
FT                   /db_xref="GeneID:6370536"
FT                   /translation="MTSDITLLRRELLRAAEREKGYEATIQENGRRTAKLEAAVAGLTA
FT                   DLATSRESSRDADRRLQEADEKFQKIEKRNQELEEEIRRLKGKPAGGASKPKACPPGDP
FT                   CDVEDQELLRRLEKGRYRDGRRAAGLVQRLRGCIAILTAENKESSTRNAKLERFKRQRA
FT                   GPHMPSSAEQFKGNTQSDDRKKPGRGPGHIGKSSTVKCNETERHRCNKCKSCGGRHLKH
FT                   KGQSCSKETDVEVITKVKTINHITETHECMDCGVLNTPKTPIIPGTSFGVSILAILFNL
FT                   WQKGTTIDGMTDHIREEYGLEYCGATVQNAMAALGKFLEPLQQEIIRAIQDTGWCNGDE
FT                   TGYRKNGEDIWAWLFCNNRFTLVLMDKGRSMQIPALLFPRGVRIICDGLGSYKIFPTMQ
FT                   RCWAHILRDAKDAAQDAASQELHRRLQQVFADAKAARKAEVCGIEAEFVVQELSARTRG
FT                   LAKAYMDICPAFGKKLANAEPNLFTFLYYHDMPPTNNAAERAIKAIIRQRRCREQLKTA
FT                   GGMMMFGVLMTCLLTWKQQEISIRDGILAQIQA"
FT                   /protein_id="YP_875296.1"
FT   gene            301484..302593
FT                   /db_xref="GeneID:6370537"
FT                   /locus_tag="CENSYa_0357"
FT   CDS_pept        301484..302593
FT                   /locus_tag="CENSYa_0357"
FT                   /gene_family="HOG000106014" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="TPR repeat protein"
FT                   /transl_table="11"
FT                   /note="COG0457"
FT                   /db_xref="GI:118575554"
FT                   /db_xref="GeneID:6370537"
FT                   /translation="MKEAGESRPARAPPRPKKAGTDLTDSDYQRRKLHKKGVNLMADEK
FT                   LDDAAEAFEQALRYDPENVDTLIKLGYAKFHLDDYTDALKVYDRILDIDVTNAETWNLK
FT                   SLIHYEQKNYAKALDCVEKAIDSDPTYGMAWYNKGCYLSLLMQIPEAIESLKRSIEIDV
FT                   KNARKSVKDRDFANVRAEDGFRRIVEVVVIESVRQGYHTIGAIVWTTFLSKADTEDALL
FT                   KLLEKGLIVKGEKKEGLQRIPIYDLSPDIASRVGTEKRSLLGLRRKKLPAPVRNLKELG
FT                   QTIQEIKAAIEDEDVDALIRSFDDLIDPKKFGEHMIGQFLEEHREIRLWKIRLKDHGVG
FT                   FLQDNKKKMSAVFDNIETAVTKQLRSEIA"
FT                   /protein_id="YP_875297.1"
FT   gene            complement(302735..304540)
FT                   /db_xref="GeneID:6370538"
FT                   /locus_tag="CENSYa_0358"
FT   CDS_pept        complement(302735..304540)
FT                   /locus_tag="CENSYa_0358"
FT                   /gene_family="HOG000263628" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ferredoxin-sulfite/nitrite reductase"
FT                   /EC_number="1.7.7.1"
FT                   /note="COG0155"
FT                   /db_xref="GI:118575555"
FT                   /db_xref="GeneID:6370538"
FT                   /translation="MESRLKQALPPDPVPRAGWADNEEADNFAKTVKLFRQGWYDADSF
FT                   RRFRLQNGAYGSRMTGDYAMVRIKVPAGEILPQQLEKIAYLSETYSIGSAHFSTRENVQ
FT                   LHWVVLEDVSEIMRGLAEVGMTSREACGNSVRNVMCSPLSGVCGAEAFDATPYALATAS
FT                   FFLRNPMCQNLPRKFKFNFTCCEEHGMVRMVDVGLVPQTRELKGAVQRGFKVFLGGGLG
FT                   NRSFVGHQLEEFTPDEDLLYTSMAVLRIFDRLGDRKNLARNRMRYLVNEMGWEKFQNLV
FT                   LKERAIVRSTQPVITRLEMDDAPPGIRTPMRITDEAPAAVPSGFARWSRTNTMAQKQDG
FT                   YQTVFITLEAGDITAGQLRSLAAICREYSGEGRARTGFRQNVVIRYVKEEDLPAIYSRL
FT                   TESGLAKSGALTMSTPVGCSGTTSCNLALTNSHRLAKEIQRKFLEMGLDEDADLADSSI
FT                   KISGCPNSCGQHGIATIGFYGGGSRAGGNMYPVYQMSVGGRFDGQTVLGTNCMRIPAKR
FT                   VIPAILRIIELFRDNKQPSDTLKSWIHRLVLGNGDGAVDTLDALKAELAPLTVAPAIED
FT                   DPDFYKDYGNEGGYHAKTGKGECAA"
FT                   /transl_table="11"
FT                   /protein_id="YP_875298.1"
FT   gene            complement(304731..305525)
FT                   /db_xref="GeneID:6370539"
FT                   /locus_tag="CENSYa_0359"
FT   CDS_pept        complement(304731..305525)
FT                   /locus_tag="CENSYa_0359"
FT                   /gene_family="HOG000106025" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="rhodanese-related sulfurtransferase"
FT                   /EC_number="2.8.1.1"
FT                   /note="COG2897"
FT                   /db_xref="GI:118575556"
FT                   /db_xref="GeneID:6370539"
FT                   /translation="MSRGRRITVDADRLSSEIRDGSIRVVDVRKAADYNKGHLPSAVNL
FT                   PLSELLLDDSPERMGKLFGSMGIGDEMPVAVYDDTFGALASRVAWALEYIGHGDVSLLD
FT                   VTYSGWTGIGLDTEQAAPEVRSAKHAVDPRDSILATLEQTEKAVEDGAVLIDNRERLNY
FT                   LEQHIPGSVNIPYRTLGSPDKIIRPSGELTRLLDNRDIPHGKEAITYCGSVGTLSGLAY
FT                   YALKSAGMEDVRLYVRSFKEWKALSKPTSKQEEANYWDLSAE"
FT                   /transl_table="11"
FT                   /protein_id="YP_875299.1"
FT   gene            complement(305522..307153)
FT                   /db_xref="GeneID:6370540"
FT                   /locus_tag="CENSYa_0360"
FT   CDS_pept        complement(305522..307153)
FT                   /locus_tag="CENSYa_0360"
FT                   /gene_family="HOG000263628" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ferredoxin-sulfite/nitrite reductase"
FT                   /EC_number="1.7.7.1"
FT                   /note="COG0155"
FT                   /db_xref="GI:118575557"
FT                   /db_xref="GeneID:6370540"
FT                   /translation="MTNDYSMIRVKVPAGEILPQQLEKIAYLSETYSIGSAHFSTRENV
FT                   QLHWVVLEDISEIMRGLAEVGMTSREACGNTVRNVMCAPLAGVCRDEAFDATPYAQATG
FT                   TFFLRNPMCQNLPRKFKFNFTCCEDHGMVRMVDVGLVPQTREINGVMQRGFMIFLGGGQ
FT                   GNKAFLGHQLEGFTPDEDLLYTALAVLSVFDRLGDRKKMARNRLRYLVSEMGWEKFRNL
FT                   VLKERALARSNQSVLTQLDTDGTPRGIRTPMRIADEAPAAVPSGFARWSHTNTIPQKQD
FT                   GYRSVFITLEAGDITAAQLRSVAALCRDYSGECKARTGFHQNVVIRYVKEDDLPAMYSR
FT                   LLEAGLAKTGALTMATTVGCSGTTSCNLALTNSHRLAKEVQRKLLELGIDEDPDFSNSS
FT                   IKISGCPNSCGLHWMATLGFYGGGSRAGSSMYPVYQMLVGGRFDGHSSLGIPILRIPAK
FT                   RVIPAILKVIELFREHKKPSDTLKSWLHRLVSGNGDGTIDTLDALKEELSPLTVAPSIE
FT                   VDPDFYKDYGNEDNYHTKTGRGECAS"
FT                   /transl_table="11"
FT                   /protein_id="YP_875300.1"
FT   gene            307557..308369
FT                   /db_xref="GeneID:6370541"
FT                   /locus_tag="CENSYa_0361"
FT   CDS_pept        307557..308369
FT                   /locus_tag="CENSYa_0361"
FT                   /gene_family="HOG000106048" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thiazole biosynthetic protein"
FT                   /transl_table="11"
FT                   /note="COG1635"
FT                   /db_xref="GI:118575558"
FT                   /db_xref="GeneID:6370541"
FT                   /translation="MQASDTERPRIFKDVSEAQITRAIATEFNSVLLDAAESDVIIIGA
FT                   GPAGLTASRELSGMGFRVLVIEQNNYLGGGYWLGGYMMNPVTVREPAQKIWDELGISYK
FT                   QAADGLYITPGPNAVSKLIAGACDAGVKFLNLTKFDDLVLKNGRVAGVVVNWMPVSALP
FT                   RNITCVDPIALEAKMVIDSSGHDSVAVKRLVDRGLVQWKGMDPMHVNAGEDDVVHMTGE
FT                   VFPGLVAAGMSVTETHGLARMGPTFGSMLFSGKKAAEVTATKIKELQG"
FT                   /protein_id="YP_875301.1"
FT   gene            308437..309147
FT                   /db_xref="GeneID:6370542"
FT                   /locus_tag="CENSYa_0362"
FT   CDS_pept        308437..309147
FT                   /locus_tag="CENSYa_0362"
FT                   /gene_family="HOG000106049" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575559"
FT                   /db_xref="GeneID:6370542"
FT                   /translation="MEGLQKFLEGMGFSAGIQNSAFDNMDRRVAAELAASRVFRPLRPF
FT                   ERHDPTVSEIEHELDRAPAGPGNIVYYDGFEAQRIIAGLVPDDRCLHIVFTDRLMCTYD
FT                   PGDYRYHGRALIGANPSVISTTGMVEAPAKPRSYYTELISGMDIGMNMEVVNRRYSGQY
FT                   LAYHDRRTSLVAQGYVLQAIFYYMTGEAFCDTKECRLHNAHWQSDLLYSQIERGLLCPR
FT                   HQGMLDSRRLDARG"
FT                   /protein_id="YP_875302.1"
FT   gene            309204..310175
FT                   /db_xref="GeneID:6370543"
FT                   /locus_tag="CENSYa_0363"
FT   CDS_pept        309204..310175
FT                   /locus_tag="CENSYa_0363"
FT                   /gene_family="HOG000072912" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thioredoxin reductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="COG0492"
FT                   /db_xref="GI:118575560"
FT                   /db_xref="GeneID:6370543"
FT                   /translation="MAAEPEGGVLVEKGPPKEPRKKTKYDVIIIGAGPAGYTAGIYCSR
FT                   ARRDTLILSGILPGGQLVNTTDVENFPGFENGIMGPDLMINFRKQAERMGTTIVDDEVV
FT                   NVDFRHRPFKVLTSEEEYEAKAVIVGTGATPRKLGVEGEKAFAGKGVSYCATCDGPFFK
FT                   NMELVVVGGGDSAMEEATFLTKFATTVHVVHRRKELRASKIMQERAHDDEKIRFHLGYE
FT                   VKEIRGNGKVQQVVLASPDGEEQMDTGGVFVAIGHDPNTELFKGQLETDDQGYIVLKGA
FT                   SQTSVPGVFAAGDVHDRRYRQAITAAGFGCMAGIDVNNYLDE"
FT                   /transl_table="11"
FT                   /protein_id="YP_875303.1"
FT   gene            complement(310177..310398)
FT                   /db_xref="GeneID:6370544"
FT                   /locus_tag="CENSYa_0364"
FT   CDS_pept        complement(310177..310398)
FT                   /locus_tag="CENSYa_0364"
FT                   /gene_family="HOG000259290" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="redox protein, regulator of disulfide bond
FT                   formation"
FT                   /transl_table="11"
FT                   /note="COG0425"
FT                   /db_xref="GI:118575561"
FT                   /db_xref="GeneID:6370544"
FT                   /translation="MPEIDATGLFCPEPVFRTKIEMERMQVGDVLTIKADDPAAEEDIS
FT                   RWATRNGHDLVEVKKDGQVISITIKKVR"
FT                   /protein_id="YP_875304.1"
FT   gene            complement(310446..311363)
FT                   /db_xref="GeneID:6370545"
FT                   /locus_tag="CENSYa_0365"
FT   CDS_pept        complement(310446..311363)
FT                   /locus_tag="CENSYa_0365"
FT                   /gene_family="HOG000106060" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="metal-dependent phosphoesterase"
FT                   /transl_table="11"
FT                   /note="COG0613"
FT                   /db_xref="GI:118575562"
FT                   /db_xref="GeneID:6370545"
FT                   /translation="MDQINSEMHCHNSFSNFHQAAHDTPYDSSVGIAEQLDRSLHLGLD
FT                   ALFVTNHNTLSGYEEMVRYQADHDKYARIRILPAEEITTDEGAHVIAYGIHEEIRPGMS
FT                   LEETIDEIRRQDGVSSAPHPFGLLDALREKAGRCDLVEVFNSNNIDVIANARAAEFAHE
FT                   RGITGVAGSDSHVISTLGRCTNVIEAEDSLDGILDALRHGRVSIRATGYASARETMEYF
FT                   RYKVDNSAEYIRDYVGEFYPRSRWIFSVLLGLFNRSPESYLWVLMLRLGMLSMRRISKK
FT                   VNFEGLDPGIMKRRSLPEMLRASL"
FT                   /protein_id="YP_875305.1"
FT   gene            complement(311444..311998)
FT                   /db_xref="GeneID:6370546"
FT                   /locus_tag="CENSYa_0366"
FT   CDS_pept        complement(311444..311998)
FT                   /locus_tag="CENSYa_0366"
FT                   /gene_family="HOG000223628" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG1478"
FT                   /db_xref="GI:118575563"
FT                   /db_xref="GeneID:6370546"
FT                   /translation="MLSTGIASAYDRDPRLIEVILSQTKRIVRMRDGILIVETKGGITC
FT                   ANAGVDESNIQEGHAALLPKDPDGSAGRIRREILEKAGRQVAVIISDTFGRPFRMGQTD
FT                   CAIGVSGMGPITDYIGTKDTFGRELRVTEMAVADELCGAAEIVMGKASRIPAAVIRNHS
FT                   VSPGEGSANDLLRPRGEDLFR"
FT                   /protein_id="YP_875306.1"
FT   gene            complement(312186..312836)
FT                   /db_xref="GeneID:6370547"
FT                   /locus_tag="CENSYa_0367"
FT   CDS_pept        complement(312186..312836)
FT                   /locus_tag="CENSYa_0367"
FT                   /gene_family="HOG000231114" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphoserine phosphatase"
FT                   /EC_number="3.1.3.3"
FT                   /note="COG0560"
FT                   /db_xref="GI:118575564"
FT                   /db_xref="GeneID:6370547"
FT                   /translation="MLVIFDVEGVLFDAEYLPILAEKLNKEDEIWEITRKGIRGAIDWE
FT                   EGLRTRVEALRGIDYETCKEVADALPIMTGAREACSALKEAGWKIMAVSGGFTIMTDRL
FT                   KEVLGLDHVYANELVFRNGVLDGVKINVNSDKSRSAMTKIKEWDQRREEIVVAVDGAND
FT                   LKLFDICGLGIAFRAQDVVKDRADAVLEEKDLSKMLDIINRHYGIALEIPARA"
FT                   /transl_table="11"
FT                   /protein_id="YP_875307.1"
FT   gene            313058..313372
FT                   /db_xref="GeneID:6370548"
FT                   /locus_tag="CENSYa_0368"
FT   CDS_pept        313058..313372
FT                   /locus_tag="CENSYa_0368"
FT                   /gene_family="HOG000106071" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575565"
FT                   /db_xref="GeneID:6370548"
FT                   /translation="MSDGDTSGELEHKYEVEIKTAEKVQRMTEDVKAELKASGMMDAKG
FT                   KLKLKGVSAKMLKRMKQEYVDCPVLGDGIQFIQCFACPNFQSRVQGKVLCKGHDLPPKT
FT                   "
FT                   /protein_id="YP_875308.1"
FT   gene            313409..314839
FT                   /db_xref="GeneID:6370549"
FT                   /locus_tag="CENSYa_0369"
FT   CDS_pept        313409..314839
FT                   /locus_tag="CENSYa_0369"
FT                   /gene_family="HOG000167538" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="COG0442"
FT                   /db_xref="GI:118575566"
FT                   /db_xref="GeneID:6370549"
FT                   /translation="MKVGITASKSDDFSEWYTQVVLKAELADYAPVKGLIVLRPDGYSI
FT                   WESIRTSLDVKLAARGVRNGFLPVLIPESLLGKEKEHFAGFNPEVFWVTHSGENKVGDR
FT                   LALRPTSETLAYSLYSKWIKSWRDLPLRINFWNTALRAEIKSTKPFLRTSEFLWQEGHT
FT                   VHACSEEAESEVAAILELYRETVEGDLAIPVITGRKSEKEKFVGAVYTTTMESMMPDGR
FT                   ALQMGTSHFLGQNFSRPFEVKFADKDNVEHFAWQTSWGLSWRLIGAMIMVHGDDKGLVL
FT                   PPKVAPLQVVIIPISYSGEEGAQVLAAAEGMEAELLKAGIRARTDKREELTPGFKFHDW
FT                   EMRGVPVRIEIGPRDLKDGSAVLATRHDGKKSKVPLDGAAVNIEEELCRVQTEMLGAAK
FT                   RALDGMIHDASSYGALTKAVEGGGFVRAAWCGGLECEEKVKEETGADIRVVPEGGAEGA
FT                   CIVCGGRAASIPLFARGY"
FT                   /transl_table="11"
FT                   /protein_id="YP_875309.1"
FT   gene            complement(314843..315478)
FT                   /db_xref="GeneID:6370550"
FT                   /locus_tag="CENSYa_0370"
FT   CDS_pept        complement(314843..315478)
FT                   /locus_tag="CENSYa_0370"
FT                   /gene_family="HOG000105992" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575567"
FT                   /db_xref="GeneID:6370550"
FT                   /translation="MNPAAKMGIYGASVGLAAVLALTLAVPAGHSSHGPVAYGMAEAIH
FT                   MDAGGSVLMSQTVHNLVVDQGEEQLIDRLFKTAETRIEAIHRINILCLTDSTVPVTDSV
FT                   TAASMDPATGFALRNGACAVFGEVEDDETDDRSLAVMGPVNFTAGSNFNENRTVTALLV
FT                   CPNPDDDEGSCRFSANYIFAAVPLGNLTFSENDTLQVTYTFDVSSDNN"
FT                   /protein_id="YP_875310.1"
FT   gene            315657..316961
FT                   /db_xref="GeneID:6370551"
FT                   /locus_tag="CENSYa_0371"
FT   CDS_pept        315657..316961
FT                   /locus_tag="CENSYa_0371"
FT                   /gene_family="HOG000253478" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG1262"
FT                   /db_xref="GI:118575568"
FT                   /db_xref="GeneID:6370551"
FT                   /translation="MTAVARESALIDQFDATRERTLELVRTLERDDFVVQTAPYMSPPK
FT                   WHLGHVSWIYEAIMSKISPGYEFYSGDLAGYLNSYYQQFGSPMDKGRRGVVSRPTLEQI
FT                   FDYFEETNRRVRGFIEGGLSPDNSRMITMGTHHECQHQELLIYDLQHLLASEYRPARRG
FT                   TEPKPAGETGGTVRVKGGLYTLGYGGGGFCYDVELPEHRVYLEDYTIGAYPVTNGEYLL
FT                   FMEDGGYGSYRHWLSDGWDRVKENGWNSPMYWEKEGDEWYTNGLAGRRKINPKEPVCHV
FT                   SFYEADAYCRWAGKRLPTEAEWEKAALWNEEEQTKSVFPWGDGAPSEDRANLYESGLWK
FT                   CTEAGSYPEGASPSGCHQMVGDAWEWTSSEFVGYPGFRSGFDEYNDKWFTGQKVLRGGS
FT                   YATPSMAIRGTYRNFFRLDERWMFCGFRCAGDAPA"
FT                   /protein_id="YP_875311.1"
FT   gene            complement(316933..317973)
FT                   /db_xref="GeneID:6370552"
FT                   /locus_tag="CENSYa_0372"
FT   CDS_pept        complement(316933..317973)
FT                   /locus_tag="CENSYa_0372"
FT                   /gene_family="HOG000253490" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG4301"
FT                   /db_xref="GI:118575569"
FT                   /db_xref="GeneID:6370552"
FT                   /translation="MSSQTAQELGYEIHRLSPRLHCLRPHAAVSGESFARDVAFTLGGS
FT                   SKSINPKWFYDDEGSALFGQICTVPEYYITVTESSILSRIGGELGSFLARDTRLVELGS
FT                   GLSSKTRLILDVMEGVQDEMEYLPIDISDVLAESCHGLLDDYPRLEITGIIDTYHGGLE
FT                   FLSTLDERPNLIAFLGSSLGNFDAGEGELFLKKIASCMGERDMLLLGLDLDKESGVLEA
FT                   AYDDTQGVTARFNLNVLTRMNRELGANFDLSAFAHRAKYNGSARRIEMYIESLADQDVA
FT                   IPAAGAAVRFGRGELVHTENSHKYTIPRIREMVREAGLGTDAIWQDEENRYALVLCSKQ
FT                   GRPRRT"
FT                   /protein_id="YP_875312.1"
FT   gene            complement(318085..318300)
FT                   /db_xref="GeneID:6370553"
FT                   /locus_tag="CENSYa_0373"
FT   CDS_pept        complement(318085..318300)
FT                   /locus_tag="CENSYa_0373"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575570"
FT                   /db_xref="GeneID:6370553"
FT                   /translation="MRINAHSNLKTLSSSCYAYRLRIHGRAAWNRILSDCTACTHEPLP
FT                   RRGESAVSGAKNKGCPGYEMTSPEHR"
FT                   /protein_id="YP_875313.1"
FT   gene            318299..318613
FT                   /db_xref="GeneID:6370554"
FT                   /locus_tag="CENSYa_0374"
FT   CDS_pept        318299..318613
FT                   /locus_tag="CENSYa_0374"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575571"
FT                   /db_xref="GeneID:6370554"
FT                   /translation="MEQSVEEKVKELSDEEVKNLYEGAMQKIGQLAMSRDESAGNPSSE
FT                   DYEKKLGQMTLSRYESAKKLDEIISLLQILLGEIHAQKSQERSHSRKHGNKICITTNRP
FT                   "
FT                   /protein_id="YP_875314.1"
FT   gene            318620..319546
FT                   /db_xref="GeneID:6370555"
FT                   /locus_tag="CENSYa_0375"
FT   CDS_pept        318620..319546
FT                   /locus_tag="CENSYa_0375"
FT                   /gene_family="HOG000106082" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="periplasmic serine protease (ClpP class)"
FT                   /transl_table="11"
FT                   /note="COG0616"
FT                   /db_xref="GI:118575572"
FT                   /db_xref="GeneID:6370555"
FT                   /translation="MPPWSDILKEIHDLENVTIESASDRIIQKYLELLQRHTKRDTILY
FT                   TSSWTRPTRTNDVVSITEDDLDGFMEVVYGLKAKELDLVLHSPGGSPEAAEAIVLYLHE
FT                   IFEDIRVIIPHAAMSAATMISCASNYIVMGKHSFLGPTDPQMFLYTAHGWTNMAAQYIL
FT                   DDFDEAQEISRDDPGKLVAWNPLLSQYTPGFIHECRSAKELTKELVREWSKTYMFAGKP
FT                   DKLARATRISENLTSDDIFKSHARHIPRKKCEEMGLEIIHLEDDEILQDLSLSVFHAAN
FT                   IFFQHSTATKIIKNHNDRTVLSFPPEE"
FT                   /protein_id="YP_875315.1"
FT   gene            319621..320463
FT                   /db_xref="GeneID:6370556"
FT                   /locus_tag="CENSYa_0376"
FT   CDS_pept        319621..320463
FT                   /locus_tag="CENSYa_0376"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575573"
FT                   /db_xref="GeneID:6370556"
FT                   /translation="MLQFGNAISTSLGNGRAPKHSSDCRRPLARTMWTDAPTLPGCYCP
FT                   IPRACSVVAANCLPGAFTRGICPKPCLPHQNQIHKEKNPQNPRYSMDSTDIVDTVNELL
FT                   KLGVGDQYRLEHIKLSYMESKTLWDSDKRYLERMKEKYLTVHKTEEIADPALATPVVED
FT                   DREVIHCWKCGKKNLLSANYCMKCGIALFDVGTKGAPRPHGEAPASRSRFPRWAKILVI
FT                   VVAALFVLAAVSLAFSYGYFDGTDDAPRAPAPRQDGAASKCGAGTVFDAPTNSCVLER"
FT                   /protein_id="YP_875316.1"
FT   gene            complement(320465..321421)
FT                   /db_xref="GeneID:6370557"
FT                   /locus_tag="CENSYa_0377"
FT   CDS_pept        complement(320465..321421)
FT                   /locus_tag="CENSYa_0377"
FT                   /codon_start="1"
FT                   /product="ABC-type oligopeptide transport system, ATPase
FT                   component"
FT                   /transl_table="11"
FT                   /note="COG1124"
FT                   /db_xref="GI:118575574"
FT                   /db_xref="GeneID:6370557"
FT                   /translation="MDEILRAEGISRIFEDGGLLGPKRIVRAVDDVSFSVYKGEVFVLA
FT                   GESGSGKSTLANLILNPAEADSGKVFFGGRAVDGASDLKKVRMSCQMVHQDPYDSVNPG
FT                   MKVADIVAEPLEIHGEGDKSYRKKRVLEALSEVRLEPPAEIAAKHPHMLSGGQRQRVAL
FT                   ARALALKPGIIIADEPVSMLDVSIRAEMLELMSGLRKSHGITFLYITHDLATARHFGDR
FT                   IAVMYSGKIVEEGPVDTVLLRPAHPYTQALIDAISEPDPGNLHREKIIRINDPPNDLRG
FT                   GCSFRSRCPYAIDRCAEEPELEDAGGGRRVACFARLE"
FT                   /protein_id="YP_875317.1"
FT   gene            complement(321467..324994)
FT                   /db_xref="GeneID:6370558"
FT                   /locus_tag="CENSYa_0378"
FT   CDS_pept        complement(321467..324994)
FT                   /locus_tag="CENSYa_0378"
FT                   /gene_family="HOG000106093" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="chromosome segregation ATPase"
FT                   /transl_table="11"
FT                   /note="COG1196"
FT                   /db_xref="GI:118575575"
FT                   /db_xref="GeneID:6370558"
FT                   /translation="MVHIRKVEIFGFKSFGFRNTSVEFRPGLVSISGPNGSGKSNILDA
FT                   IIFALGENRPKAMRVGRLSGLMHDIEGSRRGPKMTRASVHFDNSDRRIPVDSDTVEVTR
FT                   EMAPQGESVYYLNKKKSPRGAILDLLDMAGAGLSQLNVVQQGTVTRISEFSPEEKREAI
FT                   ENLIGLSYFDEKKAESVKQLSDADQRLAIALAKMGEIKKRIDELEVERNHKLRHDMIEE
FT                   ELGRLRAVSAADKLRHLGSQKVEKSAELAEVSASAAAQRSELDGIREELKSAEGEKAAY
FT                   MESVEGHGREKAAFEGELGSALRSSEEHRSGILTAERRVERINARIPEIDGEAQELRGR
FT                   LESARSAAAAAAAELAAAGESRQRAEAGVSGVNTERDAALSRQSEAAKKRSAADAQMRE
FT                   VKDRLGEARLETAQARARLDDAKSKEESNSSKRGEYARDCSALRALQGELAAAVEERRA
FT                   SADSLRGKLEGLEAKKIRTGSEVEELGFLLEKSGRAAGQYDAKLRLVRGMMHEEYSAAK
FT                   LRESARELGILGQVYELISWDEKDERAVMAAGSDWIKATVVEDLATLAGLAGHMRERGL
FT                   PKLRIIPLEALPRLRPAPPEIEGAAGLLSDRIKCGRRYSALKEFLFGNVVVADSVESAH
FT                   RISRAGYRSVTLGGEYYEAGTAAAVIDISSRISKLARVISMSSSVEGLVSAVSMLKGHV
FT                   EKRRGLLKRAEGEILACRDELQSAETGLAATEGEHRELGEQAARKERVRDQMAERIAEL
FT                   SSERGRLEEEINVHETLTASLVAELEQAASAEPGADPDAMAAGIDALNAKRSELERLQA
FT                   EAVSAFGRASESKAGADAAASGTESALRVLDTEKSGITAEAGELAAKAAISKEQLAISE
FT                   EQLVKLRGREQEFIEASAESVGRMKEYDGRLSALNARDREVSAGAAKAERRRDALERDL
FT                   SSIEEGMKETQTVLDMFGFGGDLEYFDVGPMLRGLEAEQRSLQQLNARAPEVYADVTDG
FT                   YRSMSSRKNSLEGERNRIVGFIEGIEREKKQTFLDAFDKVDREIKNAFSKMTGGSAWLE
FT                   LQNEDDIFSSGISYMIQFQNKPKRESTSISGGEKTLAAVVFVLALQKLKPSPFYLFDEV
FT                   DAHLDAPNSEKLAKILEERARESQFIMVSLKDSVVRRASLIYGVFPKGGVSHVVSYRDK
FT                   RLPSMAPST"
FT                   /protein_id="YP_875318.1"
FT   gene            complement(325073..326290)
FT                   /db_xref="GeneID:6370559"
FT                   /locus_tag="CENSYa_0379"
FT   CDS_pept        complement(325073..326290)
FT                   /locus_tag="CENSYa_0379"
FT                   /gene_family="HOG000224236" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="myo-inositol-1-phosphate synthase"
FT                   /EC_number="5.5.1.4"
FT                   /note="COG1260"
FT                   /db_xref="GI:118575576"
FT                   /db_xref="GeneID:6370559"
FT                   /translation="MRRVPAAKKPERRPCLEEYNAQTNRGSARLKTFKRFWAGRSNMGG
FT                   IKVGLVGIGNCFSGLIQGIEYYKKNPSQEVTGIIHKELRGYGIHDIEFVCGFDVGESKV
FT                   GKSMNDAIYAEPNMVNWVDHGDMPKTPAMVHEGPALDGVGLWVENRVKPIKSSKTDDEL
FT                   AAEAKKIIQDTGAEVLVSYLPVGSDRATRFWAQICLDTGTAFVNCIPSFIASDAEWGQK
FT                   FADAGVPVIGDDIKGQVGATIVHRTLARLCSDRGTKIERTYQINVGGNTDFLNMKEQER
FT                   LVSKRISKTESVQSQLKERLDDDRIYVGPSDFIPFLGNTKLMFMRIEGRQWANIPYNME
FT                   VRLDVDDKANSAGIVVDAIRLARIARDDGVGGPIIPASAYLMKHPPEQMSDPQAKAACE
FT                   KFVSGA"
FT                   /transl_table="11"
FT                   /protein_id="YP_875319.1"
FT   gene            326341..327279
FT                   /db_xref="GeneID:6370560"
FT                   /locus_tag="CENSYa_0380"
FT   CDS_pept        326341..327279
FT                   /locus_tag="CENSYa_0380"
FT                   /gene_family="HOG000228838" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="deoxyhypusine synthase"
FT                   /EC_number="2.5.1.46"
FT                   /note="COG1899"
FT                   /db_xref="GI:118575577"
FT                   /db_xref="GeneID:6370560"
FT                   /translation="MIEPGRPVEDISIGRGTGIGEIFDGLSRSGGFESVNMALGLDVLH
FT                   SMASDDKCLRFLSFVGALVSTGARGIIRDMLGGKMFDVVVTTCGALDHDIARSYSEYRE
FT                   GSFTMDDSELVGAGMHRLGSVLVPLESYGPLIERKMQAFLEEEYAKGTRRMSTADITRM
FT                   IGLHTGEDSFLHKAAGHGIPVVVPGIMDGAVGSQIWMFTQKHSDFVLDVSADSELLSGL
FT                   VFKAERSGALMLGGGISKHHTLWWNQYRGGLDYALYMATADEHDGSLSGAPVREAISWG
FT                   KVAPGARQVTLRAEITSVLPFIYAALLERLQ"
FT                   /transl_table="11"
FT                   /protein_id="YP_875320.1"
FT   gene            complement(327374..330844)
FT                   /db_xref="GeneID:6370561"
FT                   /locus_tag="CENSYa_0381"
FT   CDS_pept        complement(327374..330844)
FT                   /locus_tag="CENSYa_0381"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RTX family exoprotein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575578"
FT                   /db_xref="GeneID:6370561"
FT                   /translation="MTVYLPGGNRTVGGGNPPEVLKAPLGVETNGTHIFVADRNNFRVQ
FT                   IFDANGTAQKVLDRSTHYELIGTPWDVHVSNDTMLLAHETEVLVLDKSRRIVQDLDVSS
FT                   PDWEVRAVTSNGTHIFAMEDYLLEPRASRLIVYEYAGAEAGAAPHVLSVSAEAGIYREG
FT                   RAVPFTVAFSEEVDVGGAPRLLLDIPGADAVYSSGSGTAELVFEYTVGAGNASQGLGHA
FT                   GEDSLVLDGGSITARGSTLPAFLELPPPPGGPGVVVGAPDVNVVVMDSPVPSDVLRVSA
FT                   PMVIKVAVSDTPSVMENGGGMGTADLTAESILDIQDGAALSVLRGASDLPAVSDAATAS
FT                   MGETRATDAPGTSDEASLSVSLGITDAPAVSERIARMGTGSADALDIPAVADGAALSLS
FT                   IGISDVSSVSDGASILSMGADGAADAPGIVETVSLSASLGTGDGPAFSEMVEGMSMILL
FT                   SASEAPGVTDSAHTTPTVRSVSAPSSIEMVNGTVEITVTFSEPVNISGVPLLRLDVGAN
FT                   ATFAAGSGTSSVTFNYTVGEGHNSDDLSYISTNALVPGNGSITAADDGIPADLALPRPG
FT                   SGSSLSGSSNVTIDTEPPAIARILATGNYTLEAASNEPFNISRTNIELEIDGLPANATM
FT                   VDAVAGNNLLITTNRTLFDAQNITVGFTDVTDPAGNPLVADEYNLTDNDKALLDDREVV
FT                   IGDDGNLLVIHGGMPPEFTVRDGTSRNVSLILNLEHGGGNETHALIPSSVTITDGNITV
FT                   LLPANLTLSEFNGMHQIIIERSSRVPAVEGTYEDPVEVGQMGADLQLGMLARITLHEQG
FT                   GNTGYRIDSMNDTISIDTRCDADSSARAAAQIGDGGACSIDVGVDLAIWTRGLSAWGSF
FT                   VPFPSEAIPVEQPAPLPRRGGGGGGGGGGGGGGGGSTLTGSDTGRSASLGFASSGQDAR
FT                   ESPSGILLAPGGTLAITPELESAGFEARVFGMEVILYGAGGQEDARVKYSAVPSLLNSE
FT                   QCAGESYSSERIFACDVSSVISEENAGYSFDSSDQLSLEIPLEGEFEGMMSVMLQDNRG
FT                   ILLLSHEGTAYGLSTGQAEPVLEIDPEPAGIAEEGPGGTEPATMAEPPEPVIEVEPEPV
FT                   AEPESDAAAEPDMIPEEPDESEPSAPEEAEEPEDLLNMIVEWFRSLFGG"
FT                   /protein_id="YP_875321.1"
FT   gene            complement(330858..333695)
FT                   /db_xref="GeneID:6370562"
FT                   /locus_tag="CENSYa_0382"
FT   CDS_pept        complement(330858..333695)
FT                   /locus_tag="CENSYa_0382"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="subtilisin-like serine protease"
FT                   /transl_table="11"
FT                   /note="COG1404"
FT                   /db_xref="GI:118575579"
FT                   /db_xref="GeneID:6370562"
FT                   /translation="MALPPEGKGHARNHPGAPAGARQENKRLIASRRADVHGQAVHAGW
FT                   IIYHHSPFGRGQRAPHLRRCGQGPAGCMMQGPGRLGRMAAIPASLALLAMLAVLSAGAP
FT                   HSQAEEGHMQLVHRVIDGELAVSTVPVQVTSVETFEPPRQFQIEADPASKISPELQNYA
FT                   ETGMHPMCGRGMNETAENIFGMDCSKPDDFDNRYISVIILLEQERRPVDYSRYNYDRET
FT                   VYRMIQEEGARASAALEAPAESVAEYLEGINATGIEVYYGIGGVAASVPGSAISGIAGL
FT                   EWVKGIDTTEYLFFTSADSTRRATGINIPFYDGFGGDGTRIASIDTGVDIVDGSYNHTA
FT                   FTAEIAHDDLDDLDDDPDTDDPKVVYIRDMISNRGYDPDDCANHGTRVVGAASGTGSQD
FT                   PRFRGFAPQAELIVYASCKTVDQAVIDIGGAMRAINDIIDTKAAAPGEGADVLTISYVS
FT                   KGNGYGRVTSVQLTDMVYDSGIAITRSAGNNLVNPNFYDNTGDGHKVFTAGQLLANGEH
FT                   GVLNGRPTSNYGTTLDGRIKPEITIPVAPMTVPSTGNTYQASTGTSFAAPAVAGAMATM
FT                   IGMYKEQDIVLEPGHVYAMMLSQAGGTETGSFEDIHMDERSGAGVMGMNYDTMETHSGS
FT                   YTFNSTGNTTVPLEIPGGTVKITAALWWPEVALDNPSNDRNDHNEVHLHIVSNGSALLS
FT                   STHSGSVLQRLVLEDPVPGEYDLQLSFVESEILPQKVFYSYTLFTEEDEFVMEHAALSP
FT                   GGERIRLGFSREVDPISATAGAFAVPGSRIAGSTASGSEVNLFLDAPIPAGSTPRVALH
FT                   GSVFASGSEDDVSASNVATVDGAGGESFLNVENIAHNSTHLFIADYALAGGLYILDGSF
FT                   GLADKVDQNTTGIDSFFITGVDVNATNIVLATQIGNNSGVHVLDLSGNRVGGFTTNGSI
FT                   YQWDLAPGSRDYSQR"
FT                   /protein_id="YP_875322.1"
FT   gene            333787..334494
FT                   /db_xref="GeneID:6370563"
FT                   /locus_tag="CENSYa_0383"
FT   CDS_pept        333787..334494
FT                   /locus_tag="CENSYa_0383"
FT                   /gene_family="HOG000106104" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="archaeal enzyme of ATP-grasp superfamily"
FT                   /transl_table="11"
FT                   /note="COG1938"
FT                   /db_xref="GI:118575580"
FT                   /db_xref="GeneID:6370563"
FT                   /translation="MGEKFKITETRPIDVKGGYLIEGFPSIGLTSAIATESLIRTTNFE
FT                   LAGFIDSDRFPPVSLVRNGEPTFPTTIHVNNALNVAVFSSYLMLNEKLHKEMARTLLGW
FT                   AKKHGISNVISSVATKSPEAKTAAAASTVEARKMLKEKGIPVIEHGAIPGIPGALLNHG
FT                   VLSGQNVIVLTFSPSTQGPDFNSSIELCNAFASIVPGVSCDIPALKKESERAELEINAA
FT                   KLETKNLSDGMYG"
FT                   /protein_id="YP_875323.1"
FT   gene            complement(334474..334950)
FT                   /db_xref="GeneID:6370564"
FT                   /locus_tag="CENSYa_0384"
FT   CDS_pept        complement(334474..334950)
FT                   /locus_tag="CENSYa_0384"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="archaeal DNA-binding protein"
FT                   /transl_table="11"
FT                   /note="COG1581"
FT                   /db_xref="GI:118575581"
FT                   /db_xref="GeneID:6370564"
FT                   /translation="MSDAEEILSEFRQGQEPADAKPEVQAAAGGQPEHPSADAGPGAPP
FT                   ENPPGPQPAEDEQAVPERDTIYVGAKSIMTYVMATLTQLSNLPRVTIKARGRRITQAVD
FT                   VSQTIVKRMSSVGYSVSEVRISSDQLTGPDNKTRTISTIEIDITKKVDLTVHAV"
FT                   /protein_id="YP_875324.1"
FT   gene            complement(335006..335251)
FT                   /db_xref="GeneID:6370565"
FT                   /locus_tag="CENSYa_0385"
FT   CDS_pept        complement(335006..335251)
FT                   /locus_tag="CENSYa_0385"
FT                   /gene_family="HOG000106115" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575582"
FT                   /db_xref="GeneID:6370565"
FT                   /translation="MSGPLVPGEDGIKIKPELMETEKLYHCIFGDKVMLAFKDGQEVLH
FT                   CYEIEEKEIVMRVKNETPEGIEGILEDYIRERRLND"
FT                   /protein_id="YP_875325.1"
FT   gene            335323..336414
FT                   /db_xref="GeneID:6370566"
FT                   /locus_tag="CENSYa_0386"
FT   CDS_pept        335323..336414
FT                   /locus_tag="CENSYa_0386"
FT                   /gene_family="HOG000082707" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nucleotidyltransferase/DNA polymerase involved in
FT                   DNA repair"
FT                   /EC_number="2.7.7.7"
FT                   /note="COG0389"
FT                   /db_xref="GI:118575583"
FT                   /db_xref="GeneID:6370566"
FT                   /translation="MDRIVLHVDFDHFFAQCEEARRPELRSGPVVVCVFSDRGGDSGAV
FT                   ATANYAARKFGVKSGIPISHAKSRLHEVPDAVFLPADFAYYSGISQEAMDEMKGFADVF
FT                   EYVGKDEAYMDVTRRTGGDYKKASYLAQQVKNAVRRKTRLTCSVGVTPNRLLSKIASDY
FT                   KKPDGLTVVPPGKVAEFLEPLDIRDIPGIGGKTEKALAEMGIRTVGQMRSVDIFELQQR
FT                   FGRRSGTHMHNAARGIDDEPVSEREPNVQHSRIVTLKRDSNEFGFLAETLGELCRDLHS
FT                   AVVKRRQRFKSVGIQLVQSDLSQKTRSRMLRSPVSDLEVLEKSSVQLLREALRDQEKPV
FT                   RRLGVRISELSEAGSQGVMDSYF"
FT                   /transl_table="11"
FT                   /protein_id="YP_875326.1"
FT   gene            complement(336405..337172)
FT                   /db_xref="GeneID:6370567"
FT                   /locus_tag="CENSYa_0387"
FT   CDS_pept        complement(336405..337172)
FT                   /locus_tag="CENSYa_0387"
FT                   /gene_family="HOG000106126" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="multitransmembrane protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575584"
FT                   /db_xref="GeneID:6370567"
FT                   /translation="MGVSTRRLLATIPLAAAVIAYIIAVENGLREQIEAAAPDFGVELV
FT                   YSWIWLWDFAVMTAFVSVALAIYFGKKWVRIAPAGPIFLGGSAAILSLDAFFPYDSLGP
FT                   LQFFVPYLVELNVWLIGLFDLGMATANDNLMFLRGDHGAFALQVFWPSAGVHSIIIYSL
FT                   VMMAFLLKMNVPRGRKAAWFAIGIIGTIAVNVARIFALSWYALKVTTDAAKWEEFHSVA
FT                   GEIMFLPWLFAFLVIVMVVESRRLTRLKAQSQK"
FT                   /protein_id="YP_875327.1"
FT   gene            337276..338094
FT                   /db_xref="GeneID:6370568"
FT                   /locus_tag="CENSYa_0388"
FT   CDS_pept        337276..338094
FT                   /locus_tag="CENSYa_0388"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="secreted protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575585"
FT                   /db_xref="GeneID:6370568"
FT                   /translation="MKRIGAETIAMARMRFLCNYSPGEGRAINNMARGLLHCRAPFMRP
FT                   AAGPGNFPARRRAKPRTGSNTYNPPGPTRPVKKAAKIGIAAVVAAVAVGLASPLFYETE
FT                   VNEALPAALDEMQTGLTLEEFETMDEGSRSVLVDSMPEDLKGMIMDASARKVRPVSENM
FT                   DEDGPDVLKRGSFAGLAGHAADGDAKILDVSGTRFLRFENFEVTNGPDLRVYLAPDGSV
FT                   SQGIELGKLKGSRGSQNYNIDGIDTDVYNTVVIYCQPFRVYFGEAQLFPS"
FT                   /protein_id="YP_875328.1"
FT   gene            complement(338160..338510)
FT                   /db_xref="GeneID:6370569"
FT                   /locus_tag="CENSYa_0389"
FT   CDS_pept        complement(338160..338510)
FT                   /locus_tag="CENSYa_0389"
FT                   /gene_family="HOG000106137" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575586"
FT                   /db_xref="GeneID:6370569"
FT                   /translation="MEVEIAVKKLLAMNKAIRVVTICDMSGKLVFTGRRKTVTNVLSPK
FT                   ESKESLRISARNMKGRKKLSKKLGQCRYTLAEYDKIKRLVMPAGKSHLFFITCTPRYDH
FT                   NKIVKKIRTFKD"
FT                   /protein_id="YP_875329.1"
FT   gene            complement(338554..338796)
FT                   /db_xref="GeneID:6370570"
FT                   /locus_tag="CENSYa_0390"
FT   CDS_pept        complement(338554..338796)
FT                   /locus_tag="CENSYa_0390"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575587"
FT                   /db_xref="GeneID:6370570"
FT                   /translation="MIEAAVPRVICISKRNAPFYSEHPDGHRSGPYAAGWFGGRPCGSL
FT                   VWQNPAPGPGSQYGKRSTARARGRVLHGRGRTLGT"
FT                   /protein_id="YP_875330.1"
FT   gene            338795..339064
FT                   /db_xref="GeneID:6370571"
FT                   /locus_tag="CENSYa_0391"
FT   CDS_pept        338795..339064
FT                   /locus_tag="CENSYa_0391"
FT                   /gene_family="HOG000106149" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575588"
FT                   /db_xref="GeneID:6370571"
FT                   /translation="MVPILGTFMSILSTLAGQLGPNYDPLFYDVMIYIFGTIMFTVFLL
FT                   AIISFWLRVHGWGYKDNRERWVDELDRHFEREGIGLIPDNGKYW"
FT                   /protein_id="YP_875331.1"
FT   gene            complement(339283..340068)
FT                   /db_xref="GeneID:6370572"
FT                   /locus_tag="CENSYa_0392"
FT   CDS_pept        complement(339283..340068)
FT                   /locus_tag="CENSYa_0392"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575589"
FT                   /db_xref="GeneID:6370572"
FT                   /translation="MAQTHCRAAVMLAGGFRKQPAGTWRHGCMHSRPCFPAGVPAGDGP
FT                   RVRGAPIPRSGRAKDFPRQNLCLKLGFAGLIETTLWNLRPSCVMFWPGMGDPRKRKKTL
FT                   RFLIITAAIGISVGLASTFAQQIVDADNPLKVCIDDRDTPYRITATLELFVDGIKAEIP
FT                   ANVGNINGCKRSLYTLSDDGTIYAEWEEEYPFEIGHFLWIWDFPHRDMEESKSRFLVDG
FT                   RPTDDYIHAPLKDGSHYRAEFTSKSYDDSKDTDFLPPDL"
FT                   /protein_id="YP_875332.1"
FT   gene            complement(340074..340439)
FT                   /db_xref="GeneID:6370573"
FT                   /locus_tag="CENSYa_0393"
FT   CDS_pept        complement(340074..340439)
FT                   /locus_tag="CENSYa_0393"
FT                   /gene_family="HOG000106160" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575590"
FT                   /db_xref="GeneID:6370573"
FT                   /translation="MRLHARRFITSIAAACSVPGFRITKMDIQQSYFFGRVETGGEEYK
FT                   LNIQSERRGKVLRMPPGMRPSKERLVVRLTGPGGIYVEDYLPYKGESEWLEIDSDEIAY
FT                   FLADHQDQLDTIEVMDE"
FT                   /protein_id="YP_875333.1"
FT   gene            complement(340470..341045)
FT                   /db_xref="GeneID:6370574"
FT                   /locus_tag="CENSYa_0394"
FT   CDS_pept        complement(340470..341045)
FT                   /product="ammonia monooxygenase subunit B"
FT                   /gene_family="HOG000106171" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="CENSYa_0394"
FT                   /EC_number="1.14.13.25"
FT                   /db_xref="GI:118575591"
FT                   /db_xref="GeneID:6370574"
FT                   /translation="MAIIDKKLMVVGLGMVLALGTLGFNWMEAILPSAEAHGVQAQLQS
FT                   RFIRIEDETFNRQSLQTGETLCLAGSFVSLVERDLRGWNSIFSESTNAGNRWEILSRDP
FT                   PGNVFDIPGNSEIPYEICALALEPGVYHVHTQLNVATVGPGLGPGQTVVVDGEFILKEI
FT                   PYTNIAYQSIIIGVGYVITFATRPWQVI"
FT                   /transl_table="11"
FT                   /protein_id="YP_875334.1"
FT   gene            complement(341154..341408)
FT                   /db_xref="GeneID:6370575"
FT                   /locus_tag="CENSYa_0395"
FT   CDS_pept        complement(341154..341408)
FT                   /locus_tag="CENSYa_0395"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575592"
FT                   /db_xref="GeneID:6370575"
FT                   /translation="MLIGDPRCRKCRLGGWKWERWHEYTVFDRQRRAGGPYWRILRARD
FT                   TSLQEIWEISSDSAHVYSPEMVITWRIQRGSESLGSDLC"
FT                   /protein_id="YP_875335.1"
FT   gene            341513..341983
FT                   /db_xref="GeneID:6370576"
FT                   /locus_tag="CENSYa_0396"
FT   CDS_pept        341513..341983
FT                   /locus_tag="CENSYa_0396"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575593"
FT                   /db_xref="GeneID:6370576"
FT                   /translation="MFAEFGFEGLQPRRLCLSSTGISCRYLPQCKSAFCLDQAVYLPGN
FT                   LVCHVGVRRHADCIYPHLESYMPAELVIEVHEERLVMAPRPVNQPGESVKGPVVLAGSR
FT                   RSPVPDGRMLVEEIEMNNSQIHDHHDVLDAHAVRLHSLLEHTLYALYGVGGR"
FT                   /protein_id="YP_875336.1"
FT   gene            342054..342290
FT                   /db_xref="GeneID:6370577"
FT                   /locus_tag="CENSYa_0397"
FT   CDS_pept        342054..342290
FT                   /locus_tag="CENSYa_0397"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575594"
FT                   /db_xref="GeneID:6370577"
FT                   /translation="MTPGWGEFMQDAKITEADIASGKALELADKYVQNWKNHYFNEQHS
FT                   EFFSVKYGGHADIRPIDDAGFKWVEGAMKEVGL"
FT                   /protein_id="YP_875337.1"
FT   gene            342280..343080
FT                   /db_xref="GeneID:6370578"
FT                   /locus_tag="CENSYa_0398"
FT   CDS_pept        342280..343080
FT                   /locus_tag="CENSYa_0398"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575595"
FT                   /db_xref="GeneID:6370578"
FT                   /translation="MVFELPKLSDYPPDAVFRTEDLHLTDDPRDAFVVEFSRLEDGEIV
FT                   KVMVPVGMNKMILDMFDRVEKRVDAEIEAEDQQALNAALAQGHQMRAVEIIDKGEGNTY
FT                   VKTFLINDERNRNGWRASWESIRNNTKSFVGKPGIEFIKCGDRGCLRDHSPGHKDYSKA
FT                   PKSDQKHKVSTIIDVQLDEATHTAYAIHRIDSPGLAEIIKQDEIKYLSPSIWPNREKTT
FT                   VIGADDEWYIDNTDWKGVHDAWVDMPAFGHPARVIAACDGTSLR"
FT                   /protein_id="YP_875338.1"
FT   gene            343290..343859
FT                   /db_xref="GeneID:6370579"
FT                   /locus_tag="CENSYa_0399"
FT   CDS_pept        343290..343859
FT                   /locus_tag="CENSYa_0399"
FT                   /gene_family="HOG000106182" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ammonia monooxygenase subunit C"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575596"
FT                   /db_xref="GeneID:6370579"
FT                   /translation="MLMAQMPALIPKEVEIQRLKKIWMIMIAMGSVAASVEVDNFVDGS
FT                   LHQTSIRDSAFTPAHWWLYSHFVALPLGWGSVAIYDRRVPTLRGPNNSMNTGLKMTILG
FT                   YLATMFTIGVNEMWHFWFVEEIFAVPNHWMFNMGVVVAFMGALAYVVRVYARLIELGAE
FT                   TPGENPYVAEMYKMALEGKLYSRSIP"
FT                   /protein_id="YP_875339.1"
FT   gene            343919..344320
FT                   /db_xref="GeneID:6370580"
FT                   /locus_tag="CENSYa_0400"
FT   CDS_pept        343919..344320
FT                   /locus_tag="CENSYa_0400"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575597"
FT                   /db_xref="GeneID:6370580"
FT                   /translation="MPPGMSGAPRVHQLQVVCPCTAPGARRPGSTCAAPGCLHMRRSRL
FT                   SAHAPLQVVCTCAAPGCLHMRRSRGPYTRQHVQPPYLYRTDCMCMLRREFGEAPQGRAV
FT                   DVTGLYFSTAAAVCTAGPASRGIRRVLHE"
FT                   /protein_id="YP_875340.1"
FT   gene            344371..345648
FT                   /db_xref="GeneID:6370581"
FT                   /locus_tag="CENSYa_0401"
FT   CDS_pept        344371..345648
FT                   /locus_tag="CENSYa_0401"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575598"
FT                   /db_xref="GeneID:6370581"
FT                   /translation="MQTHAGTSPPRTGTRAAVHELYLVTPWHDGTWGKQRPVGFRLKTS
FT                   PACRTGRRGIRTVPAAPPARSGRYAVASRSADRDPFSDPARQGYGMTAAPPARSGRYAV
FT                   ASRSADRDPFSDPARQGYGMTAAPPARSGRYAVASRSADRDPFSDPARQGYGMTAAPPA
FT                   RSGRYAVASRRAARDGAPFSDPARRVYGMAAGAPGSLRWMGCQRTGAETATRTVSHESG
FT                   ICGRFSGPAGIRSGVYGASEGRQMHYLHIRAGILLRAGSACPRRRTSCFQARFYHMRHF
FT                   TPEFVPLQGPIKKDFNTFRTPLISMTLPKGFGSGGAGGADAADVEKMIGRRIENMTGII
FT                   TLSFIAAWLATFAGTAVGYFYYPWAYPTNSGHYAFIVLTIIEAIGYLFAVKIAEEGSRK
FT                   KSNLMIGSTLGGVTVLTMYLSIFVGW"
FT                   /protein_id="YP_875341.1"
FT   gene            345988..346653
FT                   /db_xref="GeneID:6370582"
FT                   /locus_tag="CENSYa_0402"
FT   CDS_pept        345988..346653
FT                   /locus_tag="CENSYa_0402"
FT                   /gene_family="HOG000106193" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ammonia monooxygenase subunit A"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575599"
FT                   /db_xref="GeneID:6370582"
FT                   /translation="MPRLTMVWLRRCTHYLFIAVVAVNSTLLTINAGDYIFYTDWAWTS
FT                   FTVFSISQTLMLVVGATYYLTFTGVPGTATYYALIMTVYVWIAKGAWFALGYPYDFIAT
FT                   PIWLPSAMLLDLAYWATKRNKHSLILFGGVLVGMSLPLFNMVNLITVADPLETAFKYPR
FT                   PTLPPYMTPIEPQVGKFYNSPVALGAGAGAVLSVTFAALGVKLNTWTYRWMAAWSKWD"
FT                   /protein_id="YP_875342.1"
FT   gene            complement(346746..347606)
FT                   /db_xref="GeneID:6370583"
FT                   /locus_tag="CENSYa_0403"
FT   CDS_pept        complement(346746..347606)
FT                   /locus_tag="CENSYa_0403"
FT                   /gene_family="HOG000281350" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="site-specific DNA methylase"
FT                   /EC_number="2.1.1.72"
FT                   /note="COG0338"
FT                   /db_xref="GI:118575600"
FT                   /db_xref="GeneID:6370583"
FT                   /translation="MLSQQYGLEQSPIRPFVKWAGGKRQIIPVLQGFFPRAFGEYHEPF
FT                   LGGGAVLFHMLSGGRRHKCHASDLNGELVLAYEVVRDSVEDLISALEEHARAYNADKSG
FT                   HYYEVRAAEPRGDLARVSRMIFLNRTCFNGLYRVNKRGRFNVPLGRYSNPGIVNAENLR
FT                   AVSATLRSGRVSIGCHDFVDSAEDAKRGDFVYFDPPYQPVSRTASFTSYTRADFGAEDL
FT                   ARLAGLCRRLDARGCHVMLSNSNTPEVRSHFGNSWKTRKVRANRAINSDSGGRSGHTEL
FT                   VITNY"
FT                   /transl_table="11"
FT                   /protein_id="YP_875343.1"
FT   gene            347787..348173
FT                   /db_xref="GeneID:6370584"
FT                   /locus_tag="CENSYa_0404"
FT   CDS_pept        347787..348173
FT                   /locus_tag="CENSYa_0404"
FT                   /gene_family="HOG000106204" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575601"
FT                   /db_xref="GeneID:6370584"
FT                   /translation="MPKPGFKSITISDAVYDRFFDVYSKNREKMMMRGVSSFAGYVTYM
FT                   MEETMQKDKTFARYAPRMESISVEDDRVILKDNIEDRIAEITIRGGKFFCQLCEQEHCV
FT                   HVGFAFSLPEVYEALAARGMNKRG"
FT                   /protein_id="YP_875344.1"
FT   gene            348380..348453
FT                   /db_xref="GeneID:6370585"
FT                   /locus_tag="CENSYa_0405"
FT   tRNA            348380..348453
FT                   /db_xref="GeneID:6370585"
FT                   /locus_tag="CENSYa_0405"
FT                   /product="tRNA-Thr"
FT   gene            348543..349853
FT                   /db_xref="GeneID:6370586"
FT                   /locus_tag="CENSYa_0406"
FT   CDS_pept        348543..349853
FT                   /locus_tag="CENSYa_0406"
FT                   /gene_family="HOG000229291" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="translation elongation factor EF-1alpha"
FT                   /EC_number="3.6.5.3"
FT                   /note="COG5256"
FT                   /db_xref="GI:118575602"
FT                   /db_xref="GeneID:6370586"
FT                   /translation="MTAHMADKPHLNMIVTGHIDNGKSTTMGHFLMDLGVVDERTIAQH
FT                   AEESEKTGKGDTFKYAWVMDNIKDERERGITIDLAFQKFETPKYFFTLIDAPGHRDFIK
FT                   NMITGASEADCAILVLSAKEGETDTAIAAGGQAREHAFLLKTLGVNQLIVAVNKMDDSK
FT                   YSEEAYKKTVEKGEGLVKSVGYKLENVPFIPVSGWKGDNLVKRSENMPWYKGKTLLESF
FT                   DDFKMAEKPVGKPLRVPIQDVYTITGVGTVPVGRVETGTMKPGDKIVVMPSGAQGEIKS
FT                   IETHHTEMPSAEAGDNIGFNLRGIEKKDIKRGDVLGDPANPPKVAKEFLAQIIVIHHPT
FT                   ALAPGYTPVMHCHTAQVAAIMSEFVSKINPATGAVEEENPKFLKVGDSAIIKIRPVRPT
FT                   PIETFKEFPEMGRFALRDMGATIAAGIVKEITEEHKV"
FT                   /transl_table="11"
FT                   /protein_id="YP_875345.1"
FT   gene            349860..350168
FT                   /db_xref="GeneID:6370587"
FT                   /locus_tag="CENSYa_0407"
FT   CDS_pept        349860..350168
FT                   /locus_tag="CENSYa_0407"
FT                   /gene_family="HOG000270244" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein S10"
FT                   /transl_table="11"
FT                   /note="COG0051"
FT                   /db_xref="GI:118575603"
FT                   /db_xref="GeneID:6370587"
FT                   /translation="MTQSARVKLTSINLLKLDGVCGIIMDIGKRTGVRIKGPTPLPVKK
FT                   LHIATRKSPCGSGTETYEKWEMRMHRRIIDISADDKTIRRLIDLKIPDDVHLELFLT"
FT                   /protein_id="YP_875346.1"
FT   gene            350199..350420
FT                   /db_xref="GeneID:6370588"
FT                   /locus_tag="CENSYa_0408"
FT   CDS_pept        350199..350420
FT                   /locus_tag="CENSYa_0408"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Zn ribbon protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575604"
FT                   /db_xref="GeneID:6370588"
FT                   /translation="MVDEEAAPEAAPEEDEEPVEEPEPKFEVFYSCLRCGTSVSNVELH
FT                   RLPEIKCICGFRVFTKVRPPIIKSVKAV"
FT                   /protein_id="YP_875347.1"
FT   gene            complement(350407..350607)
FT                   /db_xref="GeneID:6370589"
FT                   /locus_tag="CENSYa_0409"
FT   CDS_pept        complement(350407..350607)
FT                   /locus_tag="CENSYa_0409"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="C2H2 Zn finger protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575605"
FT                   /db_xref="GeneID:6370589"
FT                   /translation="MGLFKRARCPRCGASFRGEEQLMHHKDRVHGDLKYRCEKCGMSFH
FT                   GMEEMRSHVKAKHGYWDIRRP"
FT                   /protein_id="YP_875348.1"
FT   gene            complement(350610..351020)
FT                   /db_xref="GeneID:6370590"
FT                   /locus_tag="CENSYa_0410"
FT   CDS_pept        complement(350610..351020)
FT                   /locus_tag="CENSYa_0410"
FT                   /gene_family="HOG000106215" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="multiple Zn finger protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575606"
FT                   /db_xref="GeneID:6370590"
FT                   /translation="MGLFGRKAEHCAVCGKEMQHRHKPKREWNMKGRLCGDCHVDKSKE
FT                   YYEGKIRQSCTVCGTTKKITDLWEPRWQWDMEGLLCKECFDVKEGDFENRKKYCSMCGA
FT                   RMKFLRYRPKPGWKMDGELCRECWDSQKAKFG"
FT                   /protein_id="YP_875349.1"
FT   gene            complement(351138..351296)
FT                   /db_xref="GeneID:6370591"
FT                   /locus_tag="CENSYa_0411"
FT   CDS_pept        complement(351138..351296)
FT                   /locus_tag="CENSYa_0411"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575607"
FT                   /db_xref="GeneID:6370591"
FT                   /translation="MDLPRDQPIKYLSKNAGAGPRGRSGRDINYCDAVYPWQNAQCPYA
FT                   LPQSSTG"
FT                   /protein_id="YP_875350.1"
FT   gene            351295..351801
FT                   /db_xref="GeneID:6370592"
FT                   /locus_tag="CENSYa_0412"
FT   CDS_pept        351295..351801
FT                   /locus_tag="CENSYa_0412"
FT                   /gene_family="HOG000156896" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Rossmann fold nucleotide-binding protein"
FT                   /transl_table="11"
FT                   /note="COG1611"
FT                   /db_xref="GI:118575608"
FT                   /db_xref="GeneID:6370592"
FT                   /translation="MARKTQILVIGHNDNGCTPEHEKTAYDTGAAIARSGAVLISGGLG
FT                   GVMRASCRGAREAGGLTVGIIPQDAHSEANEFCDVVLPSGMGLTRDFLNALAADGIIII
FT                   GGGSGTLSEVCAAYMYRRPMVAVRGTGGVADRYGGTFVDYRENIMIGQADSPDEAVRSI
FT                   LEAIT"
FT                   /protein_id="YP_875351.1"
FT   gene            complement(351794..352891)
FT                   /db_xref="GeneID:6370593"
FT                   /locus_tag="CENSYa_0413"
FT   CDS_pept        complement(351794..352891)
FT                   /locus_tag="CENSYa_0413"
FT                   /gene_family="HOG000141498" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase/enoyl-CoA
FT                   hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /EC_number="1.1.1.35"
FT                   /note="COG1250"
FT                   /db_xref="GI:118575609"
FT                   /db_xref="GeneID:6370593"
FT                   /translation="MGHGIAQVSAASGYEVVLRDIEQRFLDSAMEKIRWSLDKMASKGR
FT                   ITAEEKDGILNRIRPVVALGEALEGADLVIEAVPEVMDLKRKVYAELDAAAPEGAAFAS
FT                   NTSTLPITEIAQATSRPERFIGIHFFNPPQLMKLVEVIPGEGTSDETTRMTLEYVESLG
FT                   KQAVLCRKDVPGFIVNRLFIPMVHEACHAMDRTGASMEQIDSAVKFGLGFPMGIFELAD
FT                   FTGMDVIHKATVEMHQRDKGVVNPHPLVEKMFNEKKLGKKSGEGYYKYSDEKYERVALS
FT                   EELAAGYDPLELAASVLNNAAWLVSNGASDIEEIEKAARLGLGLKNPLFETAKEMGMGR
FT                   IVGALEKMAAKYGPFYRPDPLFATM"
FT                   /transl_table="11"
FT                   /protein_id="YP_875352.1"
FT   gene            353018..353737
FT                   /db_xref="GeneID:6370594"
FT                   /locus_tag="CENSYa_0414"
FT   CDS_pept        353018..353737
FT                   /locus_tag="CENSYa_0414"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575610"
FT                   /db_xref="GeneID:6370594"
FT                   /translation="MDAGADRMRGTYNDWARYAKMYDSFLSSGKMVGTYKAVLLRSLAD
FT                   LGLYSEPCLVGRRWIGHRDGRIMLNLDFVAARFAKYYWDMHAGFGLRHTPHRSRGGRED
FT                   ADTIISLIDNEQAGRADQNPPELAELASDKMEGFRCKVARLCVARHAIDAVLTDMPGLY
FT                   EKVGKEYIELEPGLVAFLREHRTLIRKSLNCILAQHLERINPEARHIATKIDGETPLVE
FT                   RQAIIAEMESRAGAPPG"
FT                   /protein_id="YP_875353.1"
FT   gene            353797..353967
FT                   /db_xref="GeneID:6370595"
FT                   /locus_tag="CENSYa_0415"
FT   CDS_pept        353797..353967
FT                   /locus_tag="CENSYa_0415"
FT                   /gene_family="HOG000106226" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575611"
FT                   /db_xref="GeneID:6370595"
FT                   /translation="MGLFGKGKKKDENKTKCDVCGNELYYPERLERHMKKAHGNVPEKK
FT                   MDPKESSDGMW"
FT                   /protein_id="YP_875354.1"
FT   gene            353971..354258
FT                   /db_xref="GeneID:6370596"
FT                   /locus_tag="CENSYa_0416"
FT   CDS_pept        353971..354258
FT                   /locus_tag="CENSYa_0416"
FT                   /gene_family="HOG000106237" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575612"
FT                   /db_xref="GeneID:6370596"
FT                   /translation="MELSDGQKYGAIFGGAIVAAGLILATVVFPFWNLIREDVFEEVVI
FT                   LTNTDGTCYVETEDMVPKTIEDCAAQPGDTVMIKFGRDLAWAAIVEPGDG"
FT                   /protein_id="YP_875355.1"
FT   gene            354274..354690
FT                   /db_xref="GeneID:6370597"
FT                   /locus_tag="CENSYa_0417"
FT   CDS_pept        354274..354690
FT                   /locus_tag="CENSYa_0417"
FT                   /gene_family="HOG000061063" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="diadenosine tetraphosphate hydrolase"
FT                   /transl_table="11"
FT                   /note="COG0537"
FT                   /db_xref="GI:118575613"
FT                   /db_xref="GeneID:6370597"
FT                   /translation="MRDADCVFCKIASGELPARIISETGNTIAFMDAFPVARGHSLVIP
FT                   KGHYERMQEIPESENADLFEVVRRVVARVDEMGGSTLVALHNGRGSGQEVPHAHVHLIP
FT                   RSEGDGAGPVHSMFGGAIQLGTDETFEIYDRLKG"
FT                   /protein_id="YP_875356.1"
FT   gene            complement(354691..355434)
FT                   /db_xref="GeneID:6370598"
FT                   /locus_tag="CENSYa_0418"
FT   CDS_pept        complement(354691..355434)
FT                   /locus_tag="CENSYa_0418"
FT                   /gene_family="HOG000106248" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DnaJ-class molecular chaperone"
FT                   /transl_table="11"
FT                   /note="COG0484"
FT                   /db_xref="GI:118575614"
FT                   /db_xref="GeneID:6370598"
FT                   /translation="MKHCILLQDPRDGPAGCMFLSCGISGVVLDPHKARRILGVGDDAG
FT                   FDEIKAAYRRQALEKHPDRSGDGSLFQEINEAYSILREEQRNPRPASRPAARQGPAAGS
FT                   ARNWGPPPGQDGPPEQDWSKHTRDIEEENPDFWKEYERNFWKDYENTINADGRNGEFEK
FT                   AKEPKKQPDLHVEVEPSLCIGCQSCETIAPDVFRVDRDTNMNPKSRVINRKGAGLNKIM
FT                   NAAETCPTKAIIVENKDTDERLYPL"
FT                   /protein_id="YP_875357.1"
FT   gene            355433..355906
FT                   /db_xref="GeneID:6370599"
FT                   /locus_tag="CENSYa_0419"
FT   CDS_pept        355433..355906
FT                   /locus_tag="CENSYa_0419"
FT                   /gene_family="HOG000106269" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="translation elongation factor P
FT                   (EF-P)/translation initiation factor 5A"
FT                   /transl_table="11"
FT                   /note="COG0231"
FT                   /db_xref="GI:118575615"
FT                   /db_xref="GeneID:6370599"
FT                   /translation="MAGDPGDGKRKVNYSTKGRIGMSKPSELGSLKIGSYILLPVGDQA
FT                   TGEPCRISEYDTSKPGKHGAAKARIVGVGVFDGQKRPHVGPVSMQVHVPLIDKRTGQVI
FT                   SIIGETIQIMDSETFETVDIVMIDEEVQGRIENGQNVEYWLVMDKTKIMRIKN"
FT                   /protein_id="YP_875358.1"
FT   gene            355998..356804
FT                   /db_xref="GeneID:6370600"
FT                   /locus_tag="CENSYa_0420"
FT   CDS_pept        355998..356804
FT                   /locus_tag="CENSYa_0420"
FT                   /gene_family="HOG000229449" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ATPase of the PP-loop superfamily"
FT                   /transl_table="11"
FT                   /note="COG2102"
FT                   /db_xref="GI:118575616"
FT                   /db_xref="GeneID:6370600"
FT                   /translation="MRLAALFSGGKDSAYSAYRAIQEGHTVACLVSAAPVSPDSMLFHA
FT                   PNTHITGLQAISMGIPRICARSGPSDADSEEKLLAESLLFARDEYRIQGVVHGGLSSAF
FT                   QKRHFEGACGSAGLEAVAPLWGLEPGQYMRSLVDDGFRFIITAVSAGGLGARWLGREIG
FT                   RREIDELGRISARHGLGLAFEGGEAETLVVDCPLFSREIRILRSRGSWDGCRGIFEIEA
FT                   AGLSRHARRPQDQPPVGNKKDSQLAGGRRKADTRAGARRPEGADTL"
FT                   /protein_id="YP_875359.1"
FT   gene            356806..357999
FT                   /db_xref="GeneID:6370601"
FT                   /locus_tag="CENSYa_0421"
FT   CDS_pept        356806..357999
FT                   /locus_tag="CENSYa_0421"
FT                   /gene_family="HOG000036165" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="signal recognition particle GTPase"
FT                   /transl_table="11"
FT                   /note="COG0541"
FT                   /db_xref="GI:118575617"
FT                   /db_xref="GeneID:6370601"
FT                   /translation="MDVRLVKEIAGRLEERCVGEVPPPGLSRKDHIVKILYDELAKLLG
FT                   GESEFSFKPGRTNKVLMLGIQGSGKSTITAKLAKLLTRQGYKTGVVGADTYRPGALVQL
FT                   RTMCERSNVEVYGEEGESDAPAVVRRGLRHFGDSCDVILVDTAGRHKEEGELLDEMKRI
FT                   GKAAEPDLALLVIDGTIGNRCYAQAEAFHKTVPVGGIVVTKLDSSAKGGGAIAASAATG
FT                   SSVMYIGTGERIDDIEQFSSTRFVGRLLGMGDVRAVLELAKRLEDGDQDRLKRISSGKM
FT                   TMDDFYQQLGEVAGAGSLQGLLENMPGFSGSVQTGKIEQLEGRIERWRYIIQSMTQAEK
FT                   ADPDLLNASRIKRIARGSGWPEHDVKELRKGYNNSKGMIKASKGRQMQGMLRRMGLG"
FT                   /protein_id="YP_875360.1"
FT   gene            358039..359247
FT                   /db_xref="GeneID:6370602"
FT                   /locus_tag="CENSYa_0422"
FT   CDS_pept        358039..359247
FT                   /locus_tag="CENSYa_0422"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pseudouridylate synthase"
FT                   /EC_number="4.2.1.70"
FT                   /note="COG1258"
FT                   /db_xref="GI:118575618"
FT                   /db_xref="GeneID:6370602"
FT                   /translation="MRPERGYVLCDPCLGRLFGSGNILHCEKRGRIIRGKGRDRPSECH
FT                   ICKGLCPSLEESCGPSLWGAAAYEFETFVVGVRLKSSMAERDDEVRSRCRLAGAAALRA
FT                   YVAAMLSSYLGAMTGASVDHGAPELSITADLRDNTAEFHPRPVVLSGRYTKSVRGLSQK
FT                   GAPCGGCAGEGCTSCGMLGVDTGGSVEGVISGHACGTYSARRASFTWVGGEDQESLVGG
FT                   RGRPFVAQLVQPHRRGLVHPATVRLGGVVLHGLREVRSMPQLPVRFRSKVRLAVSAKGE
FT                   ISDDTLGRLADLGGSTLAVYEGRRRVERAIHSASHSRTGPGSFELHMEVDGGVPFKRFV
FT                   SGETVFPNLSDLLGTVCSCGGFDFEEITVERGGHPGARGGTRRRPRKGPARPAGGRDRP
FT                   RKT"
FT                   /transl_table="11"
FT                   /protein_id="YP_875361.1"
FT   gene            359307..359597
FT                   /db_xref="GeneID:6370603"
FT                   /locus_tag="CENSYa_0423"
FT   CDS_pept        359307..359597
FT                   /locus_tag="CENSYa_0423"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575619"
FT                   /db_xref="GeneID:6370603"
FT                   /translation="MPTATPRAARKSRPRGASPADRRRGRAPRIAQPVSPRRISCRPPR
FT                   LGALRQRILLQGSEPPHWIRSPRLKRHPAGGSYRIVWRSWSGSAFHLPSPG"
FT                   /protein_id="YP_875362.1"
FT   gene            359642..360211
FT                   /db_xref="GeneID:6370604"
FT                   /locus_tag="CENSYa_0424"
FT   CDS_pept        359642..360211
FT                   /locus_tag="CENSYa_0424"
FT                   /gene_family="HOG000106271" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575620"
FT                   /db_xref="GeneID:6370604"
FT                   /translation="MDPSILVSVQDPGSFEYGILFARTLPLVREGRLQVVIQVCAPLIA
FT                   YGLKGTVHAILAHEFLHYLELIHRASGAITSDETSGNIRDSVYADGTRVLEPGAVFSDR
FT                   TLVSHITKRFPAGFRDARLEAKTITNWIDAGLPRTGVDLGGNTAVLPAGGLAGLRLETG
FT                   LAERLKIMAEKSSRMRGRMARAASGI"
FT                   /protein_id="YP_875363.1"
FT   gene            complement(360216..360383)
FT                   /db_xref="GeneID:6370605"
FT                   /locus_tag="CENSYa_0425"
FT   CDS_pept        complement(360216..360383)
FT                   /locus_tag="CENSYa_0425"
FT                   /gene_family="HOG000223075" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein S27AE"
FT                   /transl_table="11"
FT                   /note="COG1998"
FT                   /db_xref="GI:118575621"
FT                   /db_xref="GeneID:6370605"
FT                   /translation="MADKKEGGVHRFYKIEDGKTVKLRHICSRCGKGFFMAQHKDRRSC
FT                   GKCGLTEFNQ"
FT                   /protein_id="YP_875364.1"
FT   gene            complement(360383..360997)
FT                   /db_xref="GeneID:6370606"
FT                   /locus_tag="CENSYa_0426"
FT   CDS_pept        complement(360383..360997)
FT                   /locus_tag="CENSYa_0426"
FT                   /gene_family="HOG000106282" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575622"
FT                   /db_xref="GeneID:6370606"
FT                   /translation="MAREDAHASGRIIMAGCKWHLPPVQEPADAAPAFLCPGFSFQGLY
FT                   EQRRGSPTMGMVETVSDTESKFLSRREITCNFLGLAGKLDKLGAVDAVTSELGLGGKLV
FT                   IPMNLKNHVGKTMVTGTFYVYDDEALARSHVSSAVFARLDKAKKKIEEAKAAEKPAEEA
FT                   AEKPAEAAEAKADEGADKPAEAAEAKDEKPAENPAEAKEGS"
FT                   /protein_id="YP_875365.1"
FT   gene            complement(361015..361275)
FT                   /db_xref="GeneID:6370607"
FT                   /locus_tag="CENSYa_0427"
FT   CDS_pept        complement(361015..361275)
FT                   /locus_tag="CENSYa_0427"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575623"
FT                   /db_xref="GeneID:6370607"
FT                   /translation="MAPFMRSAKPRTGLPCHLFFGTAKACKQPHGAPRLCGGISPDRRE
FT                   PAASDSIVAGVQKMHALQRRPVLYSMKRVIICLCPRDNGRS"
FT                   /protein_id="YP_875366.1"
FT   gene            361314..361676
FT                   /db_xref="GeneID:6370608"
FT                   /locus_tag="CENSYa_0428"
FT   CDS_pept        361314..361676
FT                   /locus_tag="CENSYa_0428"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575624"
FT                   /db_xref="GeneID:6370608"
FT                   /translation="MSRKRIIVLCLLAVLAGAVTTGGAAFAYISVSGEELKADVREWLI
FT                   DNDPNKMTQNEKMVELKDKHYSYLAGFIEMVRVIIGGEFSEDDVRGMMYYVIHETIKDE
FT                   KMKLLKATAQENGWGG"
FT                   /protein_id="YP_875367.1"
FT   gene            361727..362278
FT                   /db_xref="GeneID:6370609"
FT                   /locus_tag="CENSYa_0429"
FT   CDS_pept        361727..362278
FT                   /locus_tag="CENSYa_0429"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575625"
FT                   /db_xref="GeneID:6370609"
FT                   /translation="MDDTGQDPQCGSKRGAGRLRPPVCVHGVEWRSGRPHGCRKGGHQR
FT                   YNTEWRDRAEPAHFERHEVLPGEHFIMFLGAGGACEIRDLPDFGVIAPGAGLCHVGDSI
FT                   ASILEGESLPADDLRDGRACRQAPDRDTCLVPALPFELASLDACIVCRAPHPNPEAAPM
FT                   NRNLRNSIRGVAWSGTWSTW"
FT                   /protein_id="YP_875368.1"
FT   gene            362275..362814
FT                   /db_xref="GeneID:6370610"
FT                   /locus_tag="CENSYa_0430"
FT   CDS_pept        362275..362814
FT                   /locus_tag="CENSYa_0430"
FT                   /gene_family="HOG000106293" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG1547"
FT                   /db_xref="GI:118575626"
FT                   /db_xref="GeneID:6370610"
FT                   /translation="MNTQYSPKESRHIVHKARDLCDGLGASIRVVRVATGFIELDVSVA
FT                   PSLLDELIGRLRPIGGLDNIRHVTEEEEITKDEGIVEGISYFNGERFWEAHEAWEGAWK
FT                   KCSGDEKSLVQGIILVAVAFAHSQKNDDDIGINMFGRALEKMGEFAGIYHNIDVGRIRS
FT                   KITAMMDERRMELFRI"
FT                   /protein_id="YP_875369.1"
FT   gene            complement(362804..364063)
FT                   /db_xref="GeneID:6370611"
FT                   /locus_tag="CENSYa_0431"
FT   CDS_pept        complement(362804..364063)
FT                   /locus_tag="CENSYa_0431"
FT                   /gene_family="HOG000004785" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphoglycerate mutase"
FT                   /EC_number="5.4.2.1"
FT                   /note="COG3635"
FT                   /db_xref="GI:118575627"
FT                   /db_xref="GeneID:6370611"
FT                   /translation="MTEARMVYVLLDGVGDLPHPDLGGKTPLEAASTPNMDRLAVRGAM
FT                   GEVISVGEGIAPESDIAVFNMLGYRFGDEYPGRGVIEAIGTGADFKDGDLALRGNFATL
FT                   GGSGEITDRRAGRNVGRPDAEAVSRELEEGVRFSKSGASVSVIPSVGHRVTVRIRSEGG
FT                   LSGSITNTDPAYERLRGMGVAKDASGPMRIDRCRALDDDPRAQTAAELVNEFSEQAVKI
FT                   LGDSGTNERRAAAGAKKISCILLRDAGSRRPVVEPIEKKYSLGFSCIADMPVELGISEV
FT                   LGMEVLEAGGTCDYEQKAAAAAGADGSVYVHLKGPDEFGHDGDAAGKTSSIEDIDGRFF
FT                   GPLLGAISRDETAVVISADHSTPCISKGHSDDPVPLLVSGALAPPDGTVRFTEAQARSG
FT                   MMGRLAGADVLDAALNRIRS"
FT                   /transl_table="11"
FT                   /protein_id="YP_875370.1"
FT   gene            364127..365182
FT                   /db_xref="GeneID:6370612"
FT                   /locus_tag="CENSYa_0432"
FT   CDS_pept        364127..365182
FT                   /locus_tag="CENSYa_0432"
FT                   /gene_family="HOG000106304" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /EC_number="2.7.7.10"
FT                   /note="COG1085"
FT                   /db_xref="GI:118575628"
FT                   /db_xref="GeneID:6370612"
FT                   /translation="MKNVLTRFVRGTHMGVMRKDYVSERYMIVTGKEAKESDAKKSLYS
FT                   PGNESKTKPSVLSLVAKDGMLQRLQDSEDQYVKDWSIRVFESSNPAVTTEQNNTYSDRP
FT                   HYSEPAYGYHYIVVASPNQKDTFSTIDVDQWSNILMVVQDRLKWLYTKKGVTYVSIYAN
FT                   WGEAAGAATSHPHMNIVTFSTIPPVVDAEVDASHRILNEKGVCPMCQTVAAELDGPRQV
FT                   LQTKGFVAFCPWAPAYPYEFWICPRKHNTFFSKISQKELTDLALMLRTTLGGLAKTAKD
FT                   PAFNLVFHLSPERKNSRQIHWHIEVYPVTAPRSGLERGYGIYLSSISPEDAAGRLGPAC
FT                   RKELAGLVGIL"
FT                   /transl_table="11"
FT                   /protein_id="YP_875371.1"
FT   gene            365236..365673
FT                   /db_xref="GeneID:6370613"
FT                   /locus_tag="CENSYa_0433"
FT   CDS_pept        365236..365673
FT                   /locus_tag="CENSYa_0433"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575629"
FT                   /db_xref="GeneID:6370613"
FT                   /translation="MAIEKYIAAASLGLFIMFVGEIITIFYYMQTAPGEFIIFVLEPDP
FT                   KILQFISIGAAPAIIMAGVSFLLTRRYGSRLIGSLIIAGGAVMFGGMVVAHSMAGGIHP
FT                   EYEGNFVPIITPLFMAVSVPIMVIGAMLLRRKQRRRKKEYV"
FT                   /protein_id="YP_875372.1"
FT   gene            complement(365670..366089)
FT                   /db_xref="GeneID:6370614"
FT                   /locus_tag="CENSYa_0434"
FT   CDS_pept        complement(365670..366089)
FT                   /locus_tag="CENSYa_0434"
FT                   /gene_family="HOG000106325" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="histone acetyltransferase"
FT                   /transl_table="11"
FT                   /note="COG0454"
FT                   /db_xref="GI:118575630"
FT                   /db_xref="GeneID:6370614"
FT                   /translation="MRRLSTEDLAAGFLESLDSLREASGMGPEKAKDILSRISANPDHI
FT                   VLVAEYGGRIVGATTLLIEPKFIHGGGIAGHIEDVAVARGMQGKGIGKLLVREALECAK
FT                   KAGCYKTILDCEDSLLPFYEGLGFRRGANAMRFDH"
FT                   /protein_id="YP_875373.1"
FT   gene            complement(366104..366751)
FT                   /db_xref="GeneID:6370615"
FT                   /locus_tag="CENSYa_0435"
FT   CDS_pept        complement(366104..366751)
FT                   /locus_tag="CENSYa_0435"
FT                   /gene_family="HOG000283478" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="nucleoside-diphosphate-sugar pyrophosphorylase"
FT                   /transl_table="11"
FT                   /note="COG1208"
FT                   /db_xref="GI:118575631"
FT                   /db_xref="GeneID:6370615"
FT                   /translation="MFLPKPMLPLGDRPLLELLIEWARKNGTKSVVLCVSYMRKAIQDY
FT                   FEDGSRFGVSIEYAVSERPLATAGQLRTAADLVDGTFACLYGDSVFGFSLRAMAAQHRR
FT                   KRSFITMGLYEYSTTLPYGVIKTGRGGKVASWDEKPEIKAMINMGCYIMEPGVMDLIPR
FT                   GKSYGMDDVVRRAMSKGLPVGSYPTKKGFMDIGDKESYSRAYQSFVERLGKI"
FT                   /protein_id="YP_875374.1"
FT   gene            complement(367004..367903)
FT                   /db_xref="GeneID:6370616"
FT                   /locus_tag="CENSYa_0436"
FT   CDS_pept        complement(367004..367903)
FT                   /locus_tag="CENSYa_0436"
FT                   /gene_family="HOG000106336" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ABC-type Fe3 -hydroxamate transport system,
FT                   periplasmic component"
FT                   /transl_table="11"
FT                   /note="COG0614"
FT                   /db_xref="GI:118575632"
FT                   /db_xref="GeneID:6370616"
FT                   /translation="MARRIVSFLPSATEMIYALGAQDMLHGVTHECDRPPEAASKPKVI
FT                   RSSFDPAAMSSKEIDDATARAGEGVFVLDEKALMEARPDLIIAQDTCKVCAPHSAQAAR
FT                   ALEIVDGARAHSMDPHDMAGILDSITDLAGVIGREGEGREIRGALEERIAAAGAAGPGP
FT                   RVLALEWVDPLYTSGHWVPDMIAAAGGTDAVGAAGAHSRRMDMEEAAASDPDKVVLMPC
FT                   GFDAARAESEYRGSLATNVRWRQMRAVAEGEVYAVDSAAYFTRPGIGVAAGVEIIANIL
FT                   RPGSADAPRGACKKMGPP"
FT                   /protein_id="YP_875375.1"
FT   gene            368278..368598
FT                   /db_xref="GeneID:6370617"
FT                   /locus_tag="CENSYa_0437"
FT   CDS_pept        368278..368598
FT                   /locus_tag="CENSYa_0437"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575633"
FT                   /db_xref="GeneID:6370617"
FT                   /translation="MGSPCFVQHVSGTPRISSRACSGIGPQASCSPSTARRARHGTLTG
FT                   KRLHICTFKYCSLPACAMIEGTAMFAGALGMSIALAIASFALRHRNYFFKSPAVEAGPE
FT                   ER"
FT                   /protein_id="YP_875376.1"
FT   gene            368725..369849
FT                   /db_xref="GeneID:6370618"
FT                   /locus_tag="CENSYa_0438"
FT   CDS_pept        368725..369849
FT                   /locus_tag="CENSYa_0438"
FT                   /gene_family="HOG000223838" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG1602"
FT                   /db_xref="GI:118575634"
FT                   /db_xref="GeneID:6370618"
FT                   /translation="MEVRWNEYLSRNGSLFSSDELSGASPPSVFVGSYGYPRVGVGPMV
FT                   PPVHGDTSLMDAPERWAGRPLDEIVNYRLSLVRGIRKTRVTGTSGRYIEGLQEAAMSRR
FT                   PVDSDIRFEKPVSPAALADGCCAPFGPVGEIRRASFGGSSADGAIERAYYDRDLGAADA
FT                   AVALYDGGTEISRIQGCLSVGMLGRRRKLVPTRWSITAVDDMVSKRLVGRIKDAPVSDA
FT                   HQVFHYVHMGNLFSVVLFPHRWLFEMMEAYYSGGVLGFGADHEDARGLDHAPATAGAHF
FT                   ASRLAVAEHLCGRGVQAGALVLREIRAEYSVPVGVWQVREGLRAAMAQKPFVAGSLDEA
FT                   IDEACRPMSISRNEWLSHGSIMRLVRQRTLSEFF"
FT                   /protein_id="YP_875377.1"
FT   gene            complement(369874..370728)
FT                   /db_xref="GeneID:6370619"
FT                   /locus_tag="CENSYa_0439"
FT   CDS_pept        complement(369874..370728)
FT                   /locus_tag="CENSYa_0439"
FT                   /gene_family="HOG000106337" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575635"
FT                   /db_xref="GeneID:6370619"
FT                   /translation="MNPRKSARLIPVLMLAVFMAAGPLVGSVSAQGIGMSLNVFAEAGS
FT                   TALTVSGMTTNRALGDVSITVQAPNGNIVGIDQKAPDRDGNYRTEVQLGDGILGIQDGV
FT                   YTIRAYQSDANLYDLNVRVMITGGVLGNIDETTSSLDLSSATTVRPDNRISGLSFTVDA
FT                   PEGALEMGINGNTDHLHTDVTMVVTAPNGNLIHTDQLSPDASGDFEATINVGCPNWAQD
FT                   GMYTITIQQEENILYKDVHQVEIRDCVVIPEFGTVAVLVLAVAIVSIIAVTARSGLSII
FT                   PRY"
FT                   /protein_id="YP_875378.1"
FT   gene            complement(370755..370916)
FT                   /db_xref="GeneID:6370620"
FT                   /locus_tag="CENSYa_0440"
FT   CDS_pept        complement(370755..370916)
FT                   /locus_tag="CENSYa_0440"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575636"
FT                   /db_xref="GeneID:6370620"
FT                   /translation="MPCLFGGAVRIKTVLMDAGFRSRYGRWRQSPGRPAYAPGGRNRAF
FT                   LCAFVHTT"
FT                   /protein_id="YP_875379.1"
FT   gene            complement(370917..371282)
FT                   /db_xref="GeneID:6370621"
FT                   /locus_tag="CENSYa_0441"
FT   CDS_pept        complement(370917..371282)
FT                   /locus_tag="CENSYa_0441"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575637"
FT                   /db_xref="GeneID:6370621"
FT                   /translation="MSPGWKRSPGMLFLWDAPQSLHLTRSSASTIRALPQSMHIRTPVP
FT                   IFGSLDPPRSIPSFMGIRIEQGTIKINREKLRRSGSIPRAPSGQPHIRMDDSSMLVRTI
FT                   HFRGGFPGAAAGAPRLP"
FT                   /protein_id="YP_875380.1"
FT   gene            complement(371462..372409)
FT                   /db_xref="GeneID:6370622"
FT                   /locus_tag="CENSYa_0442"
FT   CDS_pept        complement(371462..372409)
FT                   /locus_tag="CENSYa_0442"
FT                   /gene_family="HOG000106348" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575638"
FT                   /db_xref="GeneID:6370622"
FT                   /translation="MIPFWASETSPLDSEATSRPPFLHISSRFVLYCSTVNTVASSSSM
FT                   RGQTISFQTNRLFSVADAYLPFSPNINTRWRMLLTELSSEDIAVALDLLEKDWEVDPLL
FT                   KDFMLRKIEKVSDHTVTVGSVTYHMPYLEDEKKYILWTCLWPDCHNCCDRQGRLPLTSD
FT                   DLIKVGGKLEYKDVSEFIERETITATWQEPSPGGGTVTLTTINLKRKDGETEKDDGTHV
FT                   SCRFLDKDGGCTLHPDRPGVCQMYPFSAWLENDGGRARVHAAYQFTGDCPGFYMSADAG
FT                   EMRTEHENYSEMIYDYAMKSSRTTREGYSASSMH"
FT                   /protein_id="YP_875381.1"
FT   gene            372562..372666
FT                   /db_xref="GeneID:6370623"
FT                   /locus_tag="CENSYa_0443"
FT   tRNA            372562..372666
FT                   /db_xref="GeneID:6370623"
FT                   /locus_tag="CENSYa_0443"
FT                   /product="tRNA-Gln"
FT   gene            complement(372672..373271)
FT                   /db_xref="GeneID:6370624"
FT                   /locus_tag="CENSYa_0444"
FT   CDS_pept        complement(372672..373271)
FT                   /locus_tag="CENSYa_0444"
FT                   /gene_family="HOG000039066" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein S7"
FT                   /transl_table="11"
FT                   /note="COG0049"
FT                   /db_xref="GI:118575639"
FT                   /db_xref="GeneID:6370624"
FT                   /translation="MAETQNLLLFRKWDLSDIEVVDPGLKTAISLRKMTLPYTYGRSAL
FT                   KRFNKADANIVERLANKMMHFGKKYAKNTGRMAGKKMGSINTVKTAFEIINLKTGRNPV
FT                   EVLVRAVENSAPNEDTTRIVYGGTVYHVSVDVSPLRRVDLALRFIADGVKEAAFRKPKS
FT                   LEEFLAEHLILAANNTTDAPSVKKKNELERIAQASR"
FT                   /protein_id="YP_875382.1"
FT   gene            complement(373274..373711)
FT                   /db_xref="GeneID:6370625"
FT                   /locus_tag="CENSYa_0445"
FT   CDS_pept        complement(373274..373711)
FT                   /locus_tag="CENSYa_0445"
FT                   /gene_family="HOG000040064" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein S12"
FT                   /transl_table="11"
FT                   /note="COG0048"
FT                   /db_xref="GI:118575640"
FT                   /db_xref="GeneID:6370625"
FT                   /translation="MAKSPLGLFAGRVLKAKKKRQRWSISRYKRRELGLDRKANPMGGS
FT                   PQARGIVLEKVGVEAKQPNSAVRKCVRVQLIKNGKSITAFLPRDGAMNFIDEHDEVHVE
FT                   GMGATQGGAMGDIPGVRFKVFKVNGTSLHELVIGKKEKPRR"
FT                   /protein_id="YP_875383.1"
FT   gene            complement(373714..374178)
FT                   /db_xref="GeneID:6370626"
FT                   /locus_tag="CENSYa_0446"
FT   CDS_pept        complement(373714..374178)
FT                   /locus_tag="CENSYa_0446"
FT                   /gene_family="HOG000222997" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcription elongation factor"
FT                   /transl_table="11"
FT                   /note="COG0195"
FT                   /db_xref="GI:118575641"
FT                   /db_xref="GeneID:6370626"
FT                   /translation="MTQAIKLTNDQMRLMSLFQSITKATARDCIEDEKQNRVIFVVGGN
FT                   KMGLAIGRGGSNIKSLQNIIKKNVELVEYHEDPAEFLKHMLDSKLVSEVKLNKRSDGTT
FT                   QAIVIVDPQKKGIVIGRDGRNVEKARMLAKRYFEISSVMINSPEREKIEW"
FT                   /protein_id="YP_875384.1"
FT   gene            complement(374252..374557)
FT                   /db_xref="GeneID:6370627"
FT                   /locus_tag="CENSYa_0447"
FT   CDS_pept        complement(374252..374557)
FT                   /locus_tag="CENSYa_0447"
FT                   /gene_family="HOG000106359" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein L30E"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575642"
FT                   /db_xref="GeneID:6370627"
FT                   /translation="MGKLLEKALRDAVKEDRCTIGAKQVAGAIKGSKMIVLSRLRQGND
FT                   TGEITRGAEEAGVPTVSFEGSSVALGRLCGLQYRVSAISIDAMPEAGIKPILEEAQ"
FT                   /protein_id="YP_875385.1"
FT   gene            complement(374609..375172)
FT                   /db_xref="GeneID:6370628"
FT                   /locus_tag="CENSYa_0448"
FT   CDS_pept        complement(374609..375172)
FT                   /locus_tag="CENSYa_0448"
FT                   /gene_family="HOG000106373" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="O-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COG4122"
FT                   /db_xref="GI:118575643"
FT                   /db_xref="GeneID:6370628"
FT                   /translation="MIQVMGRLEKQSRNERCTSPAERMMAITPETGRFYNILLRAMGAS
FT                   SVLEIGLSHGYSTIWFADGIQDVPGSRITTLERDSSKCSIAGANLREAGVDGMVNIRQG
FT                   DAADTLDGLEGPFDFVFIDADKENAIGYFEACLPLVRRNGIIAADNTLDMREMRPYIEH
FT                   VRRREGVRTVTLHVGWGQELTARL"
FT                   /transl_table="11"
FT                   /protein_id="YP_875386.1"
FT   gene            375367..376161
FT                   /db_xref="GeneID:6370629"
FT                   /locus_tag="CENSYa_0449"
FT   CDS_pept        375367..376161
FT                   /locus_tag="CENSYa_0449"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="COG1475"
FT                   /db_xref="GI:118575644"
FT                   /db_xref="GeneID:6370629"
FT                   /translation="MIRPSRYTLRYARPSGSGIEDLRASIREQGLLQPILIRPQDHGFE
FT                   IVAGHRRFAACRSLRWRVIPCRIRELTDRQAYEVQLAENIQRKSMDPIEEAEAYRRYVT
FT                   EYGWGGVGELGKRIGKSEEYVSHRMQLLRLPEDLRERVAGGGMGVSQALELAGADEPLR
FT                   TELAAEMASGGLTVRQIRDAKRRVAREPKPDGGTRSAAILNRGNLALKITLSRIDDLIE
FT                   DARAVGPKERAELVRFLMELRLQTHSMIDETLKYKKRRPGRA"
FT                   /protein_id="YP_875387.1"
FT   gene            complement(376158..377015)
FT                   /db_xref="GeneID:6370630"
FT                   /locus_tag="CENSYa_0450"
FT   CDS_pept        complement(376158..377015)
FT                   /locus_tag="CENSYa_0450"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="urease accessory protein"
FT                   /transl_table="11"
FT                   /note="COG0829"
FT                   /db_xref="GI:118575645"
FT                   /db_xref="GeneID:6370630"
FT                   /translation="MGQLGVGRTGKTAVLDIELRRSGSRTIISRQYSEVPLQVQRALYP
FT                   DAGLPGMAHVYVLSPSGGLLQGDRYKTSISLKDKAAAHVTTQGASRIYGMNSNCAIHKM
FT                   DISAGKGCYLEYIPDQVIPYAKSRYFQEVRLAIDDDAAAVYSEVVTPGRVAMGESFLYD
FT                   ILCTSVRCENQDGSLRFAENARAEPRRMNLRGEAVLGGYSVHGTVYVMAPPESARTIEY
FT                   TAGRIISHTDGILGGTSLLPGGAGITARLLSHRTDSIFKCIEGIAGACRMEMTGAAYPG
FT                   IRKC"
FT                   /protein_id="YP_875388.1"
FT   gene            complement(377047..377694)
FT                   /db_xref="GeneID:6370631"
FT                   /locus_tag="CENSYa_0451"
FT   CDS_pept        complement(377047..377694)
FT                   /locus_tag="CENSYa_0451"
FT                   /gene_family="HOG000236979" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Urease accessory protein"
FT                   /transl_table="11"
FT                   /note="COG0378"
FT                   /db_xref="GI:118575646"
FT                   /db_xref="GeneID:6370631"
FT                   /translation="MGRVPRVGIGGPVGAGKSMLIERVVPVLAARGYHVSIVSNDVISK
FT                   EDADRMRASLATERGLLPEDLVVGVATGGCPHTAVREDPSMNISIIEEIEAGHPELDLV
FT                   IIESGGDNITTTFSPALADYFIYMIDVAGGDKYPRKGGLGIESCDLLLINKTDLAGMVG
FT                   ADLGVMRADAERIRGERPFGFVNCMTDEGITEVAERIIHDALLGAPPGHPVG"
FT                   /protein_id="YP_875389.1"
FT   gene            complement(377712..378368)
FT                   /db_xref="GeneID:6370632"
FT                   /locus_tag="CENSYa_0452"
FT   CDS_pept        complement(377712..378368)
FT                   /locus_tag="CENSYa_0452"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Urease accessory protein"
FT                   /transl_table="11"
FT                   /note="COG0830"
FT                   /db_xref="GI:118575647"
FT                   /db_xref="GeneID:6370632"
FT                   /translation="MGELQLSDSLFPSGMFAHSNGLEYMINSKAISDAGGLYDVIEGVI
FT                   LQQVGPLDCAALGSTYSFIKDGDYPGIAETDRLVHCSKLVAGQRDASARSGAQAARCVA
FT                   EFAKDDTLDRYVSDIGGGVHGAYPVAFALCCNALGVQKERAAVMLLYGYASGSVSAALR
FT                   MGLIDHVEGQGMIHRLKPAICSATKELNSTMWQFSPRMDIMQMLHEKTDSKMFIT"
FT                   /protein_id="YP_875390.1"
FT   gene            complement(378373..378852)
FT                   /db_xref="GeneID:6370633"
FT                   /locus_tag="CENSYa_0453"
FT   CDS_pept        complement(378373..378852)
FT                   /locus_tag="CENSYa_0453"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Urease accessory protein"
FT                   /transl_table="11"
FT                   /note="COG2371"
FT                   /db_xref="GI:118575648"
FT                   /db_xref="GeneID:6370633"
FT                   /translation="MLEVREPLGNVFDGGRYAKAMDEAHEVLRLSRQELEKRIIRRSTD
FT                   GGTDVGISLAGGARLRHGDVLHGDGPVIIIEQKPEKVMVVTPGDTDFGAAVLLGHVIGN
FT                   RHRPVSVKGGDVCFPIQADSEAEVFGRLLGGVGSIDVKIEERIFVPDGSADVHGH"
FT                   /protein_id="YP_875391.1"
FT   gene            378942..379241
FT                   /db_xref="GeneID:6370634"
FT                   /locus_tag="CENSYa_0454"
FT   CDS_pept        378942..379241
FT                   /locus_tag="CENSYa_0454"
FT                   /gene_family="HOG000075053" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Urea amidohydrolase (urease) gamma subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="COG0831"
FT                   /db_xref="GI:118575649"
FT                   /db_xref="GeneID:6370634"
FT                   /translation="MLTPRELEKLNVFVAAELARRRMGRGLRLNHPEAVSILADHILEG
FT                   ARDGRSVPELMSSGRGVLTREQVLPGVPELIDSVQVEATFEDGTKLVTVHDPIV"
FT                   /transl_table="11"
FT                   /protein_id="YP_875392.1"
FT   gene            379244..379606
FT                   /db_xref="GeneID:6370635"
FT                   /locus_tag="CENSYa_0455"
FT   CDS_pept        379244..379606
FT                   /locus_tag="CENSYa_0455"
FT                   /gene_family="HOG000077770" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Urea amidohydrolase (urease) beta subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="COG0832"
FT                   /db_xref="GI:118575650"
FT                   /db_xref="GeneID:6370635"
FT                   /translation="MIPGEYFVEDEPVIANGNRKTVRVRVSNTGDRPVQTGSHTHFFEV
FT                   NRALDFPRSEAYGFRLNIPSGTSVRFEPGDTREVELVELAGSRIVHGMGGLVEGPLDEN
FT                   REEALRRARERGYRGA"
FT                   /transl_table="11"
FT                   /protein_id="YP_875393.1"
FT   gene            379603..381312
FT                   /db_xref="GeneID:6370636"
FT                   /locus_tag="CENSYa_0456"
FT   CDS_pept        379603..381312
FT                   /locus_tag="CENSYa_0456"
FT                   /gene_family="HOG000075064" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Urea amidohydrolase (urease) alpha subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="COG0804"
FT                   /db_xref="GI:118575651"
FT                   /db_xref="GeneID:6370636"
FT                   /translation="MTLEIPRSTYVDLFGPTTGDRIRLGDTDLIIEVERDLIRHGDEAV
FT                   FGGGKSIRDGLCQAAGTGRDGSLDLVITNAIIADPILGIVKADIGVKGGLIAGVGNAGN
FT                   PGIMDGVDMVISSSTEVVAGEHYICTPGTVDSHVHYISPQQAVHAICNGTTTMIGGGTG
FT                   PADGTNATTCTPGRWNIARMMESIRDMPLNFGFLAKGNDSIEGALMDQLKAGACGLKLH
FT                   EDWGTTPATIDSALKVAERTDTQVAIHTDTLNECGFVDDTIRAIAGRTIHTYHTEGAGG
FT                   GHAPDIMKIAGEPNVLPSSTNPTRPFTVNTLAEHLDMMMVCHHLNPHVPEDVSFAESRI
FT                   RGETIAAEDVLHDMGVLSMMSSDSQAMGRVGEVTTRNWQTADKMKKMAGPLPGDTAHND
FT                   NLRVKRYLAKITINPAITHGISEYVGSIRPGRLADMVLWSPKFFGAKPRLIIKGGMIAY
FT                   SLMGDPGASIPTTEPVLYRPMFGAHGAAAASTSLTFTSQIALDSGLGPEVAGRRLAPVR
FT                   GCRHIGKKDMVHNDLTPDIQINPETYEVRVDGALATTEPARSVSLARLYNLF"
FT                   /transl_table="11"
FT                   /protein_id="YP_875394.1"
FT   gene            381488..383407
FT                   /db_xref="GeneID:6370637"
FT                   /locus_tag="CENSYa_0457"
FT   CDS_pept        381488..383407
FT                   /locus_tag="CENSYa_0457"
FT                   /gene_family="HOG000106394" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="urea active transporter"
FT                   /transl_table="11"
FT                   /note="COG0591"
FT                   /db_xref="GI:118575652"
FT                   /db_xref="GeneID:6370637"
FT                   /translation="MAEAAGEIAQGFAIGDVLDEGWGWFIVVGLGAVFAVVITAEIKLE
FT                   EKYLGVKTSSEWFNTAGRVIKTGLTAAAIVSAWTWAATLLQSSTVAYQYGVSGPFWYAA
FT                   GASIQVLLFGILAIELKRKAPNAHTFLEIIRARYGNGSHKVFLVFALMTNMIVTAMLLL
FT                   GGSAVVNGLTGMDISLAAFLIPAGIMIYTLVGGLKATFVADYMHTIIIFIVILTFVAAV
FT                   YINSDLTGGVEGMYDKLVEAARLNPVEGNAAGAFLTMASIGGLMFGIINIVGNFGTVFV
FT                   DQAYWQRAIAAKPSSTVKGFLLGGACWFAIPFTLATTMGLTAVALGVDLTPEEVQLGLV
FT                   VPAAASVLMGEVGAILVLTMLFMAVTSAGSAELIAVSSLITYDIYRTYKNPRATGRQLL
FT                   RVSRGAIIGFGVGMGGLAVILLGAGLSLGFVYLAMGILIGSAVIPIAVSILWKGANRAA
FT                   ATAAPIIGLAVSLTVWVSVAASLPQYGGEITLASLGDNYSMLFGNIAGILTGGAVVILG
FT                   SLARKPTFEWEDLKDKITLVDVTPEEFDERESDEAELKKAFKFSLKGGGLMTLVLIVLW
FT                   PLPLFFSDYVFDLGFYTLWVGISIVWVSVAAFFIVGLPIIEARKGLIQVLTGKKTEQSE
FT                   EGGT"
FT                   /protein_id="YP_875395.1"
FT   gene            383404..383922
FT                   /db_xref="GeneID:6370638"
FT                   /locus_tag="CENSYa_0458"
FT   CDS_pept        383404..383922
FT                   /locus_tag="CENSYa_0458"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575653"
FT                   /db_xref="GeneID:6370638"
FT                   /translation="MTSCSGCGTVLGRKKYRFHKMWRIPGHYCKKCMLVLGQDFDDHGK
FT                   LTLPKTPCKLCETEIFFPVTVSKGGKRGRYCSLCSEAVEAGAVAAPGSPPSQVPARLPH
FT                   VMMMFAGLGVLMMALGLIFTLGAGDGGLVNILFGAVTTALGFMLFRKTIRSRSLLLGKT
FT                   GVRQNAVQD"
FT                   /protein_id="YP_875396.1"
FT   gene            384307..385146
FT                   /db_xref="GeneID:6370639"
FT                   /locus_tag="CENSYa_0459"
FT   CDS_pept        384307..385146
FT                   /locus_tag="CENSYa_0459"
FT                   /gene_family="HOG000106395" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="COG5340"
FT                   /db_xref="GI:118575654"
FT                   /db_xref="GeneID:6370639"
FT                   /translation="MELGMYMRPMSHTEQKLYLYLESMSKNIFRLPEIEHERLGLSRGH
FT                   YHTLISRLVKKGWIKRAGHGTYLRNPPLSVRAGPYYIEDPFETGLKMYGGYIAFHTAMY
FT                   LYGLNDNQPVMIYVATPSKSETVDLGPYHRIKAVKMGRRFTGIRTKDKYRISTLMKTIF
FT                   DCFDHVMHSGGYPDLLKSITFAESYGFGGSLDWNEFEVYLDEFASSSLCQKIGYMLSLL
FT                   KEEGIYETPDDLMEYLRGRIKNKTNLFGGRLGGKYDRNWMVVDNIGRRALLSWHYHG"
FT                   /protein_id="YP_875397.1"
FT   gene            385217..385945
FT                   /db_xref="GeneID:6370640"
FT                   /locus_tag="CENSYa_0460"
FT   CDS_pept        385217..385945
FT                   /locus_tag="CENSYa_0460"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG2253"
FT                   /db_xref="GI:118575655"
FT                   /db_xref="GeneID:6370640"
FT                   /translation="MFDIWNSLCYISTDEVLKDVQFAFRGGTTLSKVYFGSRQRISEEI
FT                   NLDIFFKDGMTREEAVDFVYRKIVSRMGPYEVDGPFGKGRVSRHRFTFTNELGSKDHVY
FT                   VDFNIKTTAPVYDTETRGASSIILPLNIRNVPVYPFHVILAQKLIAFHDRAEGKDLYDI
FT                   HTGLAMADKLGPVLDTLREILAAINIDYSDFKERIVEKLSDYKAMWNLHLSLNPYVLDE
FT                   NKLDWGKAAQQALDRLGPHL"
FT                   /protein_id="YP_875398.1"
FT   gene            385999..386391
FT                   /db_xref="GeneID:6370641"
FT                   /locus_tag="CENSYa_0461"
FT   CDS_pept        385999..386391
FT                   /locus_tag="CENSYa_0461"
FT                   /gene_family="HOG000106406" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575656"
FT                   /db_xref="GeneID:6370641"
FT                   /translation="MAYEKLLKTIMDSDTNIRHCLVADTEGNIVETNHREGITNFLSPE
FT                   ETAASLKRAASAWKGRKQLAPKIGRGMYAVAAFEKITRLTFPLGDDHLIFVSLGSEQTR
FT                   VDLHAGGQRQIVEHVLNILTDDPTRE"
FT                   /protein_id="YP_875399.1"
FT   gene            complement(386394..387560)
FT                   /db_xref="GeneID:6370642"
FT                   /locus_tag="CENSYa_0462"
FT   CDS_pept        complement(386394..387560)
FT                   /locus_tag="CENSYa_0462"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575657"
FT                   /db_xref="GeneID:6370642"
FT                   /translation="MTKPGYIPLSEDAAKIDRLVKKQRFRNTEAFIDRAVKILLAWELD
FT                   PESSLNIIQGYPLTAEQKTLVNKIWKPQEYERVFGEPEAGAHATLREGLGETVTYLKGL
FT                   KLHGPENPIEYDSYPMLFRFYSRFAPVKIAMAVLAEMLYKGNAESVELEALRDRAFEVA
FT                   SALAADIVEYEKSKGIKRTRKVSTGLPKAAGDDPDVMVAVKRRFKDHYVGRIRKDRRTK
FT                   ERHFEGAPAALGLARAAEEDGAYRVYLTEEGRKFCMMENPILSGEYSRALSGEESAFIT
FT                   GMIRRLPLEGRLFDVALEAVKGHTEGPVTELLDERFRETIVSYQREHPEEAKRHNINLE
FT                   SHTVEESAKMVEGWRVATMGRLSELGLISWEIDSQGKSVFAPRGAPAV"
FT                   /protein_id="YP_875400.1"
FT   gene            387866..388060
FT                   /db_xref="GeneID:6370643"
FT                   /locus_tag="CENSYa_0463"
FT   CDS_pept        387866..388060
FT                   /locus_tag="CENSYa_0463"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575658"
FT                   /db_xref="GeneID:6370643"
FT                   /translation="MLIFAWIYYKLDPREAGPAGARENARERVQEYQEYQGNDGDRQWP
FT                   DAGEQYEDDGYRRSSRRWR"
FT                   /protein_id="YP_875401.1"
FT   gene            388060..388629
FT                   /db_xref="GeneID:6370644"
FT                   /locus_tag="CENSYa_0464"
FT   CDS_pept        388060..388629
FT                   /locus_tag="CENSYa_0464"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575659"
FT                   /db_xref="GeneID:6370644"
FT                   /translation="MVPSAPYGYTFDTCAIINVWRNPNISTPLRMLLETEGSIVYMNSY
FT                   VVGELAVKSLGQDEAGRMLHEHLGADAGADVISTMRERAGSMLQKRLGADVSGGDVIPK
FT                   MREHAVQMEEHCPTLHSPDSIILAFAMYTKTVLVTHDKGLLAATEKMKAPCVDPNVIVG
FT                   DCSAKRRRNQFEGLVGYMGSARLGFD"
FT                   /protein_id="YP_875402.1"
FT   gene            complement(388656..391589)
FT                   /db_xref="GeneID:6370645"
FT                   /locus_tag="CENSYa_0465"
FT   CDS_pept        complement(388656..391589)
FT                   /locus_tag="CENSYa_0465"
FT                   /gene_family="HOG000106417" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="superfamily I helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="COG0210"
FT                   /db_xref="GI:118575660"
FT                   /db_xref="GeneID:6370645"
FT                   /translation="MDLDPEQRRAVEYSGPALLVRAGPGSGKTRVIVERVLHMVRNGAD
FT                   PGRILCLTFSEKAAGEMLGRLKESIDTTEMDVCTFHSFAKQILEDNEPESGIVTSRGTI
FT                   SGPAGAAWAAAHIDEFKLGSHRVVIRPHEVIRKIMEGISGFKRELVTPGELEKYLEGEE
FT                   NGELKDLCSVYQRYQGHLREMGIIDFDDMVSEAVRLFRARDDVRSEYGGRYSHILVDEL
FT                   QDANYAQLELVRLIAGNITAVGDENQSIYGFQGAYTSGFENFDDITGGAETISLNNNYR
FT                   CTKTIAGLAAQCIANTPSGSQAGAVHPEGSPVEIVECADEDSEAACIADRIVQIRSPGG
FT                   ESAGYSIAVLTRKIADGKKFSDELELRGVPARYSGGDGIFSAGPARELLTYLEIARAPA
FT                   SAGGEINLLMKKHGIPEGDIAVINTEAKKAAYNDIHGNDHVLEVIRRGGNSGVRKKAEL
FT                   AGLVRRLDKVITLAGSYSPGTLAYHIAVPLAGLFRNLEDGAGAEHLREACRLATEYDLL
FT                   DPRGGLDGLVGYLWAANSDKNLRSDADAGGAVEVTTIHKSKGREFDAVFIADAVEDRLP
FT                   LKYKGRKYQVPTTLLHGRRPQGKEKDRHMQEERRLLYVAMTRAKKNLCITYSKEYASKK
FT                   TESKPSRFLEEMQFRSNPLVRTFVFAGGPAQGAGTASTVSGLQEEAMRAVSVGDHGTAV
FT                   QKVTDLAALEYMKEHGGLDGFVPPAARSPSPGLGAGAGPAKPAPLRLSSTKIGTYKKCP
FT                   LMYWFAHVMTIPSPPGIPMVMGGVIHKVLEKITDAQMNGQTPDEAGALAMLEGQLKYAV
FT                   YDSRTSFEQSKEEAESMISWFVKWSAGSPNKPIAVEKKFELEIAGAEFRGSIDRVERTP
FT                   DGGLVLIDYKTGRTKVSPGKIAEDVQLNLYAEAAKKLYKELPEKAVLLYLESGETVEYR
FT                   LDEASVKSAIGRIEEYVDGIREGRFDPTPAVSTCMFCDYSGMCDYAV"
FT                   /transl_table="11"
FT                   /protein_id="YP_875403.1"
FT   gene            391708..392016
FT                   /db_xref="GeneID:6370646"
FT                   /locus_tag="CENSYa_0466"
FT   CDS_pept        391708..392016
FT                   /locus_tag="CENSYa_0466"
FT                   /gene_family="HOG000106438" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein L21E"
FT                   /transl_table="11"
FT                   /note="COG2139"
FT                   /db_xref="GI:118575661"
FT                   /db_xref="GeneID:6370646"
FT                   /translation="MRPMTTKKPSGRSHGFRHKSRSVMTKRAPRGVSFLLREYSAGDRA
FT                   LIIIDPRQHKGLPHRRYHGKVGTVKEAGRRAVTLDVRLGEKMKTLITRYDHIKPFGV"
FT                   /protein_id="YP_875404.1"
FT   gene            392018..392344
FT                   /db_xref="GeneID:6370647"
FT                   /locus_tag="CENSYa_0467"
FT   CDS_pept        392018..392344
FT                   /locus_tag="CENSYa_0467"
FT                   /gene_family="HOG000106439" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575662"
FT                   /db_xref="GeneID:6370647"
FT                   /translation="MEEIKKKQPVSIPEVQEILGKGDPEMMDQIQRWTYDYVSKFVTAD
FT                   PKNAKKMKQVLVKECELTEEEAVELVNIRPTSMAELRSFTFGWKKLILAETLEKILRTI
FT                   QEHS"
FT                   /protein_id="YP_875405.1"
FT   gene            392352..392927
FT                   /db_xref="GeneID:6370648"
FT                   /locus_tag="CENSYa_0468"
FT   CDS_pept        392352..392927
FT                   /locus_tag="CENSYa_0468"
FT                   /gene_family="HOG000227950" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RNA-binding protein"
FT                   /transl_table="11"
FT                   /note="COG1491"
FT                   /db_xref="GI:118575663"
FT                   /db_xref="GeneID:6370648"
FT                   /translation="MIHLQEDGQTPRRYEEHAYVLDVRRRGRSTTVRGREGTIVTAIGE
FT                   DRLTLLELLGAPDAMFKAGERVYIGKEGRKKVSSVLGKMEYGRITDSAKAELEDVVNGI
FT                   VASCEDRFVHYVNSSQPLTPRVHALELLSGIGKNYLKTILGEREKKKFESFADIEERTG
FT                   LKQPAALFSKRILEEVAGKARMNMFVKR"
FT                   /protein_id="YP_875406.1"
FT   gene            392957..393622
FT                   /db_xref="GeneID:6370649"
FT                   /locus_tag="CENSYa_0469"
FT   CDS_pept        392957..393622
FT                   /locus_tag="CENSYa_0469"
FT                   /gene_family="HOG000227962" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dimethyladenosine transferase (rRNA methylation)"
FT                   /EC_number="2.1.1.-"
FT                   /note="COG0030"
FT                   /db_xref="GI:118575664"
FT                   /db_xref="GeneID:6370649"
FT                   /translation="MRSRQAARRIADSAGISPGDTVLEVGTGLGALTRELCGRGARIIS
FT                   VERNGRLYGEASASLHCEGLELRRGDGFAVEDGFDVFVSNLPYSQSRRAVEWLVQRDFA
FT                   RGIVTVQKEFAAKLMEADPRRRRAIGVLAGHCFEMRVLFPVARSCFDPPPRVDSVVVEL
FT                   AKRRTIPGGVVRAVNGIFSYRRKTMRGIMKQFGREGGPGRLDDLSGDEIVGVAAEIAR"
FT                   /transl_table="11"
FT                   /protein_id="YP_875407.1"
FT   gene            393630..394127
FT                   /db_xref="GeneID:6370650"
FT                   /locus_tag="CENSYa_0470"
FT   CDS_pept        393630..394127
FT                   /locus_tag="CENSYa_0470"
FT                   /gene_family="HOG000106450" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methylase of polypeptide chain release factor"
FT                   /transl_table="11"
FT                   /note="COG2890"
FT                   /db_xref="GI:118575665"
FT                   /db_xref="GeneID:6370650"
FT                   /translation="MPAEDTYLLEDCIAGRSGDAALDMGCGTGYISRALGRSFGTVVGT
FT                   DVDMLSLRGGSMDRTVCCTGADALSCTFDLIVCNPPYLATDGILDRSTDGGRLGLEVPG
FT                   RMVRSAAPLLKRGGSMLVVTSSLSDYAALMGVASSCGLECTICARKKLFFEELIVIEAV
FT                   RP"
FT                   /protein_id="YP_875408.1"
FT   gene            complement(394117..395085)
FT                   /db_xref="GeneID:6370651"
FT                   /locus_tag="CENSYa_0471"
FT   CDS_pept        complement(394117..395085)
FT                   /locus_tag="CENSYa_0471"
FT                   /gene_family="HOG000021113" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="isocitrate/isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.42"
FT                   /note="COG0473"
FT                   /db_xref="GI:118575666"
FT                   /db_xref="GeneID:6370651"
FT                   /translation="MMHVLNECNIQSELVQCEAGSEYWEKHGGDSYIPADTQKLMEESD
FT                   ACYKGPTTTIPLPDAPRSVAVSTRQKFNLYANVRPIKTYERLSPERSLDFVCFREATEG
FT                   LYSGIEFDTSEDSAIAIRKTTRKGCRRIAEASFKWAKERNLKNVVAITKRNILRRTDGI
FT                   FWSEMESAASANPGIGLEEYYIDNMTQQLVKNPERFNGMVLTSTNLFMDIVSECASGNT
FT                   GSIGNVYSANMGDKYAMFEPAHGSAPKYKGMDKVNPTAAVLSGAWMAEYLGEPGIRDAI
FT                   FAATEEVINEGKYVTYDIGGDAGTKKMSDEIASRAASRLRA"
FT                   /transl_table="11"
FT                   /protein_id="YP_875409.1"
FT   gene            complement(395221..396105)
FT                   /db_xref="GeneID:6370652"
FT                   /locus_tag="CENSYa_0472"
FT   CDS_pept        complement(395221..396105)
FT                   /locus_tag="CENSYa_0472"
FT                   /gene_family="HOG000274120" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Ca2 /Na antiporter"
FT                   /transl_table="11"
FT                   /note="COG0530"
FT                   /db_xref="GI:118575667"
FT                   /db_xref="GeneID:6370652"
FT                   /translation="MLCFGGNWLVSGGVMLARRFGISSLVIGMTVVAYGTSTPELAASL
FT                   AASGEHGELILGNVIGSNIANVGMIIGISAILVFIAVSRSTLRREVPIMIGASLLLVLL
FT                   SIDGEVAGYDGIVLIGVLVAFTAYTFRGIRERSGGSAPPADGGRFYLKSGGMIAAGVAL
FT                   LGAGAWLAVENAVVLARAFGLSEMVIGTTVIAIGTSLPELVTSVVAIKRGHTDIGVGNI
FT                   IGSNIYNILMIMGVASMIAAVPVAPGVFTEYGIMICFSLVVLAAAKTGGIGRWIGAGLV
FT                   AAYAAYIVAALLA"
FT                   /protein_id="YP_875410.1"
FT   gene            396302..398956
FT                   /db_xref="GeneID:6370653"
FT                   /locus_tag="CENSYa_0473"
FT   CDS_pept        396302..398956
FT                   /locus_tag="CENSYa_0473"
FT                   /gene_family="HOG000039664" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phosphoenolpyruvate synthase/pyruvate phosphate
FT                   dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /note="COG0574"
FT                   /db_xref="GI:118575668"
FT                   /db_xref="GeneID:6370653"
FT                   /translation="MKNVYYFDEGDYKNRRLLGGKGAGLCEMTHLKLPVPPGFVITTEV
FT                   CKSYYAKKGSLPGGFMAQVKKGIKRIERDTGKGWNSRDDPLLVSVRSGAAISMPGMMDT
FT                   ILNLGLNDTTVDALSRSSGDPRFAWDSYRRFVQLFGKVVFGVDDSKFDKILDGAKKDAG
FT                   VSSDAALAEDSLRGVVKKYKEACRKHTGRSFPSDPDEQLELAIRAVFKSWMGERAIVYR
FT                   EKYGITPDVADGTAVNVVSMVYGNMGDDSATGVVFTRNPGDGTPGLYGDYLINAQGEDV
FT                   VAGTRTPEPVASLRKTMPKSYAELERTCRRLEKHFREPQDIEFTIEKGRFYLLQTRAAK
FT                   MNAVAMIKTSIDMVKEGLIGRERALVRLDAGQLEQLLHRRIDTEAAGSHERLTTGIAAS
FT                   PGAATGLAVFDVKKAAEMGEAGTSVILVREETKPEDVPAFFAAAGILTSRGGKTSHAAV
FT                   VARGMGKPCVVGASDMKIDYSSGSCSAAGTAIKDGDEITIDGSSGHVFLGRVPTIEPSV
FT                   TGGLRTILEWAGKAKKLGVRANADTPEAAKLARSFGAQGIGLCRTERMFNAADRIGLFV
FT                   EMIMAGSAAERKGILDKLGRLQRSDFAKILRVMEGYPVTIRLLDPPLHEFLPNPEELAG
FT                   RLREMKPGPEERRARTVLDRARELAETNPMMGHRGVRVGITYPEIYEMQIRAVFEAAAG
FT                   LAAKGVDARPQIMVPQVGSLSELGAVRDIYDRIRAEMEKKHSRKLKINFGTMIEVVRAA
FT                   LTAAELAGPAEFFSFGTNDLTQATFSFSREDAEGKFLPEYMEKGLLDTSPFQSIDEDGV
FT                   GRLMKMGAADGRGRRPGLEVGICGEHGGDPSSVRFCHGMGLSYVSASPHRIPIATVAAA
FT                   QATIAGRAGARGR"
FT                   /transl_table="11"
FT                   /protein_id="YP_875411.1"
FT   gene            398970..399527
FT                   /db_xref="GeneID:6370654"
FT                   /locus_tag="CENSYa_0474"
FT   CDS_pept        398970..399527
FT                   /locus_tag="CENSYa_0474"
FT                   /gene_family="HOG000106461" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="COG3620"
FT                   /db_xref="GI:118575669"
FT                   /db_xref="GeneID:6370654"
FT                   /translation="MLPRIDSIRQVRTKLGITQKRLASLAGVSTSMINQIESGRSQPSY
FT                   ETAKRIFDNLAAAEGHSSSHKAGDFCSTDIVKLRPTDTLNGAIRQMQKYGISQIPVFDG
FT                   AAPAGVVTEDGIVGYMADHGASGLKKTHVSQIMRPVPPIVDYDTPANVLVPLIRFTKCI
FT                   LVSRNSEIVGIVTALDTLKMME"
FT                   /protein_id="YP_875412.1"
FT   gene            complement(399511..399909)
FT                   /db_xref="GeneID:6370655"
FT                   /locus_tag="CENSYa_0475"
FT   CDS_pept        complement(399511..399909)
FT                   /locus_tag="CENSYa_0475"
FT                   /gene_family="HOG000232024" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methylmalonyl-CoA epimerase/lactoylglutathione
FT                   lyase"
FT                   /EC_number="5.1.99.1"
FT                   /EC_number="4.4.1.5"
FT                   /note="COG0346"
FT                   /db_xref="GI:118575670"
FT                   /db_xref="GeneID:6370655"
FT                   /translation="MEIDHVAIAVRDVEAAAKDYGRALGIEKIEYETVEGEGVRLAILR
FT                   LGDARIELMQPTGDASPIAKFLEKRGEGLHHIALRTKDIDGEVSRMEGCGINFLGGIRG
FT                   GSEGTRVTFIHPRSLHGVLAELCTTPSS"
FT                   /transl_table="11"
FT                   /protein_id="YP_875413.1"
FT   gene            complement(399909..401495)
FT                   /db_xref="GeneID:6370656"
FT                   /locus_tag="CENSYa_0476"
FT   CDS_pept        complement(399909..401495)
FT                   /locus_tag="CENSYa_0476"
FT                   /gene_family="HOG000003918" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methylmalonyl-CoA mutase, N-terminal
FT                   domain/subunit"
FT                   /EC_number="5.4.99.2"
FT                   /note="COG1884"
FT                   /db_xref="GI:118575671"
FT                   /db_xref="GeneID:6370656"
FT                   /translation="MTAKKPASTPFVTDSNFAVDRVYHRKAGGRKEEPGTYPYTRGIHA
FT                   GMYRDRLWTMRQYTGFGDARLTNERFKFMLDKGQTGLSMAFDLPTQIGHDPDVPQAEGE
FT                   VGKVGVSIASIDDMMTAFDGIPIDKVSTSMTINSTASTLLAYYIAVGEAQGVGGEALRG
FT                   TTQNDILKEYIARNTYIYPPQPSMRIIGDMIGYCAKHVPRWYPVSISGYHMREAGSTAT
FT                   QEVAFTLANAIAYIRTCLAQGLKIDDFAPRLSFFFCCTMEFFEEIAKFRVARRVYAKIL
FT                   KEEFHAKDPRSLQLRFHTQTSGESLTAQQPDNNVVRVSIQSMAAVLGGTQSLHTNSRDE
FT                   ALSLPTKESAKIALRTQQIVAHESGITKTADPMAGSYYLEQLCDEMEEGVLKYLKKIER
FT                   MGGSIRAIEKGFFQSEIRNNAYRLKKEVDSEGRVIVGVNKFKDEEEGGRELLRVSDSIG
FT                   AGQARALRSIRRRRDPAKHSAAITALQAAADTEDNLMPAILDAVRARATTGEISNALRE
FT                   VFGEYRPDEVF"
FT                   /transl_table="11"
FT                   /protein_id="YP_875414.1"
FT   gene            complement(401500..402423)
FT                   /db_xref="GeneID:6370657"
FT                   /locus_tag="CENSYa_0477"
FT   CDS_pept        complement(401500..402423)
FT                   /locus_tag="CENSYa_0477"
FT                   /gene_family="HOG000003903" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="periplasmic protein kinase ArgK"
FT                   /transl_table="11"
FT                   /note="COG1703"
FT                   /db_xref="GI:118575672"
FT                   /db_xref="GeneID:6370657"
FT                   /translation="MRYVRGGPLSLLADLKSGKRGAVAKAISSVENGAAGSRALMKSIF
FT                   RDPGDSVIIGITGPAGSGKSSLINRAAIELGRLGARPAVLAVDPTSHLTGGAILGDRVR
FT                   MAESADSGTYIRSIASRGATGAVSAHVRDITRVLEYAGFNPVIIESVGAGQTEVEISRI
FT                   ADITVVVFNPHTGDGIQAVKAGITEIGDICVVNKGDLPGAQKLQEALKEFVGSDGGPPV
FT                   LMASAKTGSGVKALARMLYKMMEAGARREGRLEEELRGVILNNIKERIDSMLDADETYQ
FT                   ECLKKVRARRMDPREAAEKVARKLVG"
FT                   /protein_id="YP_875415.1"
FT   gene            complement(402439..402828)
FT                   /db_xref="GeneID:6370658"
FT                   /locus_tag="CENSYa_0478"
FT   CDS_pept        complement(402439..402828)
FT                   /locus_tag="CENSYa_0478"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575673"
FT                   /db_xref="GeneID:6370658"
FT                   /translation="MRALLAGAAIISALVIAAVVGAAAPQEAGLGETLLIGAEYDGEAV
FT                   EITYEDRSGGTSSVTLEMLGMQESFRRTYDSSSFSETIPFAEPRYGWQAHPIILEIDHI
FT                   EYGMIHAKTEVRPAGGPAPRVIFGR"
FT                   /protein_id="YP_875416.1"
FT   gene            complement(402832..405372)
FT                   /db_xref="GeneID:6370659"
FT                   /locus_tag="CENSYa_0479"
FT   CDS_pept        complement(402832..405372)
FT                   /locus_tag="CENSYa_0479"
FT                   /gene_family="HOG000106482" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="aminopeptidase N"
FT                   /EC_number="3.4.11.2"
FT                   /note="COG0308"
FT                   /db_xref="GI:118575674"
FT                   /db_xref="GeneID:6370659"
FT                   /translation="MASGRRTGGARKAWQKAPMSYTPENYRLDYVIDLDKLTFSCSETV
FT                   RVAAPRPTSEFKLHSADLSITKASIDMPGRTVPAKIIQDEKAELLLLRSAEKVSGRCKL
FT                   NIEFAGKLKDELRGLYLSRYKSGKKTKHLATTQFEAADARRAFPCWDEPEAKATFDISI
FT                   TTGNKNTAISNMPETSKKRSGPRTKYVFATTPVMSTYLVYLGAGEFEFVSGKHGNVTVR
FT                   VAATAGKIRSARYALDLGKSILGEYEKYFGAKYPLPKLDLIAIPDFAAGAMENWGAITF
FT                   REALLLYDPKSSTTRTKQLIAEVISHEIAHQWFGNLVTMKWWNDLWLNESFATFMATKI
FT                   LDKIYPEWELWEQFVGDAMPTAMALDALKSSHPIDVKVREPSEIREIFDAISYDKGGCI
FT                   LRMLEEYVTAAKFRRGLRAYIKKFAYGNAEGGDLWDAIGRESGRPVRRMMEGWIGQTGF
FT                   PVVEAARHGSTMRLKQRRFLMGPRGKAGGRWSIPVTIGRKKPLYRTLMEKESASIPVSG
FT                   GELVLNHGRYGFYRAKYDQSCLLDLKYAVESKAIPHIDRWAVQDDLYALCLAGEATLSD
FT                   YLDMADAYSNEGGYLAAMGVSANLNSIRLRTYHEPYYHMIQARCIRHYTGMHSRLGWDA
FT                   RKGEAHTDALLRGLVISVLGRMGDEGILEEARRRFAGLRRGRPLPADLREAVYSVIAWN
FT                   GGAKEYKEIAAMYEAAPTEEERTRLLGALCHPADSKLLQKTLDYSLGAAVRPQNMHIPA
FT                   ARIAANPHGTAIVWPWMKKNWTVITKKTGTGNPLLNRIVGSLSLVADKKIEEEARLFYK
FT                   RNPAPGTEMTLRQALEASGMRRAFLARASAEFGA"
FT                   /transl_table="11"
FT                   /protein_id="YP_875417.1"
FT   gene            405376..405771
FT                   /db_xref="GeneID:6370660"
FT                   /locus_tag="CENSYa_0480"
FT   CDS_pept        405376..405771
FT                   /locus_tag="CENSYa_0480"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575675"
FT                   /db_xref="GeneID:6370660"
FT                   /translation="MGGISGGYLPCPRGGGIHQVLACIIHSWISLSPGTGSGLPARGPC
FT                   PDLTRDRSQSLLSPQGKDGIMTGLLGIAPSGRALSLLDAAGLQVWGLTWPNPARRFESI
FT                   NPGRQNCGGGGASENRRLLWATSGRYS"
FT                   /protein_id="YP_875418.1"
FT   gene            405856..408018
FT                   /db_xref="GeneID:6370661"
FT                   /locus_tag="CENSYa_0481"
FT   CDS_pept        405856..408018
FT                   /locus_tag="CENSYa_0481"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575676"
FT                   /db_xref="GeneID:6370661"
FT                   /translation="MIRAGAGMGHLMLLVAASFAISALLAPANGEAGAQMPYPQCQAVQ
FT                   KPALLGDVSAPPLSVAADKSAYSYGDIVYISGRTSSLFGSGPADTLLLINPLGNAIVVA
FT                   KPEPRPDGMLAMAVAAGGPMWAGGTYEIRVRDGTLEASDTFEYSGNITDRRPDFDPIAS
FT                   MPALSVGTDRPGYFRGDAVTVAGRIWDLSDYPQDVTITVFDNSSGDAVLPAQNPGLLSR
FT                   GFALIAAAQVSPTAGGYYESPVQTDGPQWRWAGERVVLAQYGGRQSACMFDYSATDWTP
FT                   FEFAAGGGDALDGSTIGLTPGDTLVITPNELTGNSQAAFDMEVILSDAGGSAASVYYNS
FT                   VGAFLGKTCGGEVITSGLIYTCDEKSVILGGATYSTRGTYLDSIGIPFQDGFEGTLSIF
FT                   LRDSRGVPLATHDTDRYTISAVPAGPSPELPTEPRPSPVVRSRGGGGGGGGGGGGGGAP
FT                   AMGAGLGQAVSLGFTAHGDDVLDGSEISLDPGDPLIISVSSMDGDPISIYDLEITMTGK
FT                   EGQQADVYYNRIGAFYGRECGINATTSGNMYTCDVSSLISQGSARYSHSANGSLESITI
FT                   PLEGEFSGTLSIAPRDNQGLLLAPREGSVYRVSAAELPPVEPDVPADSPPDQQIPTAHV
FT                   VDAQQARPEPDMDLEPEEPAPEPPHAAGSRARSTADSPGACHSTGTARCRVHACRTIQR
FT                   IAGTCRASGRGLSGDARGVSKICAGA"
FT                   /protein_id="YP_875419.1"
FT   gene            408103..408525
FT                   /db_xref="GeneID:6370662"
FT                   /locus_tag="CENSYa_0482"
FT   CDS_pept        408103..408525
FT                   /locus_tag="CENSYa_0482"
FT                   /gene_family="HOG000011065" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="methylmalonyl-CoA mutase, C-terminal
FT                   domain/subunit (cobalamin-binding)"
FT                   /EC_number="5.4.99.2"
FT                   /note="COG2185"
FT                   /db_xref="GI:118575677"
FT                   /db_xref="GeneID:6370662"
FT                   /translation="MKQKSVSRSIKILVAKLGLDGHDRGALVLCRAFRDAGMEVIYSGL
FT                   FATPERVARMAEDEDVDAIALSLLNGAHGTLFPRVVKAVEKKGLKDVLIVGGGIIPEVD
FT                   IKKLEKAGIDGVFGPGTTLPEVIDHITAGVKRLRKV"
FT                   /transl_table="11"
FT                   /protein_id="YP_875420.1"
FT   gene            408568..409836
FT                   /db_xref="GeneID:6370663"
FT                   /locus_tag="CENSYa_0483"
FT   CDS_pept        408568..409836
FT                   /locus_tag="CENSYa_0483"
FT                   /gene_family="HOG000106488" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   system, periplasmic component"
FT                   /transl_table="11"
FT                   /note="COG0683"
FT                   /db_xref="GI:118575678"
FT                   /db_xref="GeneID:6370663"
FT                   /translation="MKISAVIIGAIGLAAGLSVGLSLGFSYAGTDAGGPAISFEQPAGS
FT                   MVPSGTVNIGLVVPLTGEISTIGNDNEMAARLAVEDFNLYLDKIGAGWEFNLVVEDSQA
FT                   DPIVALEKVQSLNSKGIQLVLGPDSSTELRNVKSYTGSNGMLLISSTSTTPTLSIDDNI
FT                   FRLVPDDTQQGRAIATLAESRGITTLIPVHRGDVWGDGLYESTKTWFEARGGTFDEGIR
FT                   YSPENSVFSIEAYLLSERLAGYLQERPASEVAIVMMTFEEGVHIFQSASSYDELRSVLW
FT                   IGTDTLSNNGLLVEDSITAGFLSDVDFVSGQFAVSENDHYNRVKGILTDRMGSSPANYA
FT                   YPTYDSVWLIGLGILQLQTTDSELLIEALPMVASHYSGALGAVILNDAGDLAISDYGLF
FT                   AVRDGKWVDYGLYDARTDTVIVR"
FT                   /protein_id="YP_875421.1"
FT   gene            409898..411667
FT                   /db_xref="GeneID:6370664"
FT                   /locus_tag="CENSYa_0484"
FT   CDS_pept        409898..411667
FT                   /locus_tag="CENSYa_0484"
FT                   /gene_family="HOG000007703" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="oligoendopeptidase F"
FT                   /EC_number="3.4.24.-"
FT                   /note="COG1164"
FT                   /db_xref="GI:118575679"
FT                   /db_xref="GeneID:6370664"
FT                   /translation="MQKHVLGEWDLTELVRDPRGPAFERQEGDVLARAKKFQRHRKSLD
FT                   PSMERKKFRDILDELESIHEKTSIVHGYASLDYSADTQSDKATALLSRAGKMGADVANS
FT                   LVFFDLWWKKTIDDKNARRLIKESGDLANLLSHKRLVARYSLTEPEERIINTLDVTGAS
FT                   ALVKLYDKITNAFLYEVRVRGKKKTMGREELVTLVRGTDAAARESAYRSLLGKYESNRG
FT                   VLGEIYQNIVLNWRDEGVDIRGYDSPISMRNTANDIDDATISSLLKVCKGNARVFRDFF
FT                   SLKAKMLGMKKMRRYDLYAPAAKDGEKNYTYDKSVKLVLESLERFSPVLSEYASRVFES
FT                   RHVDSSVRKGKRGGAFCSTISPGITPYVMLSFDGKSKDVFTLAHELGHAVHSISASKRS
FT                   ILVQEAPLPLAETASTFSELLLYDNLSDSMPDDEKRSMLVEKVDDLYASIMRQSFFTIF
FT                   EMEAHKLIAGSATVDELSGAYLGGLRGQFGSSVDVSDDFAIEWSCIPHFHHAPFYCYAY
FT                   SFGNLLALSLFRRFKKEGDDFVPSYLAILSSGGSQKPEKLLAEHGIDISSEKFWQDGFD
FT                   QIREQVRSLAKLR"
FT                   /transl_table="11"
FT                   /protein_id="YP_875422.1"
FT   gene            complement(411900..412481)
FT                   /db_xref="GeneID:6370665"
FT                   /locus_tag="CENSYa_0485"
FT   CDS_pept        complement(411900..412481)
FT                   /locus_tag="CENSYa_0485"
FT                   /gene_family="HOG000106499" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ferritin-like protein"
FT                   /transl_table="11"
FT                   /note="COG2406"
FT                   /db_xref="GI:118575680"
FT                   /db_xref="GeneID:6370665"
FT                   /translation="MADTKPHVVGIEVLKQAGLDVDALIKQLVINSSVEFAAYYYFTLL
FT                   RAHCVGVEGEGIKYVIEDARMEDLSHFESSIARIYQLGGTLPIDPIDYIKMSGCEFLQL
FT                   PKKRTDHMEIMKKCLKAEQGAIVNWLKVCKMTEGKDPMTYDIAKDILAEEIEHESWFLE
FT                   LIYGRPSGHMRRKFPGERPHTSKHSTALDM"
FT                   /protein_id="YP_875423.1"
FT   gene            complement(412561..412776)
FT                   /db_xref="GeneID:6370666"
FT                   /locus_tag="CENSYa_0486"
FT   CDS_pept        complement(412561..412776)
FT                   /locus_tag="CENSYa_0486"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575681"
FT                   /db_xref="GeneID:6370666"
FT                   /translation="MNSTQNAASSRRRFNGVAPRLCGIKLVGAALHGALRYRASIALRT
FT                   CAVFAPGHNFPPGTPLCKVWSPGPCD"
FT                   /protein_id="YP_875424.1"
FT   gene            412775..413887
FT                   /db_xref="GeneID:6370667"
FT                   /locus_tag="CENSYa_0487"
FT   CDS_pept        412775..413887
FT                   /locus_tag="CENSYa_0487"
FT                   /gene_family="HOG000106510" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575682"
FT                   /db_xref="GeneID:6370667"
FT                   /translation="MPLAASAQELRFATFQETAQVLVDAGASNVTASVTLQSTSEREMK
FT                   VPPEIADRITGDENIASVVLTNEDVCVLGVSGESCILVNVARNPDWGGISGTQEAAKII
FT                   GDSLIGELNDFFDTQASFHSVFLHHSDDVNVAFDTSGAVSGRGTVSAVYTMPREATDSM
FT                   YEKISALLLSQEIRASGGFYDAARGLAADESSSMSFAIIRGGPLYQLKVSLVQGGSPGD
FT                   VINPLEYLQAETLHRSEHFSGGFFPLNSIVQVAVIGKGGITGVSPGLVDFDVVEDTPIP
FT                   TDLTQTGWIDQSAEGAGEMVFLFGERNSVGSGELAVMLGENPAAPPRPGLIDGIPDESL
FT                   VVLIIAVAGASGAAALFLRGYKRAPGSRAR"
FT                   /protein_id="YP_875425.1"
FT   gene            complement(413884..414450)
FT                   /db_xref="GeneID:6370668"
FT                   /locus_tag="CENSYa_0488"
FT   CDS_pept        complement(413884..414450)
FT                   /locus_tag="CENSYa_0488"
FT                   /gene_family="HOG000012204" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="pyruvoyl-dependent arginine decarboxylase 2"
FT                   /EC_number="4.1.1.19"
FT                   /note="COG1945"
FT                   /db_xref="GI:118575683"
FT                   /db_xref="GeneID:6370668"
FT                   /translation="MTDLELLDLVAKKLFLTKGKGVHEDKLTSFEYALRDAGISGTNLV
FT                   LISSIFPPKAKLVPKSEGLKLIRHGQILFTIYSKNQTSEPHRLVAASVGVARPKDPDRY
FT                   GYLSEYESFGQSEKTAGDYAEDVSAQMLASSLGIPFDIDKSWDEKRQQWNISGEIYKTQ
FT                   NITQTAVGNKDGKWTTVFAAACLLF"
FT                   /transl_table="11"
FT                   /protein_id="YP_875426.1"
FT   gene            414568..415104
FT                   /db_xref="GeneID:6370669"
FT                   /locus_tag="CENSYa_0489"
FT   CDS_pept        414568..415104
FT                   /locus_tag="CENSYa_0489"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575684"
FT                   /db_xref="GeneID:6370669"
FT                   /translation="MVGYYVLTVGASLLLVRETRSRLRDLRKGLRSAWYAPLPFGVVLV
FT                   YVIVGFGPLDEIPILNWSWLGYNIAFGPYAGEGIWGILPFVPLLVYMFIHINYIEELYF
FT                   RKSKKMVVAWALLHIAMGIKVHTALILIPIGFLFKYIYDKKGVRHAYAMHFAANTLVVV
FT                   SLLLTTVAQAGFLGE"
FT                   /protein_id="YP_875427.1"
FT   gene            415380..415453
FT                   /db_xref="GeneID:6370670"
FT                   /locus_tag="CENSYa_0490"
FT   tRNA            415380..415453
FT                   /db_xref="GeneID:6370670"
FT                   /locus_tag="CENSYa_0490"
FT                   /product="tRNA-Thr"
FT   gene            415609..416913
FT                   /db_xref="GeneID:6370671"
FT                   /locus_tag="CENSYa_0491"
FT   CDS_pept        415609..416913
FT                   /locus_tag="CENSYa_0491"
FT                   /gene_family="HOG000268807" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="superfamily II helicase"
FT                   /transl_table="11"
FT                   /note="COG0513"
FT                   /db_xref="GI:118575685"
FT                   /db_xref="GeneID:6370671"
FT                   /translation="MTKFEELGIKQNVLDALRDMGFEKAFPIQEAAIPVLLTGRDVVGQ
FT                   AHTGTGKTGAYSISMLQEIKEGGGIQGLIVAPTRELAVQITEEVKKFAKYTKVRPVAIY
FT                   GGQSMGVQLDALKRGAEILVATPGRLIDHIKRGSISIDRVTHLVLDEADTMLDMGFIDD
FT                   IQFILDLTPDEKVMSLFSATMPIEILRLSEEYLKNPKQFLLDADDLSGEGIDQSYLVIR
FT                   DREKMDYLVDFIKENGKGQTIVFCSTKYRTRDVARMLHKRNYGAVAIEGDMSQHRREQS
FT                   MSRFRTAKAQILVATDVAARGIDVPRVALVVNYDVPNQEMIYFHRIGRTARAGAKGRAI
FT                   TLVSYSSVSEFDVIKRQIKAKVTYLNDEMGIVVKIPDPLKRESARRRGGPQRLGQRRQS
FT                   RERSDPRDERRRSARRKSGAIRHGPGYYRGLKSRW"
FT                   /protein_id="YP_875428.1"
FT   gene            416951..417175
FT                   /db_xref="GeneID:6370672"
FT                   /locus_tag="CENSYa_0492"
FT   CDS_pept        416951..417175
FT                   /locus_tag="CENSYa_0492"
FT                   /gene_family="HOG000106521" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575686"
FT                   /db_xref="GeneID:6370672"
FT                   /translation="MKIRCPRCKGAAELFSDFTAVKCDGCDLDMSYGEYVRYVAHSDST
FT                   YSDILGDYTGSTSGQAAGTLDEWDAQDQS"
FT                   /protein_id="YP_875429.1"
FT   gene            complement(417226..418275)
FT                   /db_xref="GeneID:6370673"
FT                   /locus_tag="CENSYa_0493"
FT   CDS_pept        complement(417226..418275)
FT                   /locus_tag="CENSYa_0493"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575687"
FT                   /db_xref="GeneID:6370673"
FT                   /translation="MRSLAVLLAAAGMISLGGIIAPAGGTAEISLPADSAPAPQDAGHA
FT                   GTEPGKARINVFASESYLPLPFKISATEWIIEGRILNGTVMERWSAMGYRDEDAEYTVN
FT                   VDTVYMVEVMEVLRGSMEKKIISVAVTGGETERYSMNYDRHEVIPGEHFIMFLSEGSCR
FT                   TRHLSDFRTIAPSGGLYLVEGGIAKNNVESESLPADDLRWEIAWLAWMPKFDVPGVIKR
FT                   PCLDQSVYEAAHEEDMREGRMRSLWPFENSTYGSVEGHMDELMGLPEVKAFHEMYEGRD
FT                   ITFSDMSTASVRLGFVAQDGDRSAHLIIGYYNREASDFSHVCIDEDPRRLLFEEEGVRT
FT                   DCFVDPGAP"
FT                   /protein_id="YP_875430.1"
FT   gene            complement(418429..418626)
FT                   /db_xref="GeneID:6370674"
FT                   /locus_tag="CENSYa_0494"
FT   CDS_pept        complement(418429..418626)
FT                   /locus_tag="CENSYa_0494"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575688"
FT                   /db_xref="GeneID:6370674"
FT                   /translation="MQRVYTDVSGVLPWQGCAAGGLSFECPRARRRIPGPASAGCGGTY
FT                   GAGSYMRKSAGSFYASCRLG"
FT                   /protein_id="YP_875431.1"
FT   gene            complement(418681..419301)
FT                   /db_xref="GeneID:6370675"
FT                   /locus_tag="CENSYa_0495"
FT   CDS_pept        complement(418681..419301)
FT                   /locus_tag="CENSYa_0495"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575689"
FT                   /db_xref="GeneID:6370675"
FT                   /translation="MDTAPDPAVINRLRCSLQFLRLSRHAPSRAACTGLRAGQGPLRPR
FT                   PEPLQEPCQPYRYLRHGKPDGDVDECHGNDGSRLIANQRPCGSVKEQHRKGRGVEGIAE
FT                   PVERRFRRKEQVPERGKRQVQQPCPVTPVKKARRGALHDVPASFPPASVVARHMQYVTG
FT                   GVLYTLAAGRQGWYLTLAVPRPQSGRWNRRPRHLWPGAQSPDS"
FT                   /protein_id="YP_875432.1"
FT   gene            419300..419587
FT                   /db_xref="GeneID:6370676"
FT                   /locus_tag="CENSYa_0496"
FT   CDS_pept        419300..419587
FT                   /locus_tag="CENSYa_0496"
FT                   /gene_family="HOG000106532" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575690"
FT                   /db_xref="GeneID:6370676"
FT                   /translation="METIEYEGTVWAINHNNPEPLVEHSIKKLQDYGVKKEDIKLTDAP
FT                   DDIKVGAIVVEMWPHHLDVTRIRTVRNESFISGTVMTIQLNTDAAGKYID"
FT                   /protein_id="YP_875433.1"
FT   gene            419650..419841
FT                   /db_xref="GeneID:6370677"
FT                   /locus_tag="CENSYa_0497"
FT   CDS_pept        419650..419841
FT                   /locus_tag="CENSYa_0497"
FT                   /gene_family="HOG000070674" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="cold-shock protein"
FT                   /transl_table="11"
FT                   /note="COG1278"
FT                   /db_xref="GI:118575691"
FT                   /db_xref="GeneID:6370677"
FT                   /translation="MEQGTVKWFNRTRGFGFIERETGADLFVHKTNIDGNLRDGDKVEF
FT                   EVGEGPKGPSAVNVKKAE"
FT                   /protein_id="YP_875434.1"
FT   gene            419938..420420
FT                   /db_xref="GeneID:6370678"
FT                   /locus_tag="CENSYa_0498"
FT   CDS_pept        419938..420420
FT                   /locus_tag="CENSYa_0498"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575692"
FT                   /db_xref="GeneID:6370678"
FT                   /translation="MKGKGAVLAAVAAAVILAAVGYNYHADQLRISGGIFGNELQAIQD
FT                   DLTAQQDLFSAELASYEGGSSTRAEFLAASEGHFVEMDGILDRYDSLRPPPAFESSVEL
FT                   FRLSTESQIGRDQEVVLWVETGDPSHNLRADELHQESFAYELAALADYKAAQSGAR"
FT                   /protein_id="YP_875435.1"
FT   gene            complement(420423..420884)
FT                   /db_xref="GeneID:6370679"
FT                   /locus_tag="CENSYa_0499"
FT   CDS_pept        complement(420423..420884)
FT                   /locus_tag="CENSYa_0499"
FT                   /gene_family="HOG000106543" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575693"
FT                   /db_xref="GeneID:6370679"
FT                   /translation="MTTWRLEQEEYYLRILDGKKNIAGYFDPDYGEIVPKEREEELIDA
FT                   MWRNHDPVPGGHMMVGMVKFGIFQGDYNSDITGLEERLGDAATRISQWKEYLSGGDIPY
FT                   HYVNISHTDQDMLTVTFPVRFAEPAPLGEKGLRAPLSPVLDGLQRHGLV"
FT                   /protein_id="YP_875436.1"
FT   gene            complement(420881..421621)
FT                   /db_xref="GeneID:6370680"
FT                   /locus_tag="CENSYa_0500"
FT   CDS_pept        complement(420881..421621)
FT                   /locus_tag="CENSYa_0500"
FT                   /gene_family="HOG000106554" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="protein-disulfide isomerase"
FT                   /transl_table="11"
FT                   /note="COG1651"
FT                   /db_xref="GI:118575694"
FT                   /db_xref="GeneID:6370680"
FT                   /translation="MSAKTGNSRYLVGGLVAAVVAAAFLGGYALGGETAPASAQYQAAP
FT                   AAPAAPVAAPPRPDAGQLVFASTDDDPVKGSPDAPLTVIEFSDFQCPFCNRFYQDTLPQ
FT                   LEREYIDTGKVNLVFRDMPLDIHPNALPAHMAAECADGQGAFWEYHDLLFDRAGQWGRL
FT                   GPADLIEQLGAYADELGVGSGFDECMVMPDTVSEVRKDLAQGSGYGVTGTPTFFIGNDD
FT                   VGYTKVSGAKPYESFRSIIESKLG"
FT                   /protein_id="YP_875437.1"
FT   gene            421755..422075
FT                   /db_xref="GeneID:6370681"
FT                   /locus_tag="CENSYa_0501"
FT   CDS_pept        421755..422075
FT                   /locus_tag="CENSYa_0501"
FT                   /gene_family="HOG000106565" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575695"
FT                   /db_xref="GeneID:6370681"
FT                   /translation="MGIPEEIKGYIEGQIDYYISEAGSYRQIAEEYTPEVGSVPDAAFG
FT                   IIAGCVYSAFLQAYQGRGMSPSLVDMREFNVLLKGRAPLIKGAILGSLPGHQKDHKPTA
FT                   RT"
FT                   /protein_id="YP_875438.1"
FT   gene            422198..422518
FT                   /db_xref="GeneID:6370682"
FT                   /locus_tag="CENSYa_0502"
FT   CDS_pept        422198..422518
FT                   /locus_tag="CENSYa_0502"
FT                   /gene_family="HOG000106576" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575696"
FT                   /db_xref="GeneID:6370682"
FT                   /translation="MSEINEFKVQQIVDNGRVIQLSLVENVQTEQISQKQMIQESISKN
FT                   LDSETRGQIMPILNAILQAQPTIKIKSYQQTGINITMPRNRYERMGRPQVGQIVEVDLR
FT                   KK"
FT                   /protein_id="YP_875439.1"
FT   gene            422559..422729
FT                   /db_xref="GeneID:6370683"
FT                   /locus_tag="CENSYa_0503"
FT   CDS_pept        422559..422729
FT                   /locus_tag="CENSYa_0503"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575697"
FT                   /db_xref="GeneID:6370683"
FT                   /translation="MLGGEIRDEMRHGINEISDHSDDFAAAGPVGIFSLLMALADMLLG
FT                   AAGLLLMLFRR"
FT                   /protein_id="YP_875440.1"
FT   gene            complement(422726..424756)
FT                   /db_xref="GeneID:6370684"
FT                   /locus_tag="CENSYa_0504"
FT   CDS_pept        complement(422726..424756)
FT                   /locus_tag="CENSYa_0504"
FT                   /gene_family="HOG000231201" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thioredoxin"
FT                   /transl_table="11"
FT                   /note="COG1331"
FT                   /db_xref="GI:118575698"
FT                   /db_xref="GeneID:6370684"
FT                   /translation="MGYAVPNSLIHETSPYLLQHAQNPVEWYAWNKEALGRAVDEDKPI
FT                   FLSIGYSACHWCHVMAHESFENENIADIMNENFINIKVDREERPDIDDIYQKGCQLATG
FT                   QGGWPLSAFLTPDRKPFYIGTYIPPSSSHGRNGFESILRQLSQAWKEKPGDIKGTAEKF
FT                   LETLRGGERATAPAEPDRSVLDEAAVNLLQMADTTHGGFGRAPKFPGSANISFLFRYGK
FT                   LSGISKFTRFALLTLDRMARGGIFDQVGGGFHRYSTDERWLAPHFEKMLYDNALIPVNY
FT                   AEAYQVTGSPAYLRIMEKTLDYVLRELSSPEGGFYSSQDADTEGEEGRYYVWSKKEVKE
FT                   ILGADADAFCMFYDVTDGGNWEGKTILYNGAAPSAVAFQCGITVGELDGIIERSAAKLL
FT                   EARSGRVPPGLDDKVLASWNSLMVTALARGYRASGEARYLDAARRCLGFIDAKMHRDGA
FT                   LMRTYKGEARIPGYLDDHAYYGCALLDAFEVDAEERYLRRASEIGSHLVQNFWDEERGG
FT                   FFMTSDVHEGLIVRPRSGYDLSLPSGNSAAAHLMLRLYHLTGDESCLKTAERTMSSQAQ
FT                   AAAENPFAFGHMLNVMYMHILGPAEITVLDKGGEIPRGLAEKFLPEALLINVASQGQLD
FT                   ALSRYPFFAGKSFGGNSTAYICRNKTCSAPQDTMNGVEALL"
FT                   /protein_id="YP_875441.1"
FT   gene            complement(424788..425123)
FT                   /db_xref="GeneID:6370685"
FT                   /locus_tag="CENSYa_0505"
FT   CDS_pept        complement(424788..425123)
FT                   /locus_tag="CENSYa_0505"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575699"
FT                   /db_xref="GeneID:6370685"
FT                   /translation="MKHNAPVSRFWACFFAGSIFALFWTLKMKKTRRWLVVSLLSIPIN
FT                   MLIAYAAGEGYYAAEWTISHYYMLGVDLGFLALVIYLMYGWSTAYNMEKFGCSSRGQWN
FT                   GAPPAGA"
FT                   /protein_id="YP_875442.1"
FT   gene            complement(425326..425631)
FT                   /db_xref="GeneID:6370686"
FT                   /locus_tag="CENSYa_0506"
FT   CDS_pept        complement(425326..425631)
FT                   /locus_tag="CENSYa_0506"
FT                   /gene_family="HOG000225449" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="COG1522"
FT                   /db_xref="GI:118575700"
FT                   /db_xref="GeneID:6370686"
FT                   /translation="MLNILESAYTSMALELAPETRHSAFVLINCDLGCKEEIISDLQKI
FT                   GGVENARETFGAYDIVAEVHAGSESELREIITWRIRRLGRVRSTLTLKGIEGQSYR"
FT                   /protein_id="YP_875443.1"
FT   gene            complement(425717..426382)
FT                   /db_xref="GeneID:6370687"
FT                   /locus_tag="CENSYa_0507"
FT   CDS_pept        complement(425717..426382)
FT                   /locus_tag="CENSYa_0507"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575701"
FT                   /db_xref="GeneID:6370687"
FT                   /translation="MAASRNTDLQAEKLLHLIRSSKGAYMGDLRGILGISQEEMSGLAT
FT                   RLKMDKSVEIKEVHRGGAFFDFMLTYRESTGMPREGPEKDGLESDDDTEPRAVHVPTAV
FT                   AVWIAAATLHREHGKEESFTKDAIISKVREQELCSVSDSTIETHVTNLCVANSAASRGG
FT                   SPHRKLYRTGRGMYRLYKRGERFHPSRKSGPITPKPSRIPEEYADLRKWYSEVYCSRR"
FT                   /protein_id="YP_875444.1"
FT   gene            complement(426495..447083)
FT                   /db_xref="GeneID:6370688"
FT                   /locus_tag="CENSYa_0508"
FT   CDS_pept        complement(426495..447083)
FT                   /locus_tag="CENSYa_0508"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="WD-40 repeat protein; COG3391"
FT                   /db_xref="GI:118575702"
FT                   /db_xref="GeneID:6370688"
FT                   /translation="MQGRSHGYCFVSGCPPPMIRAKRSAGILMVMAAAALAGAAAFPEA
FT                   YGHPIGSTEDPGEGHRTNNQDLHHTVLKYTYGSVPPGGGTPGLDLYSSQALIGDSYRRI
FT                   EIFANNEKVPLPAAYGGYGVKMYETEFGISYSGGRPALNYRVQEVSQIPAGAFSIMEGY
FT                   FPGFPDALRSFSCDDRTHTHNQDETYVLNGQIAEFRHSFFPYSQKITYTDGTEECIIPG
FT                   ALDGDEGILTQLNFNSDRLRPYVPKGEISSVETVRMSPDSVIEMTRTLECTSSSCRNPD
FT                   HVDFGFELDPQTFWIWCDVEDETLDPRCMANSTLTGDFVFELPGTHDADEVLAAAGHSP
FT                   DLTIRGGAVCVDPSEFGTVNRPMPGEFYPDNCGYVLPQDVIRPDPTPYVVSVQLDAGLG
FT                   TLRIVFDRPILSVDGAGMRIADAGGIGEIAPSGNRIEGTPPEVVELPVNASSLGAAALF
FT                   ADPRLYFSPSAVTSEVGAFPAGHEIPSPRYLRTYTTGTELSEDRAVAFSKDGLFMVIAG
FT                   RLFTYMGLPTQLDWIYPYVMTEEFDLSTAGRSGQSLDISSVTGIINYISFSDDGLRMFA
FT                   TGQQTTRAIQYELSDPYNVLSAESHRRSDPIPGLGKLYGLAFSLDGRQMYAIGRTDTIY
FT                   QFPLAEKFMVDTANISDARSFDTSGNVDDGRGISITPDGNTMHISDRNGSKVHTYSLNT
FT                   KNDISSAEYLSSFSLEPQTSRAYGLTFSPDGRFLFAVSFEGVHQYELSRPHDISGPEQN
FT                   LAALDVHGDSPSGMFIVPGGSSLYVTDDSQGSVRWYNMPTEYDLSTATLQRTQTTGWQE
FT                   SPKGVYFPAGRAEMYTVGSSPPFVHRLTLPGEYDTSSITVHSMLNVSLRDINPVGVALS
FT                   DDGTKIVVAGGAGGTIHQYGLSTPYDVTGAAYEAGLELDGLTPTDLYFSRTGGALYVSD
FT                   DDGQVHHYALDAAYNIINATRVGSFLTGTESLQALSFSDDGRTLFGLDGGTRAVASFEF
FT                   GGYPARRTAALNGSDGPMLEEITVEVPTRFIAHLIPGDRLALSDVALKDGEQVARARDA
FT                   PGVGEISRITRIVTAGDAPSVGILGDAVIPGKLNPRDGPVLDDDVLRIVMFDAMARDAP
FT                   DVNSDAAAIPPRGESPVLVSAVLDLADILSIVFDRPVDHSTVNASRIHIRDGGAAGLTM
FT                   VQSELAAPGAENTVSFRLSADRRGEISNHSNPRLHFDAGALNATDRGIFPEPFVLPLPA
FT                   QKGSFDVAAQDRTPQGVAFSPDGMIMLVAGTGSDSIHRYDLPRAYDIEAAEYSTSLETP
FT                   GLDPVSLAFADSGRLLITLGGFAGPVRAYEMTDPYNISTAAPTGGILSPAGREHEPRGV
FT                   AISPDGLSIFVTGQGSNSVHQYSLGTAFELSTASYRKSVSVVDQEANLQGVAFSAGGGL
FT                   MFLTGTISDLLHMYELDSSFDLAGASYAGSLDLRAGGGMPTDLAFSSDGRLVFISDSSS
FT                   DSIYRYELDNPYSFDVSPTDSYGLPDGAPTGAAFSADGTLMLISGNGGDAVYGFTLDPP
FT                   FDLSGIESAGSFSTAGEDTNPRDVDLSADGGSVFVIGRETNSVYRYDLASPYDITAPTP
FT                   NGSFFVGGSEGTPNGLAFTADGEGLFITGFAGDTVYEYGLAGPYDLNSSVPTDSLVGSF
FT                   NLGARGDRPTDVYFLPGGNVMLVASDDRGFVLRYELGAAYDIDTAEYAGSFSVKNQGRS
FT                   PTGLAYSADGLHLFFTDPGTDSIHWYELGTYPVGIVLSGAASDSPLFSDGASAVTTPRP
FT                   RVTSVTADADGVLSIAFDQLIDHSTVNASRIHVRDSNSTAGLTLLEVELADPADNNTIS
FT                   FMLPDERLREILGYSSPRLHFDADALRDATGDPFPVPFALPLPAYGGAFGVAGQVETAH
FT                   GVAFSPDGMRMLLAGTGNSSVHQYELPKAYDVTSAEYTGIFFETPGIDPVALELADGGR
FT                   LLLVLGGTADRVHAYSLAEPYDISGAAKTGDTLPVRPQEQAPRGIAVSPDGMRMFITGQ
FT                   LSDAVHQYELGTAFNISTAAYSGDSASIAGQEGSAQGVAFSADGTLMFITGTSSDSLHR
FT                   YELDDPFDLSGHTYAGSLFMRNNLGTPSGLAFSADGRLVFISDMNSGAIHEYELDGPYG
FT                   FGGPPVSMYGLSDSEPTGMALSADGTVMVVSGNGGDMVYGFALDPPFDLSAPVPIESFS
FT                   TSFQDSSPRDVDFSADGSSLFIIGRQFDRVLRYDLASPYNITAPPVAGFFSVFGSETAS
FT                   TDFAFTPDGTVLFVVGVTEDTVFRYNLAGPYDLGGSRPSESLVRSFSVRDQGNNPTGLY
FT                   FSPDGHVMLTISDSRDAVLRYELDSAHDTDTAEYAGSYSVRDQGRSPTGMAFSSDGLRL
FT                   FFTDAGADAVYSYQLGTHPIGIRAAAPRDLNITGDDAPGVIDGGKPKVLGKDVAEGTSK
FT                   PVVSDGAITARMGTISGDDAPGVIDGGKPKVMGKDVAEGTSKPVVSDGAITARMGTISG
FT                   DDAPGVIDGGKPKVMGKDVAEGTSKPVVSDGATTARMGTISGDDAPGVIDGGKPKVMGK
FT                   DVAEGTSKPGVSDGATTARMGTISGDDAPGIADDGAPRVEGKHVAEGTSAPVVSDGAEH
FT                   TGVDGIVATARQVVSTVLYSSGVLEITFDGLVNAGNVEHGLISIADGYAPAGRIPLSIG
FT                   EFEQAVDNSLRYVLDGNKLDLVRDYADPRLRVEIGALGQGLPDIGYRLPDSLYPYGLDT
FT                   ASINLNNTEGSPQGLAFSADGRIMITVGLDQNTIFRYVLEQPYDISSARIDGSHNVNAQ
FT                   EEDPRGLAFSADGLGLFVAGGSGNIHQYALATPFGFSPAPVPGGSFGAAEDGLVTGVDF
FT                   GRNGTRLYLSGADNGAIQQYNLSSPYDITIQPVHAGNFSTVLQDDLPRGVTVSEDGRNM
FT                   LVLGGEDDRVYMYGIDEPHDISTAGYVGSLLVRSQDNNPEGMAASADGRLLFVTGTQRD
FT                   EVHRYDLGAAYDVARDRAGNGPTFNLYHRDDNPDGPGRNPTGIEFSSDGLQMFISTHAA
FT                   GTVQSYDLAVPYAVTTAAAADSYTTAIAPGLTRDRPFDVEFSADGLWMFTTGRDGQNVY
FT                   SYTLDTPYNITSAVQNDTYEITTAQNNAQMDVVFSPEGTIMLLAVENPGFIQEYNLSSP
FT                   FDISGAVEAPFSIQDGLNPVGLAYSSDGHRLFIVDNTETVHRYDLLTPYTLKGSLFIDS
FT                   EVFNDEPNSNDMAFSGDGRKMFIVGSRNNNVETYNLTSPYDVTSSARAAVIAVTDGSNP
FT                   TPSDISVSNDGGSVLVFNNLRDMVHDYTLRQPYDLHTSVQSDDSPSIRPQDTNVNAMEF
FT                   SPNGTLMFLAGWDVPSASINPDRVTGRAIHTYSLSTAFDVSTAQLAGSFITGSAANAPS
FT                   GDAAVTSPSAIRFSSDGTDLFMIDETDRLIHHYILSNPYSLDNTTAYVESLNVLARDTN
FT                   PTGLALSSDGKRLFMTGVSSDSIHRYDMTAAYNLSTAVYTGLINVGMLENDLRGIAFSE
FT                   DGSRLFFVGQQRDLVYLFDLAGPVPIHVLAGDAPDLNVSMPTAGIERISAGDAPGVSDS
FT                   PQTAKLAVIMEDDAPSINDDDAAAVILGDAIARSTPGVDDGATAVLGTDAIARSTPVVD
FT                   DGATAVLGTDAIARSTPVVDDGAAAVLGTDAIAKSTPVVDDGATTARMVKISKGDAPGI
FT                   DDGGMAGDAVAVGRSTPGVDDGATAELIIEVPERPPSPVLLSASINNANMLDIVFDLPI
FT                   NHSTVDASRIHVRDGNDADGITLSEVNIASSGTGSTVSFGLTMEGREEISSYANPRLHF
FT                   DADALNDENGTSFPEQFALPLPRYGGALNVSAQQNGPQGVAFSPDGTRMLVAGTNSSAV
FT                   HQYDLTEAHDVTSAEYAGASFATAGIDPVALVLADGGRLMLILDNDTVHAYSLAEPYEI
FT                   VNAALTGDTFMVQSEAPAPRGMAVSTDGLRIFIVSGGGAVHQYSLGTAFNIGTAAYSGV
FT                   SIDVSGREGSPQGVAFSADGRLMFIAGQGSASLHRYELDGAFDLSGHSYTGSLDARDAG
FT                   AVAGLAFSAGGRVAFMPDSSGAIHQYELDGPYSFDGPPTGTQAPLDKSATGMAFSADGT
FT                   HMLITGVDRRAVYRYTLDQPFDLSTSGFLSSFSISDADGSPQDVVFSTDGGSIFIVGKQ
FT                   RDRVHEYELVSPYDTDPPPTRRGSFSVGDAESAPSGIAFTPDGEGLFVVGTAEDAVHEY
FT                   RLAGPYNLSGSTPSDSLVGSFSVAQQGENPTGVSFSGDGRVMYVLSLAAKHVSRYELGS
FT                   PYDVGSMEYAGSFRVAQQGNNPEGLAFSPDGLRMFFTNAPGVVLGSGSAHWYQMGTYPV
FT                   DLFSAADARDTPQVYDAASAVAPGIPVLLSAAIDKTGMLNVTFDQPINHSSVNASRIHV
FT                   RDGNETAGITLSGLANLGSNETVSFNLAGEGLAEILGYASTRLHFDAGALSSNFEKSFP
FT                   QQFALPLPAYRDEFSVGGQEGSAQGVAFSADGMRMLVAGSGSNSVHQYNLREAHDVTSA
FT                   VYRGTSLATTGISPVALALADGGRLLLVLGGTDDRVHAYRLAVPYDVGGATRSGETFQV
FT                   RQEEQAPRGMAISPDGLRIFIVGAGSDAVHQYSLGTAFDISTAVYSGDSISVAEQDGRS
FT                   QDVAFSAGGTLMFITGADSLSLHRYELDDPFDLSGHSYTGSLHVGKDTGVPTGMAFSPD
FT                   GRRVFISDSGADTVNEYKLDGPYSLAGPPTGTFGLPDGEPTGVAFSDDGTIMLISGNVR
FT                   DAVFGYELDSPFDLSAPVSIGTFSVSAEDDNVRDVELSADGGSVFIIGRQRDSVYRYDL
FT                   ASPFNITDPSFNGSFFIGDSESGPTGLEFTPDGEGLFIVGTAEDTVQEYRLAGPYELVG
FT                   ADPASSLARSFSVRGQSDNPTAVSFSPDGRVMFAASDAGNAVLRYGLSSAHGIDTAAYT
FT                   GSFSVDGQDGIQTGLAFSSDGLRMFVTKQDTDSVHWFLLGTYPVNLPPVAVPRDAPQVS
FT                   DTASASPPAIPVLHLAAVNNTGTLHITFDQPIDHSTVNASRIHIRDGNETAGLALSGLA
FT                   SSGSNETVSFDLDREGLEAVLGYTRARLHFDADALSGEDGGSFPQQFALPLPAYRDEFS
FT                   VREQEDITQAVTFSADGMRMLVAGTGSNTIYQYDLRGAHDVTSAAYTGTSLATTGIAPV
FT                   SLALADGGRLLLVLGGADDTVHAYRLAVPYDVGGAAPSGETLLVDQEEQAPRGIAISPD
FT                   GRRFFIVGSGSDAVHQYLLGTAFDISTAAYSGSSMDVSGQEGRPQGVAFSADGTLVFIT
FT                   GADSLSLHRYELDGAFDLSGHSYTGSVHVGKDTDVPTEVAFSTDGRRVFISDSGPDTIN
FT                   EYELDGPYSFDGPPTGAFDLPDGEPTGVAFSDDGTIMLISGNVRDAVLGYELDSPFDLS
FT                   APASIGTFSVSAQDNNLRDVKLSADGGSVFIIGRQSDSVHRYDLASPFNITDPSLNGSF
FT                   FIGDSESGPTGLEFTPDGEGLFIVGTAEDAVQEYRLEGPYELVDSDPANSLAGSFSVRG
FT                   QSGSPTAVSFSPDGRVMFAASDAGNSVLRYGLGSAHGIGTSEYTGSFNVGGQGSAHTGL
FT                   AFSSDGLRMFTTEQDTDSVHWYLLGTHPVDLPPIAVPRDAPQISDSASAVPPAIPVLLL
FT                   AEVDSAGTLHITFDQPIDHSTVNASRIHIRDGNETSGLALSGLASTGGNDTVSFSLARE
FT                   GLVEILGYASARLHFDAGALSGEGGGRFPRQFALPLPAYGGALNVAAQEGDLRDAAFSP
FT                   DGTRMLVVGTVSAAVHQYNLSEAYDTATAAYTGDSLGTQGIAPVALALADGGRLMLVLG
FT                   GTADTVHAYRLAEPYSIVGATPTGDTFRVRPEAPSPRGIAISPDGLQMFIAGQISDAVH
FT                   QYTLGTAFDIGTAIYSGVSIDVSGQENSTQGVEFSADGTLMFITGTDSGSLHRYELDNA
FT                   FNLSGHSYTGSLDAVDSGTPTDLAFSADGRLVFITDSAANSIHEYELYGPYSFDSPPTG
FT                   RFVLQEGGITGVAFSSDGTAMLVSGIGRGAVYRYTVDQPFDLSTATYRGFFNTTAEDNR
FT                   PRDVDFSADGSSFFVVGRQSGSVHRYDLASPLNLTGTHSLNGSFSVGGSEASPNGIAFT
FT                   PDGEGLFVVGTAEDAVYEYSLAGQYELGGSIPADSLGANFSVAAQGEDPTEVAFSDDGR
FT                   LMFILSGAADRVNRYELGSAYDVGSAEYTGSFSVAGKIRGPTGLAFSSDGLRIFFTDHP
FT                   FTQLGAVHWYQLGTHPVRILAAVNTTDLVAADGLAAFDGAGVGARLSSSDAPSLETRGE
FT                   SAVEGVNIIDESDAPSVSESSGFGAKLQVSDAPVLGDGATAPGSGMRMAPDEPAVSDRV
FT                   TIGAGLQVSDTPELGDGASAPSGGMRMAPDEPAVSDRATIGAELQVSDTPELADGASAP
FT                   SGGMRMAPDEPAVSDRVTIGAELQVSDTPELADGASAPSGGMRMAPDEPAVSDRVTIGA
FT                   ELQVSDTPELGDGGLAPSGGMRMAPDEPAVSDRVTIGAELQVSDTPELGDGGLAPSGGM
FT                   RMAPDEPAVSDKAGIGVKLSVADTPGLTTSGDSAISGMIRETETPAVSDRAGVGVSLSS
FT                   SDAPSLLTRGDAIVNVDRKSDAPAVSEKVRVDVRLSSSDAPGLDERGSTPEDETPPVLP
FT                   PEPAPQPSPRGGGGGGGSRSGVSISGNSLGYDVSFTFTGAEDVPNLPLIRLEQGVAMGI
FT                   APVLTPGGTTVYDMEMILSDAEGIAAKVYYNRLGAFIGKECQGEMTASDRVHTCDMSSA
FT                   ISGGASYSAKGGSLEEISIPFEDGFSGRMTIMLRDNQGLLLASHERGSYTILSETEPVS
FT                   VSLPETETAAEPEMDPEPEPAAAEPEPAAEPEPPASEPEVPPEMDPEPAVAEPEMEPDS
FT                   PAMEPADAGPETEPGEGILDAIIGFFRSLFGM"
FT                   /protein_id="YP_875445.1"
FT   gene            complement(447189..447401)
FT                   /db_xref="GeneID:6370689"
FT                   /locus_tag="CENSYa_0509"
FT   CDS_pept        complement(447189..447401)
FT                   /locus_tag="CENSYa_0509"
FT                   /gene_family="HOG000106587" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575703"
FT                   /db_xref="GeneID:6370689"
FT                   /translation="MDYRLTPEDKERIKLLEQVSRKGFKELGAEKLKRLEELVEKKDYS
FT                   HSGKAARSKKKLLKQINVAIYEVEK"
FT                   /protein_id="YP_875446.1"
FT   gene            447580..448587
FT                   /db_xref="GeneID:6370690"
FT                   /locus_tag="CENSYa_0510"
FT   CDS_pept        447580..448587
FT                   /locus_tag="CENSYa_0510"
FT                   /gene_family="HOG000294685" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Zn-dependent alcohol dehydrogenase"
FT                   /EC_number="1.1.1.1"
FT                   /note="COG1064"
FT                   /db_xref="GI:118575704"
FT                   /db_xref="GeneID:6370690"
FT                   /translation="MAGMRAMVLNKTGPIEENPLELAEIERHRVNGPREVLLKIQACGV
FT                   CHSQLHSIEGDWKHLGIPPALPTVPGHEVVGEVVETGPGVTKFSVGDHAGVSPLLESCM
FT                   DCAYCTGGREYLCDSSTILGESMRGGYAEYLNVSEDFATLVPADMNPEHAAPLFCAGIT
FT                   AYKAVKAAGPAPGSRVGIFGIGGVGHMAVQFARLAGAEVTAVSRSAEHLQVAAELGASS
FT                   TAVFGSELPGGPLDTAIVFAPSDAATTAAIRAVKKGGTIVVGTIGEIRGFVAFEEKTIR
FT                   GTLIGSPRDMEDVIRIAHENSLQVVTERFPLEGANEALQKLKNSKIKARAVLVP"
FT                   /transl_table="11"
FT                   /protein_id="YP_875447.1"
FT   gene            448798..449052
FT                   /db_xref="GeneID:6370691"
FT                   /locus_tag="CENSYa_0511"
FT   CDS_pept        448798..449052
FT                   /locus_tag="CENSYa_0511"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575705"
FT                   /db_xref="GeneID:6370691"
FT                   /translation="MHIHYIWQKLRTTMVHASPEERKGELEALVSKVNALEADGTDAGL
FT                   ADVLRAMIQEESHLISEHDHLKKAIDQVTFMVMDIKNKS"
FT                   /protein_id="YP_875448.1"
FT   gene            complement(449193..449612)
FT                   /db_xref="GeneID:6370692"
FT                   /locus_tag="CENSYa_0512"
FT   CDS_pept        complement(449193..449612)
FT                   /locus_tag="CENSYa_0512"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575706"
FT                   /db_xref="GeneID:6370692"
FT                   /translation="MQRPTKQAGFIPFRKGPFVPAQKSKNQGADWTVQLVIQILQYEFL
FT                   GPVKLSEWGPPMEKLVYMVMARDKDVFNMIYVGECEKTDKGDYFTSNEAFKCWMKKART
FT                   EDALYLCILPMFDREAQDRKRVVDKIVYKYNPPCN"
FT                   /protein_id="YP_875449.1"
FT   gene            complement(449643..449930)
FT                   /db_xref="GeneID:6370693"
FT                   /locus_tag="CENSYa_0513"
FT   CDS_pept        complement(449643..449930)
FT                   /locus_tag="CENSYa_0513"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575707"
FT                   /db_xref="GeneID:6370693"
FT                   /translation="MTSSLARHSSNMADSTHVLYLLHDGSSRSLLAMHSSYFMWIMYGW
FT                   HDSPAKPLSWQASKSAVLALWILSENSTSSPIAKPIRAIAVREADTTIME"
FT                   /protein_id="YP_875450.1"
FT   gene            complement(449964..450650)
FT                   /db_xref="GeneID:6370694"
FT                   /locus_tag="CENSYa_0514"
FT   CDS_pept        complement(449964..450650)
FT                   /locus_tag="CENSYa_0514"
FT                   /gene_family="HOG000106599" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575708"
FT                   /db_xref="GeneID:6370694"
FT                   /translation="MYNWEHGRHSEGGHRYTGLILFATAVALAIVVYLVFRPQIDELNR
FT                   ESTLLINAMFAPAMAIGFLYGVRITSGAVSPSEGRSPRGRSLAKVFLFFFVIGSLFSSV
FT                   SFAVNGGSIIPGARILEDGLIAWVTEYVSANGGATFLIISSITLMAAATRRIVRIGGLQ
FT                   NRIFTFVGTFAFFSMLTLSFTQSNPTDSEVYLFTFYQAGIIGGALFEMNRLTRGHNDWE
FT                   DYKNGY"
FT                   /protein_id="YP_875451.1"
FT   gene            complement(450723..451910)
FT                   /db_xref="GeneID:6370695"
FT                   /locus_tag="CENSYa_0515"
FT   CDS_pept        complement(450723..451910)
FT                   /locus_tag="CENSYa_0515"
FT                   /gene_family="HOG000106610" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="tRNA pseudouridine synthase D"
FT                   /EC_number="4.2.1.70"
FT                   /note="COG0585"
FT                   /db_xref="GI:118575709"
FT                   /db_xref="GeneID:6370695"
FT                   /translation="MEKPAAAAPAIDAKVGISGYSTIFPGTGGRIRERHEDFEVSEVLT
FT                   DAALNKIGSGGYAVYILKKRGMDTSHALRRAAKAGLRLKALGLKDAAAVTEQYVCSMRK
FT                   GPAKAWSSGTISLSHAGYVERPLSGKDMAGNRFSIRITGTHGDASEFDGYNSIPNHYGY
FT                   QRFGSARPVSHLIGRAIVKGDFDWAVDLLLSHPSEYDSTEKAELRRSLGDREKLAGKMG
FT                   DIPPGMDLERTAAAELVRHGDARRALAALPSSMAGFFVQAYQSYIFNKTLSGTDELQPA
FT                   EGDVCYTKGLLGRYSDGTGQYLAIPTVGYAYFRKTRFDGPVSGILKEEGVRPADFGVKE
FT                   LPKAAAEGGFRQAVIGCSDARSGPDRAEFTLSRGSYATMVMREIIKPSDPIASGF"
FT                   /transl_table="11"
FT                   /protein_id="YP_875452.1"
FT   gene            complement(451910..453436)
FT                   /db_xref="GeneID:6370696"
FT                   /locus_tag="CENSYa_0516"
FT   CDS_pept        complement(451910..453436)
FT                   /locus_tag="CENSYa_0516"
FT                   /gene_family="HOG000106621" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="streptogramin lyase"
FT                   /EC_number="3.-.-.-"
FT                   /note="COG4257"
FT                   /db_xref="GI:118575710"
FT                   /db_xref="GeneID:6370696"
FT                   /translation="MPGAMQDNMSAATFTGTPADNFPDVQRAQYCGTGEASSSRFITEY
FT                   KIPTDCTQPLAITTDPDGNVWFAQVNTGRIAKFDPATEEFAEYDNPRWPQQGRSMFWGI
FT                   DYHEGELWYTDEAYDSIWKYSVENGTYDRLDYPASDDSLPQKIEVSEERIIINDFTGGK
FT                   ITFLGMEGEASEYEEFPVPVNATLSDTGDAIHGYDLPSPVNYSLAGDFGLDAAGNIWYT
FT                   NWIFQGSGVLVRFDPDGYSANASAADYLRVYELPADMETPNGAAVGPDGRIWIADTSSS
FT                   FFFSFDPIFGGFTKYVTSGLQESSYGNATGVIRDPVSRPYWMEVDDSGRLVFNEQTANR
FT                   LGVFDPAEEMLVEYTIPSKNPNWADCGENTDCGLAQTFGIALDGEKVWFTEWVENNIGV
FT                   LDTSVPLPYEIEVGGEITVPRDGTAEISFTVVPLGGSSGKVRMVAADTAAFRDIVIEPD
FT                   VLELGELDGPRTIDLTINTGSFAIKGTHKVLLGVQDDDVSVSRYVTVNIV"
FT                   /transl_table="11"
FT                   /protein_id="YP_875453.1"
FT   gene            complement(453548..453847)
FT                   /db_xref="GeneID:6370697"
FT                   /locus_tag="CENSYa_0517"
FT   CDS_pept        complement(453548..453847)
FT                   /locus_tag="CENSYa_0517"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575711"
FT                   /db_xref="GeneID:6370697"
FT                   /translation="MLCVQVNQTPQKPVRFCRPVPPIPICGIWSARPYSPCHHTLCVQP
FT                   GGDISNAARLMAEISSHSWPCPLDHPALEYAFRHTCWNPPAGCRRPHTIPCRPS"
FT                   /protein_id="YP_875454.1"
FT   gene            453857..454723
FT                   /db_xref="GeneID:6370698"
FT                   /locus_tag="CENSYa_0518"
FT   CDS_pept        453857..454723
FT                   /locus_tag="CENSYa_0518"
FT                   /gene_family="HOG000106632" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA modification methylase"
FT                   /transl_table="11"
FT                   /note="COG0863"
FT                   /db_xref="GI:118575712"
FT                   /db_xref="GeneID:6370698"
FT                   /translation="MAASRKKDKLAVAARSPRPRRDSARLGPGRNRIYCGDAAAVLAKL
FT                   GDGSVDLAVTSPPYDNLRDYQGYSFDFDGICSQLYRVLRKGGVLVWVVGDRIAGGRSLT
FT                   SFRQGLAFQDLGFSMHDIMIYRKKNTPFMRSNAYTNCYEFMFVLSKGRPRVFRPIMEKT
FT                   KRSGMEMLVHNKKSDGINKKTLAELKPEKTRTNIWDYAVGLGGTTCDRFAFKHPAMFPE
FT                   KLAQDHILSWSKPGDLVLDPMCGSGTTCKMAAANGRDYIGIEISKEYAAIARRRMAGIQ
FT                   KRISAQP"
FT                   /protein_id="YP_875455.1"
FT   gene            complement(454802..455209)
FT                   /db_xref="GeneID:6370699"
FT                   /locus_tag="CENSYa_0519"
FT   CDS_pept        complement(454802..455209)
FT                   /locus_tag="CENSYa_0519"
FT                   /gene_family="HOG000227349" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /transl_table="11"
FT                   /note="COG1990"
FT                   /db_xref="GI:118575713"
FT                   /db_xref="GeneID:6370699"
FT                   /translation="MGGLGPRSYLTQLRAIPCMSPIKQVVAVRTDLGMGKGKIAAQVGH
FT                   ACVMGAERVRRSHPEWFELWWPRQEKVVVRVRGPVELEEIKKMAASLGIPWSEVSDAGH
FT                   TQVEPGTITCISIGPAPESMVDRVTGDMKLL"
FT                   /protein_id="YP_875456.1"
FT   gene            455208..456329
FT                   /db_xref="GeneID:6370700"
FT                   /locus_tag="CENSYa_0520"
FT   CDS_pept        455208..456329
FT                   /locus_tag="CENSYa_0520"
FT                   /gene_family="HOG000106643" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dehydrogenase"
FT                   /transl_table="11"
FT                   /note="COG0644"
FT                   /db_xref="GI:118575714"
FT                   /db_xref="GeneID:6370700"
FT                   /translation="MYDVAVAGGSIAGLLCAREAASSGLSVVVLEEDHEIGTPDHCGGL
FT                   VSSEALGELGLVPGPGAAVRAVQSARLRSPGGKVIDVDSSAQNVLGVDRRALDKQAALQ
FT                   AQRAGAEIRAGVRCTAVHKNSLGTVSGPIPCKVAVDARGLAPLALKDPSGVVPSAQYEV
FT                   YADWTEGTPVEVILDSAKYPGFFAWVIPSAGGSAKVGAAGRGINAGRALGDFLKSRGRH
FT                   SILRRVYAPLWTGGPADEFIDGAVAVGDAAGQAKPTTSGGIYTCGMGGVLAGRAIASYI
FT                   ATGELSRLQEYPDNWKKRFGKEFARQMLLRRLLERMDNAAIDGLFDSVGPGSLAGDSDF
FT                   DFHTDSIVGLLGLRGSLRAVRAVLGGEARKLLG"
FT                   /protein_id="YP_875457.1"
FT   gene            456459..457274
FT                   /db_xref="GeneID:6370701"
FT                   /locus_tag="CENSYa_0521"
FT   CDS_pept        456459..457274
FT                   /locus_tag="CENSYa_0521"
FT                   /gene_family="HOG000237291" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="polyprenyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /note="COG0109"
FT                   /db_xref="GI:118575715"
FT                   /db_xref="GeneID:6370701"
FT                   /translation="MYAGDALSAGEPGPDLWDYAHLMAAGALASAGSSALNHYYDRDID
FT                   PKMRRTARRPIPSGRIGENIVLAYGLAISSAAVVYAYFLLNAPTAFFIALGIFSYVIIY
FT                   TAWLKRTNRSNIVIGGIAGSAASWAGWTAATGTLDLLGFLIGFLVFVWTPSHFWCLAMK
FT                   IREDYEAAGVPMLPVVIGMQRTSKYILGNTLLLLPYSLALYAFGMGLVYLVIAVASGGL
FT                   MLVYHYKLTKTPTPDFAWKAYKVTAPYLTIIFAAVALDAAFHYPFPFPF"
FT                   /transl_table="11"
FT                   /protein_id="YP_875458.1"
FT   gene            complement(457271..457570)
FT                   /db_xref="GeneID:6370702"
FT                   /locus_tag="CENSYa_0522"
FT   CDS_pept        complement(457271..457570)
FT                   /locus_tag="CENSYa_0522"
FT                   /gene_family="HOG000106654" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575716"
FT                   /db_xref="GeneID:6370702"
FT                   /translation="MYMTIPMRNRVYNRIIEGGPATDVELTKALIKAGAPVAEDRFEKI
FT                   LLDLEILGLIKVTWMTKDTRRIEAVPQAGERDEVEEQAREAAEKDYEASFPGAS"
FT                   /protein_id="YP_875459.1"
FT   gene            complement(457571..459745)
FT                   /db_xref="GeneID:6370703"
FT                   /locus_tag="CENSYa_0523"
FT   CDS_pept        complement(457571..459745)
FT                   /locus_tag="CENSYa_0523"
FT                   /gene_family="HOG000223224" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="AAA ATPase"
FT                   /transl_table="11"
FT                   /note="COG0464"
FT                   /db_xref="GI:118575717"
FT                   /db_xref="GeneID:6370703"
FT                   /translation="MARKDGPLQMRVGEAKQRDVGKKRARIGPEAMDRLKVTPGDIIEI
FT                   AGSRPSCAVVWPNDEDERSPEVVRIDGQTRKNVGAAINDAVRIRRIQAKAAKSVILAPA
FT                   SGSVTVDKEFADFVKNRLKGLPLSQGDEISVMILGNSIDFKIGKTTPRSVVRMDRSTSL
FT                   SILTEAPESKKARVTYEEVGGLESEIRAMREIVELPLRHPELFSRLGVESHSGILLYGP
FT                   PGCGKTLIAKVLASESEANMYSINGPEIMNKYYGETEARLRDIFKEAKDNSPSIIFIDE
FT                   IDAIAPKREEAYGDVEKRVVAQLLALMDGLTDRGNVIVLGATNRPDSVDPALRRPGRFD
FT                   REAEISVPNADGRLEILQIHTRGMPLSDGIDLRELASELHGYTGADIKSLCREAAMKAI
FT                   RRYLPKIDLETDRIPAEVLETMEVKLVDFYDAMHEVVPTAMREFYVERAKVWWDDVGGL
FT                   DGVKQSLKDNLIAAMEDPGRFSKMGVRPPKGALIYGPPGCGKTMVARALAAESGANMIL
FT                   VRGPEVLSKWVGESEKAIREIFRKAKSASPCVVIFDEMDSLAKYRGGDETGGTGETILG
FT                   QLLTEMDDGASSRVVIVGVTSRPDLLDGSLLRTGRLDLLLYVQPPDEAGRLEIIKILTE
FT                   RMPLAPDVKLPEIAVSTRNYTGADLAALCREAAVHAMQQEAEKVSSADFAAALKRVRPS
FT                   ITKEVDQWYSSIRSGISDAVPKNLDRPFYV"
FT                   /protein_id="YP_875460.1"
FT   gene            complement(459752..460033)
FT                   /db_xref="GeneID:6370704"
FT                   /locus_tag="CENSYa_0524"
FT   CDS_pept        complement(459752..460033)
FT                   /locus_tag="CENSYa_0524"
FT                   /gene_family="HOG000015480" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="translation elongation factor EF-1beta"
FT                   /transl_table="11"
FT                   /note="COG2092"
FT                   /db_xref="GI:118575718"
FT                   /db_xref="GeneID:6370704"
FT                   /translation="MAQLLVIVKILPKGTEVDLDEMMEGLKGGLKGGIVLRRYAKEPLA
FT                   FGLHFVKAEFILEDKEGQNDALEATVRSAKGVSEYEVLNMSRMSVDMK"
FT                   /protein_id="YP_875461.1"
FT   gene            complement(460035..460274)
FT                   /db_xref="GeneID:6370705"
FT                   /locus_tag="CENSYa_0525"
FT   CDS_pept        complement(460035..460274)
FT                   /locus_tag="CENSYa_0525"
FT                   /gene_family="HOG000227199" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Zn-ribbon RNA-binding protein"
FT                   /transl_table="11"
FT                   /note="COG2888"
FT                   /db_xref="GI:118575719"
FT                   /db_xref="GeneID:6370705"
FT                   /translation="MECEGADQARYKCAPPRPTAMSSSITLPVCSCCKRHIMPNDMCVK
FT                   FDCPSCAGELVWRCESCREAARGYECSKCHFAGP"
FT                   /protein_id="YP_875462.1"
FT   gene            complement(460320..461870)
FT                   /db_xref="GeneID:6370706"
FT                   /locus_tag="CENSYa_0526"
FT   CDS_pept        complement(460320..461870)
FT                   /locus_tag="CENSYa_0526"
FT                   /gene_family="HOG000017736" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ammonia permease"
FT                   /transl_table="11"
FT                   /note="COG0004"
FT                   /db_xref="GI:118575720"
FT                   /db_xref="GeneID:6370706"
FT                   /translation="MESISKRALILAAAVAIAATGAMSTAYSQTMEDDADGYDNRGLYT
FT                   GNPNECWVDDGEGEFTACYIDSGDTSFMIIATALVLFMTPGVAFFYGGMARSKNVVNVI
FT                   GMTLIVMGAISWQWVAWGYSLSFGPGDSDWNMFAGSLDYAGFNQVSYFAPLGSPIECQD
FT                   TASNEYLMQEIKSGVACSDTWPGTIPHALFAAFQGTFAIITPALIVGGLIDRMKFSALI
FT                   IFVLLWATFVYDPVAHWIWGGGFVSAGSLDIDPDLSPSFALDFAGGIVVHVTSGFSALA
FT                   AALVLGRRIGYGKVPMDPHNVPMMVLGVTILWFGWTGFNAGSEVMADGVAVRAMVVTNL
FT                   AAGVGTVTWMLLSWAHTGKPSIVGAATGTIAGLGTITPAAGWVGPMAAIIIGIAAASVC
FT                   YACVAFKNAHKWDDALDVWGVHGMGGITGSVLVGTLASPDNWDTGGIGAWTGTPEGFEQ
FT                   QGINIMAAGIVAGYSFGMTVVILKIMDKVWPGGIRVTAKEEEMGLDLAQHGELAYTNE"
FT                   /protein_id="YP_875463.1"
FT   gene            461998..462222
FT                   /db_xref="GeneID:6370707"
FT                   /locus_tag="CENSYa_0527"
FT   CDS_pept        461998..462222
FT                   /locus_tag="CENSYa_0527"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575721"
FT                   /db_xref="GeneID:6370707"
FT                   /translation="MAWGHALLFPRCGRHCKPGMRPLVKSDTGGDFFLCMIQPGSIGAK
FT                   QVGRLWGRSALEPIGRLHGPPLMTEMVFI"
FT                   /protein_id="YP_875464.1"
FT   gene            462278..462910
FT                   /db_xref="GeneID:6370708"
FT                   /locus_tag="CENSYa_0528"
FT   CDS_pept        462278..462910
FT                   /locus_tag="CENSYa_0528"
FT                   /gene_family="HOG000105992" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575722"
FT                   /db_xref="GeneID:6370708"
FT                   /translation="MSKQTYGIALGGSAAVLALLALVPAGTSFLPGGAADPAFYGMAEL
FT                   VHTSADGELLSSHTVHNRLVDTGEEILIYGAFGDLADSKKPTLLCVSDVDHTDTFPADD
FT                   SLVALHVPSNAFANTSVNTCVTADINTTISSVAIMNATFTPDTNYAFGEVINSITVCNT
FT                   NMNNSNMQNCVNAGDIFSTVETPQTNATSADDLIGVTYTFNVTSPEN"
FT                   /protein_id="YP_875465.1"
FT   gene            463006..463254
FT                   /db_xref="GeneID:6370709"
FT                   /locus_tag="CENSYa_0529"
FT   CDS_pept        463006..463254
FT                   /locus_tag="CENSYa_0529"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575723"
FT                   /db_xref="GeneID:6370709"
FT                   /translation="MCHIPQIDRQSSMPSPDSGCGPLHFHGPGGPACADPPALAQLPRV
FT                   PGAPRTLPAPQARAFVRRPGAQKPSYKGLSKHRWGQA"
FT                   /protein_id="YP_875466.1"
FT   gene            463257..464102
FT                   /db_xref="GeneID:6370710"
FT                   /locus_tag="CENSYa_0530"
FT   CDS_pept        463257..464102
FT                   /locus_tag="CENSYa_0530"
FT                   /gene_family="HOG000106665" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="copper binding protein, plastocyanin/azurin
FT                   family"
FT                   /transl_table="11"
FT                   /note="COG3794"
FT                   /db_xref="GI:118575724"
FT                   /db_xref="GeneID:6370710"
FT                   /translation="MSNWDLMMPGMGLTAIGLAGVVVSYAGIAHTFIDGMHALTGLTMF
FT                   VGLIFLSAGILEGGVSTSNKAKATTLVILAISLSFGTAALVYNTISTVQTFASIMMILA
FT                   VPAIVIAYMATKMPEYLKPVGVIFCLAIGLGVVTFVALGMIGPGTYLIDEPEEAAAPAE
FT                   APAAAPAPDAPVFDITILEGSGIPDTPDYDPDVATVLQGTLVVWTNVDPLVHTVTSTAG
FT                   LGETFDSGLISEGDVFSLDTRGIDTGVHEYTCIVHPWMVSTLVVEEPEPEPEEPVIAEP
FT                   "
FT                   /protein_id="YP_875467.1"
FT   gene            464099..464497
FT                   /db_xref="GeneID:6370711"
FT                   /locus_tag="CENSYa_0531"
FT   CDS_pept        464099..464497
FT                   /locus_tag="CENSYa_0531"
FT                   /gene_family="HOG000009901" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="metal-dependent protease of the PAD1/JA B1
FT                   superfamily"
FT                   /transl_table="11"
FT                   /note="COG1310"
FT                   /db_xref="GI:118575725"
FT                   /db_xref="GeneID:6370711"
FT                   /translation="MNILVLGGNTRELLSSHAAASEPHESCALLFGDEQEDRTVVREVY
FT                   PARNADESPVSFSISPEELIRGYVKAGEMGLDVVGIFHSHPSSEAAPSGKDRQYMITNP
FT                   VPWLIYSGIDGSFRAYILDGDIAEIRVC"
FT                   /protein_id="YP_875468.1"
FT   gene            complement(464494..465816)
FT                   /db_xref="GeneID:6370712"
FT                   /locus_tag="CENSYa_0532"
FT   CDS_pept        complement(464494..465816)
FT                   /locus_tag="CENSYa_0532"
FT                   /gene_family="HOG000076502" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="threonine synthase"
FT                   /EC_number="4.2.3.1"
FT                   /note="COG0498"
FT                   /db_xref="GI:118575726"
FT                   /db_xref="GeneID:6370712"
FT                   /translation="MNAVLKCIDPGCGLEYPIDSTLVECERGHLLDVKYPGSPPESLKE
FT                   VFRCRRDPGGSIFNESGVWRFRELLNFCSIDTEDAEQCAAHLVSLDGAEGRQSKPYRMG
FT                   RVSKFTEMEPDSLWLQPEGYNPSGSFKDNGMATAVTHARMVSAGKIVCASTGNTSASAG
FT                   MFAANEGIECDVYIPAGQIAPGKLSQAYQFGAQIIEVDGNFDDALRRSLDEARGSGGYT
FT                   VNSINPFRIEGQKTIPYRALEQLDWEAPDWIVYPGGALGNTSSCGKALMELHEWGWIGK
FT                   IPRIAVINAEGARTLSDLYNDRGLRWNGGKPDTGLIEDHYAEMDRTGAGPRTRATAIQI
FT                   GRPANILKGLRALEYTDGVVTTVSDTEMLDGMSAVGLNGFDCEMASGATPAGIKKLVKE
FT                   GVIKRDDTVVGILTGRQKDAMLPVEYHSDPSNMFARPPRAR"
FT                   /transl_table="11"
FT                   /protein_id="YP_875469.1"
FT   gene            465858..466178
FT                   /db_xref="GeneID:6370713"
FT                   /locus_tag="CENSYa_0533"
FT   CDS_pept        465858..466178
FT                   /locus_tag="CENSYa_0533"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575727"
FT                   /db_xref="GeneID:6370713"
FT                   /translation="MYAAWCVQGLLWLTRPVHGQDVRLPYCGHGASYGGRTVRRGMRST
FT                   AYLPALPPACPACPLRGQSPAAGSCACSAGHCILTHRIRCKATCRTWLCEKWDPVLLYY
FT                   FN"
FT                   /protein_id="YP_875470.1"
FT   gene            466229..466567
FT                   /db_xref="GeneID:6370714"
FT                   /locus_tag="CENSYa_0534"
FT   CDS_pept        466229..466567
FT                   /locus_tag="CENSYa_0534"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575728"
FT                   /db_xref="GeneID:6370714"
FT                   /translation="MQDEKEGTPHDDIRAFATSSVKAGTDTYIRLRIPDCVDKEKCSRL
FT                   FQELIRELARSRQIPPVGPSPQMPHIGEPARPAEDAACDEPDKTVTKKPKRSITAAFHC
FT                   QNRIQSLE"
FT                   /protein_id="YP_875471.1"
FT   gene            complement(466724..466900)
FT                   /db_xref="GeneID:6370715"
FT                   /locus_tag="CENSYa_0535"
FT   CDS_pept        complement(466724..466900)
FT                   /locus_tag="CENSYa_0535"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575729"
FT                   /db_xref="GeneID:6370715"
FT                   /translation="MTESCVGCLSQGWRCNAMVSEPILFGKSSERRSRALEIPKEAGRH
FT                   GHLIWTTGSGGTY"
FT                   /protein_id="YP_875472.1"
FT   gene            466936..467574
FT                   /db_xref="GeneID:6370716"
FT                   /locus_tag="CENSYa_0536"
FT   CDS_pept        466936..467574
FT                   /locus_tag="CENSYa_0536"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575730"
FT                   /db_xref="GeneID:6370716"
FT                   /translation="MKAQIGIVAATLVLFSLFAIPAYSRSQEADVTGGFVPGDDAVGPV
FT                   GIVDAEYKFDAGLYAKVLDLVQEDPQGGDPGVFDGVRYYNVIMVVSRDDGDGRGPEETA
FT                   QENKDSIVRRLNLLGARDILAAESLSFVTASIPVVEIPGFALDNSIYRMGDGEEEVRVF
FT                   VDTARQTIRATDDNIRTPIGKVHGGTHVFWITASDGIDTVREPYAVAVP"
FT                   /protein_id="YP_875473.1"
FT   gene            467571..468815
FT                   /db_xref="GeneID:6370717"
FT                   /locus_tag="CENSYa_0537"
FT   CDS_pept        467571..468815
FT                   /locus_tag="CENSYa_0537"
FT                   /gene_family="HOG000238519" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="serine protease inhibitor"
FT                   /transl_table="11"
FT                   /note="COG4826"
FT                   /db_xref="GI:118575731"
FT                   /db_xref="GeneID:6370717"
FT                   /translation="MRRAYLAAAAVIIVAAAVGYAAFPASDIQDAPAPTGTGPPDLASL
FT                   PVVSASEIESAVIPQEIADSNNGFAVDFYRQVSKEDGNIFFSPLSMYTAFSLLYEGASG
FT                   EAAGELEDAFGFEPDAQARHNMTAHTIASINRDDPHAKLALANSLWPFVGNVRPEYLDV
FT                   GRSTYLATIENPGDDPSMRINQWVSNITNGKITEVVGPDSFADPILAIVNAVYFKGTWE
FT                   MQFPPEATKMDEWHGEGDAEANYMNVVGIFDYEEYDGLQVLRMPYEGGRLSMTVVLPEP
FT                   GGMADLEESISEGQVADWTGSMLEREVSVSLPKFTASTNYDLIGYLKALGVHRIFEFKP
FT                   PALAGIYGGDLSVRTAIHGAFVDINEEGTEAAAATIISAAITEPPRFNADRPFIFLIQD
FT                   DESGTILFMGRVSNP"
FT                   /protein_id="YP_875474.1"
FT   gene            468876..469115
FT                   /db_xref="GeneID:6370718"
FT                   /locus_tag="CENSYa_0538"
FT   CDS_pept        468876..469115
FT                   /locus_tag="CENSYa_0538"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575732"
FT                   /db_xref="GeneID:6370718"
FT                   /translation="MNAPGTIENIRRAGWKCKKAKRGVNWSIQQNNPEGGKYRTQQSCL
FT                   VSKKAKRDTPHQVPVPLPPACAVIHAKICLGTMS"
FT                   /protein_id="YP_875475.1"
FT   gene            469129..469431
FT                   /db_xref="GeneID:6370719"
FT                   /locus_tag="CENSYa_0539"
FT   CDS_pept        469129..469431
FT                   /locus_tag="CENSYa_0539"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575733"
FT                   /db_xref="GeneID:6370719"
FT                   /translation="MCSFFSVSVRRPTRIFWSIPTHGLQRHEIKVPSPRAPNLVNRFSR
FT                   GVWYFRTPPQAFRSRWGLYGAGTGRFKIWKVLMPLGCPLFHPWRSYWTEPSRIKI"
FT                   /protein_id="YP_875476.1"
FT   gene            469752..470066
FT                   /db_xref="GeneID:6370720"
FT                   /locus_tag="CENSYa_0540"
FT   CDS_pept        469752..470066
FT                   /locus_tag="CENSYa_0540"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575734"
FT                   /db_xref="GeneID:6370720"
FT                   /translation="MDKPEGRDGASHGVGTDTEHAEAGPAGCAGPDDSEKEKLREILNE
FT                   LTRTIDTYTIQRLVGAEQAESHEEPAKNTKFEYFGSVTLPKPHPRSGIRAVYPELKSFI
FT                   "
FT                   /protein_id="YP_875477.1"
FT   gene            complement(470361..470834)
FT                   /db_xref="GeneID:6370721"
FT                   /locus_tag="CENSYa_0541"
FT   CDS_pept        complement(470361..470834)
FT                   /locus_tag="CENSYa_0541"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575735"
FT                   /db_xref="GeneID:6370721"
FT                   /translation="MRPARPCAGEACPQGRLSSPIPSLARLGRPACPQGRRLRRGILLS
FT                   GPVCRGRTRQASASVHRGAAPSFSIWRRRRPRYSRGTEAAQQWYIRCCPHSHQPLIPQL
FT                   SWSRGFGADKMRGFEWLISIPRCAIGCIANSHVLMTDNYSITLPRFSHLPDRT"
FT                   /protein_id="YP_875478.1"
FT   gene            complement(470896..471060)
FT                   /db_xref="GeneID:6370722"
FT                   /locus_tag="CENSYa_0542"
FT   CDS_pept        complement(470896..471060)
FT                   /locus_tag="CENSYa_0542"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575736"
FT                   /db_xref="GeneID:6370722"
FT                   /translation="MHFLAVYAPSSSSIPSETVSMNLLSASDSNILRRMWRSLPGSAPY
FT                   RSDIISISR"
FT                   /protein_id="YP_875479.1"
FT   gene            complement(471136..472731)
FT                   /db_xref="GeneID:6370723"
FT                   /locus_tag="CENSYa_0543"
FT   CDS_pept        complement(471136..472731)
FT                   /locus_tag="CENSYa_0543"
FT                   /gene_family="HOG000279960" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="excinuclease nuclease subunit"
FT                   /transl_table="11"
FT                   /note="COG0322"
FT                   /db_xref="GI:118575737"
FT                   /db_xref="GeneID:6370723"
FT                   /translation="MKYDHKRAAVPAQPGVYLMKDSKANIIYIGKAKSLRNRVSSYFTG
FT                   AQNYKTKKLVEKIADIEFVLTDSEGEAFVLESNLIKRYRPMYNIELKDQQRYTYLRVTD
FT                   EELPRLLVARRMRSGKFIGKGRIYGPFTHGSSKLLTIGTLRKSFKVRICKTLPKTACLE
FT                   YHLGNCEAPCEIASAKKDYAGHIKDLESVLKGGAETEKFATKMKDEMGRASESQDYERA
FT                   MEIRDTLRRLGSLRTDQKMEYARVSPDEDYFGMRVWDQSALVMSLRQVNGVIRDRDRFS
FT                   FDLVADNTLGSFLYQYYTTHKTPRYVVTSEEPPQKGALEKALTDAAGRSVSIVSPSRGR
FT                   RKKMIELILRNIDLMQTSGTEPALEELGEALGLGGPPRTIECFDISNHGADFAVGAMSR
FT                   LSDGAPDRSGYRKFKIRTVSGRDDYAMIAEVVRRRYMRLLGGGGTAPDLVLIDGGKGQL
FT                   GAALGALKGMAARIPCVSLAKKNEEVFRPGSPEPLVLPRTSPALGVLRHARDEAHRFGV
FT                   EYNRKLRSMAIKSG"
FT                   /protein_id="YP_875480.1"
FT   gene            complement(472728..475535)
FT                   /db_xref="GeneID:6370724"
FT                   /locus_tag="CENSYa_0544"
FT   CDS_pept        complement(472728..475535)
FT                   /locus_tag="CENSYa_0544"
FT                   /gene_family="HOG000050448" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="excinuclease ATPase subunit"
FT                   /transl_table="11"
FT                   /note="COG0178"
FT                   /db_xref="GI:118575738"
FT                   /db_xref="GeneID:6370724"
FT                   /translation="MLRVRGARHHNLRNIDVDIPKNSIVVISGLSGSGKSTLAFDTIYA
FT                   EGQRRYVESLSSYARQFLGMMDKPEVDSIEGLSPAISIQQKTTSKNPRSTVGTTTEIYD
FT                   YMRLLFARVGVPHCTKCGRTISSQSVDTITDTVLQEFAGRQLTILAPLISRKKGTYEKL
FT                   MDKVRMDGYSRIRIDGEVYQADGELPSLDRQKWHNIEIAVDRLRAEASERSRLFEGIQT
FT                   AIRASGGRVLVAHDGGERIFSQDNACPHCGISIGELEPRTFSFNSPFGMCNTCSGLGTR
FT                   VVFDPELVIPDRSLSILDGAIAPWNVQDSQHLSGMIRKIGKEYGFGLDTPVGKIGKAAL
FT                   DTLLYGTDDLSSVDMTDPAAHEGRWSRGGVPYEGVIQWLHRGFMYTESESKREWLRQFM
FT                   RETPCSSCKGRKLRPEALAVKVGAKSIMEICDLSIDGCHTFFEGLKLSKTEQHIVRDLM
FT                   REIRSRLGFLRNVGLNYLTLNRTSSTLSGGESQRIRLATQIGSNLTGVLYVLDEPTIGL
FT                   HQRDNARLIKTLEGLKKLGNTVIVVEHDEEVIRSSDWIIDLGPGAGVHGGSIVFEGTVK
FT                   EILDGHDSVTGRYLKDKSLITVGEKGRVEKGAVTVKGASENNLRGIDVKFPLGLFISVT
FT                   GVSGSGKSTLVNEILLKALQRRLHGSRRRPGRHKSVSGTSSVDKVIAIDQSPIGRTPRS
FT                   NPATYVGAFTPMRVLYTGTELSRQRGYKPGQFSFNVEGGRCFACEGDGVKRIEMQFLSD
FT                   VYVRCDECKGRRYNSETLGVLYKGRSIADVLEMTVDEALDFFGNVPAIRRKLELVRDVG
FT                   LGYIKLGQPSTTLSGGEAQRVKLALELSKRSTGSTVYVLDEPTTGLHFADVQKLLDVLN
FT                   RLADLGNTIVVIEHNMDVIRNSDWVIDLGPEGGDGGGRIVAQGTPVQVAATATHTGRYL
FT                   KKFMA"
FT                   /protein_id="YP_875481.1"
FT   gene            complement(475537..477486)
FT                   /db_xref="GeneID:6370725"
FT                   /locus_tag="CENSYa_0545"
FT   CDS_pept        complement(475537..477486)
FT                   /locus_tag="CENSYa_0545"
FT                   /gene_family="HOG000073580" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="excinuclease helicase subunit"
FT                   /transl_table="11"
FT                   /note="COG0556"
FT                   /db_xref="GI:118575739"
FT                   /db_xref="GeneID:6370725"
FT                   /translation="MQQVRKFDLVSEFAPTGDQPEAIDALASGVRKKSLQTLLGVTGSG
FT                   KTFTVANVIARTGKNTLVISHNKTLAAQLYAELKQFFPGNNVGYFVSYYDYYQPESYMV
FT                   QTDTYIEKDTVVNEQIEKMRLETTAMLLSGEPTIVVSTVSCIYSLGNPDDWDEMAITLE
FT                   EGRGAGRADVIRRLVDARYERNDVELAPGNFRVRGDTIDVIPAYSQDVVRISMFGDEVE
FT                   RISVLDRMTMDEKQRVGTIRVFPAKHYLIAGDARKRALGSIKSELKSRLPELRELERQR
FT                   LEMRTSYDLEMIEELGYCSGIENYSRHFDGRKPGEPAFCLLDFFGPDFLLVIDESHVTL
FT                   PQLHGMYKGDHSRKGELITYGFRLPSAYDNRPLKFEEFEGYLKNVIFVSATPSEYERTK
FT                   SAEIVEQLVRPTGLLDPVAEIRPTKGQMDDLVSEIGACAKRDERALVTTLTKRMAEDLA
FT                   EFLSKRKVRVRYMHSEIEGLQRTELIRQLRLGEFDVLVGINLLREGLDIPEVSLVAILD
FT                   ADKEGFLRNMTSLIQTFGRAARNSAGRVIMYADRTTASMKNALDETARRRERQSEYNVQ
FT                   HGITPRSITKAIPEQTVKLDDVKHKSPHDISREIIELEASMKRHAEELSFEKAIECRDQ
FT                   IRRLREGMERGHGR"
FT                   /protein_id="YP_875482.1"
FT   gene            complement(477559..478578)
FT                   /db_xref="GeneID:6370726"
FT                   /locus_tag="CENSYa_0546"
FT   CDS_pept        complement(477559..478578)
FT                   /locus_tag="CENSYa_0546"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DNA modification methylase"
FT                   /transl_table="11"
FT                   /note="COG0863"
FT                   /db_xref="GI:118575740"
FT                   /db_xref="GeneID:6370726"
FT                   /translation="MVPAANRQSVRGSLAPFLNTVRCGDSAKMLKDVPSGSVDLVITSP
FT                   PYYQQRDYGGGRTGNEGHVEAYIDSIMQVFEQCVRVTKETGSIVFNMGDKYSQGSLMLV
FT                   PYRFAIRATGSGAVRLVNNTTWVKTNPTPRQFKRRLVSGTEPFFHFAKSDSYCYNIDDF
FT                   QRPETGVKKPPENTRVGEGYKKLIESSELEPVQKRRAQKALQEAIEETKSGAIAGFRMK
FT                   IRGIHSPAFGGQAGGRQIQLRDNGFTIIRMRGNPIKRDVIHHQVESIRWNAHPAIYPVG
FT                   IIAEFIRLLTPKGAVVLDPYMGSGTTGVAARSLGRSFMGIELNAGYCRAANKRISAAG"
FT                   /protein_id="YP_875483.1"
FT   gene            complement(478638..479270)
FT                   /db_xref="GeneID:6370727"
FT                   /locus_tag="CENSYa_0547"
FT   CDS_pept        complement(478638..479270)
FT                   /locus_tag="CENSYa_0547"
FT                   /gene_family="HOG000106676" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="flavin-nucleotide-binding protein"
FT                   /transl_table="11"
FT                   /note="COG3467"
FT                   /db_xref="GI:118575741"
FT                   /db_xref="GeneID:6370727"
FT                   /translation="MQLLGRLEIRSEERIIEFLGEEHVGRISTVDADGYPQVIPMNFVY
FT                   MKDAVYMHSHVKGEKLDNIRRDSRAGFEVDREVEFLPSYFEDPHDASVADTLYVSVVIK
FT                   GRAELIDDTAEKAAALNGLMAKYQPEGRYDPVKPGDEVLGHLEIIKVVPHSMRGKYKIG
FT                   QHLDTKERAELAAKILDRGSDTAASALKIMGFEVVDGRPVMRDEPSW"
FT                   /protein_id="YP_875484.1"
FT   gene            complement(479274..480446)
FT                   /db_xref="GeneID:6370728"
FT                   /locus_tag="CENSYa_0548"
FT   CDS_pept        complement(479274..480446)
FT                   /locus_tag="CENSYa_0548"
FT                   /gene_family="HOG000106687" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="flavin-dependent oxidoreductase"
FT                   /transl_table="11"
FT                   /note="COG2141"
FT                   /db_xref="GI:118575742"
FT                   /db_xref="GeneID:6370728"
FT                   /translation="MPDAKPFTDESLNPSQTYLPQKYSSQGYMNRIKFGIQNGLNVARA
FT                   GYTEDQILTACILADKTGYDSIFYMDHTNVPQWKKAIVLDPWVMLSAIAAITNNVEIGT
FT                   CVTDAIRRHPSNIALAAITLDRVSKGRAILGIGAGEAQNLKEFCIPFEKPVSKWEEQIE
FT                   VIKALYSSSPDNTVDYSGKYYDLKGACLQAPPIRKPHPPTYMASGGKRTLMLTGKLGDG
FT                   WLPIGYTPELFEDHRGQIVDSMKKHDRTEEEKENFQMALDIDVYFSEDAEESWARMKEA
FT                   VKVSLFKPEVLRVHNLKEIEGFDFVKYFTEYSMSNQEWIVKMREAATRIPDGVARSSTA
FT                   IGTPDDVIPTFERFLKAGVNHFVIRFWGKDYFGSIDKFATHVMPHLREQK"
FT                   /protein_id="YP_875485.1"
FT   gene            complement(480454..481398)
FT                   /db_xref="GeneID:6370729"
FT                   /locus_tag="CENSYa_0549"
FT   CDS_pept        complement(480454..481398)
FT                   /locus_tag="CENSYa_0549"
FT                   /gene_family="HOG000106698" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="alcohol dehydrogenase, class IV"
FT                   /EC_number="1.1.1.1"
FT                   /note="COG1454"
FT                   /db_xref="GI:118575743"
FT                   /db_xref="GeneID:6370729"
FT                   /translation="MHTVRIPKMINFGENALAETEYPANALVVTTAAPALSEKWLAKME
FT                   IKDYMLYDKVNPEPSVEDSQALIAEFKDKKPSVLIGLGGGSSLDVVKYSARDFGVEKIL
FT                   IPTTFGTGAEMTTYCVLKFDGKKKLLREDRFLADMAVVDSYFLDGTPQQIVNNSVCDAC
FT                   AQATEGYDSKLGNDYTRGLCERAFNILYDAIMSGNTKEYPYGSMLSGMGFGNCSTTLGH
FT                   ALSYVFSNEGVPHGYSLSSCTTVAHKHNNSKFYGRFKECMEKLGFERLDLKADISEAAD
FT                   VVMTDKGHLDPNPVPIAKQDVIKCLERIKSGDL"
FT                   /transl_table="11"
FT                   /protein_id="YP_875486.1"
FT   gene            complement(481521..481703)
FT                   /db_xref="GeneID:6370730"
FT                   /locus_tag="CENSYa_0550"
FT   CDS_pept        complement(481521..481703)
FT                   /locus_tag="CENSYa_0550"
FT                   /gene_family="HOG000106709" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal protein S30E"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575744"
FT                   /db_xref="GeneID:6370730"
FT                   /translation="MATHGSLTKAGKVRSQTPKIEGRKKTGTNASVQNRSNYRKRLVLN
FT                   RFPGQNKPGQRRRRR"
FT                   /protein_id="YP_875487.1"
FT   gene            481702..481869
FT                   /db_xref="GeneID:6370731"
FT                   /locus_tag="CENSYa_0551"
FT   CDS_pept        481702..481869
FT                   /locus_tag="CENSYa_0551"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575745"
FT                   /db_xref="GeneID:6370731"
FT                   /translation="MIIRSAGAIYTFGTGLWVPGWARPGFRHGLHPCFFPRLNLHDIRE
FT                   VFYTERIHTY"
FT                   /protein_id="YP_875488.1"
FT   gene            481869..482012
FT                   /db_xref="GeneID:6370732"
FT                   /locus_tag="CENSYa_0552"
FT   CDS_pept        481869..482012
FT                   /locus_tag="CENSYa_0552"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575746"
FT                   /db_xref="GeneID:6370732"
FT                   /translation="MDDSTNPRDEAPGNTPGSDKDVKKGKEQVVYFDGTEEFMTVVIHV
FT                   PP"
FT                   /protein_id="YP_875489.1"
FT   gene            complement(482078..482518)
FT                   /db_xref="GeneID:6370733"
FT                   /locus_tag="CENSYa_0553"
FT   CDS_pept        complement(482078..482518)
FT                   /locus_tag="CENSYa_0553"
FT                   /gene_family="HOG000106720" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575747"
FT                   /db_xref="GeneID:6370733"
FT                   /translation="MTEERRYIDFEVVKERWNVYELEDGTKLKTRNTLRSVWVETDSLG
FT                   AVAYHCDIHNMRVVLCHTSKQGEKDQTPHTPSQLMENIEKRVCRYETMSYEASEYTLDN
FT                   NVGIVFHLNLNRISRTSLFDPKGDRIYLSDLRSSRVLYLPNT"
FT                   /protein_id="YP_875490.1"
FT   gene            complement(482581..484305)
FT                   /db_xref="GeneID:6370734"
FT                   /locus_tag="CENSYa_0554"
FT   CDS_pept        complement(482581..484305)
FT                   /locus_tag="CENSYa_0554"
FT                   /gene_family="HOG000222870" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="Fe-S oxidoreductase"
FT                   /transl_table="11"
FT                   /note="COG1032"
FT                   /db_xref="GI:118575748"
FT                   /db_xref="GeneID:6370734"
FT                   /translation="MGHPKIVLSADRTLMSPYRNISLATFFGCAPALDPNRDPKSFWYK
FT                   ILKNQVTPKVLFDFICNYIPHHNGVADYAPYGLRKVEAGLLRDGFEREEVVVAHPDHIE
FT                   QFIGPETEAVGTYEMDPLGMGPVTMTFTYGRKQMSYDEYYNREIHRRILAAKEKTGSKA
FT                   KVIVGASGTWQYNYAPEKIKEYGLYAVLEGELGGIAPEIDGHAGQFFRHLINGDFEYTD
FT                   QSRMSGNFRVNMKEFDNEGEKIHGRFVNFWDRPELDEIPEIVEPSMHGMIEVMRGCGRG
FT                   CKFCDVTLRALRYYPPEKVKREIEVNKRFGQTSAWIHSDDIFVYGMNPRTSKGMEPNRD
FT                   ALVDLFKGVMSAGVKHTNPTHGTLAGAVADEKLIPMLSKIIKSGPENMTGIQVGFETGS
FT                   LRLIEKYADRKLAPYKPSEWHWLVKEGVKTLNQDYWVPAFTLIMGLNNDETPEDSWETI
FT                   QLISDLETEQPDSMFTTTPLTFVPIGLLEKSDFFNIGNEMDPAQLGVMYKTWQHNFKYG
FT                   IQKFMTKTGGGNSAKKLFFNAIARSLGGVPLTAMEKYARRKSREHELVIEKIKAKYW"
FT                   /protein_id="YP_875491.1"
FT   gene            complement(484468..485247)
FT                   /db_xref="GeneID:6370735"
FT                   /locus_tag="CENSYa_0555"
FT   CDS_pept        complement(484468..485247)
FT                   /locus_tag="CENSYa_0555"
FT                   /gene_family="HOG000225118" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="2-polyprenylphenol hydroxylase"
FT                   /transl_table="11"
FT                   /note="COG0543"
FT                   /db_xref="GI:118575749"
FT                   /db_xref="GeneID:6370735"
FT                   /translation="MEIERVIDETPTVRTLLFQDDIMEGALPGQFAMVWVPGAGELPMS
FT                   VMAAEEPGMAAFTVRRRGAASTGLYDTAKGGLIGVRGPYGRAFEATQGRALLVGGGTGM
FT                   SPLMRLLSRLGSASHVDVLIGAQTEKEVFFEGLAGRLAGDVPHRIVVTTEDGSYGRQGR
FT                   VTDELEGMLDEKPDAVYTCGPEPMMHAVVRAADSRGIPVQASVERVMKCGVGICGSCCM
FT                   GEDLVCTDGAVFDGKHLIANSEFGSVFRDKSGTVRNV"
FT                   /protein_id="YP_875492.1"
FT   gene            complement(485261..486106)
FT                   /db_xref="GeneID:6370736"
FT                   /locus_tag="CENSYa_0556"
FT   CDS_pept        complement(485261..486106)
FT                   /locus_tag="CENSYa_0556"
FT                   /gene_family="HOG000225105" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /EC_number="1.3.3.1"
FT                   /note="COG0167"
FT                   /db_xref="GI:118575750"
FT                   /db_xref="GeneID:6370736"
FT                   /translation="MLASGILGISVDVFRRVLGAGAGAVVTKSLSREPWEGYSNPTITG
FT                   TGGGGWLNAVGLSNPGASAFAGMLKGQGLPAVVSLVGSAPAEFVSMIKEFRDGAAAFEI
FT                   NLSCPHVAKVGLEVGDDPGLVGEIVSAAKRAADVPVFAKVGLGSTHYIKTAGAAAEAGA
FT                   DAITAINTVRAMSIDVEAKKPVLSNGFGGLSGPPIRPIAVRCVWELASKYDVPVIGCGG
FT                   VSSWEDAIEMMLAGACAVQVGSAAGGRIGIFGEINAGILGYMERNGFGSVKEMVGLART
FT                   "
FT                   /transl_table="11"
FT                   /protein_id="YP_875493.1"
FT   gene            486266..487444
FT                   /db_xref="GeneID:6370737"
FT                   /locus_tag="CENSYa_0557"
FT   CDS_pept        486266..487444
FT                   /locus_tag="CENSYa_0557"
FT                   /gene_family="HOG000227188" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribosomal biogenesis protein/nucleolar protein"
FT                   /transl_table="11"
FT                   /note="COG1498"
FT                   /db_xref="GI:118575751"
FT                   /db_xref="GeneID:6370737"
FT                   /translation="MNRVVLTELGIVVYDGDKISNRLPFGSPASEYAAIQDGSSGVPAL
FT                   KSCLRGTDATVNDRALLRILRKASMDVRECSEAEAADIRSSKLQILEEAGFASGEDDAM
FT                   DKLRRFALELSSFRIAAESQSPDLHIIQAVGALDSLDDAINAAASHMREWYGLHFPELE
FT                   SLADGIPGYAGIASAGRRDGLSRGTFEAAGYDARRSEMMDLVCGKSRGGEISDANLRMV
FT                   QALAAEVLALHRLRSEMESHIDEQMRSSAPNVTAILGATVGAKLLSRAGSLRRLASMSS
FT                   STIQILGAEKALFRSLKTGSQPPKHGLLFQHPLVHSAPRWQRGKVARAVAAKAAIAARI
FT                   DYHTGEPNGALLQSLEARISEISEKYKDPPERPPAKPPGARRKRGGFRRKRA"
FT                   /protein_id="YP_875494.1"
FT   gene            487518..488123
FT                   /db_xref="GeneID:6370738"
FT                   /locus_tag="CENSYa_0558"
FT   CDS_pept        487518..488123
FT                   /locus_tag="CENSYa_0558"
FT                   /gene_family="HOG000106741" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="fibrillarin-like rRNA methylase"
FT                   /transl_table="11"
FT                   /note="COG1889"
FT                   /db_xref="GI:118575752"
FT                   /db_xref="GeneID:6370738"
FT                   /translation="MDPGCSVYGEKLLDRAGTEYRLWDPFRSKLAACIYNGLERLPIIP
FT                   GSRVLYLGASTGTTASHVSDIVGGRGAVFAVEPAGRVARDLLHRVASRRPNVIPIMQDS
FT                   RRPGEYPGMYGAADVVYADIAQPDQTAMAVANCKMYLRAEGSLLLVIKARSIDSVRDPA
FT                   GVIREETAKLEADFGISQAVDLRTYDRDHSLVHAVYPG"
FT                   /protein_id="YP_875495.1"
FT   gene            complement(488120..488737)
FT                   /db_xref="GeneID:6370739"
FT                   /locus_tag="CENSYa_0559"
FT   CDS_pept        complement(488120..488737)
FT                   /locus_tag="CENSYa_0559"
FT                   /gene_family="HOG000100289" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="COG0164"
FT                   /db_xref="GI:118575753"
FT                   /db_xref="GeneID:6370739"
FT                   /translation="MLVCGVDEAGRGSLVGPLVIAGVAIKRNRMRELKSMGVRDSKKLT
FT                   RKARESLYPEIVNMADSYHISRVPPGVVDRSVGRHMLNDLEARYMARVITRLGHGTTYV
FT                   DSCDVNPRRFGGRVSEMSGRTVRSYHRADDRFVIVSAASILAKVARDRSIERLRKSHDV
FT                   GSGYPSDRRTVGFVRGYYNKNGAMPPFVRRSWRPARLIEAGG"
FT                   /transl_table="11"
FT                   /protein_id="YP_875496.1"
FT   gene            488736..489647
FT                   /db_xref="GeneID:6370740"
FT                   /locus_tag="CENSYa_0560"
FT   CDS_pept        488736..489647
FT                   /locus_tag="CENSYa_0560"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="site-specific DNA methylase"
FT                   /EC_number="2.1.1.72"
FT                   /note="COG0338"
FT                   /db_xref="GI:118575754"
FT                   /db_xref="GeneID:6370740"
FT                   /translation="MACAGGAPVLNRVRDGRTINYIGRAAAGAAVEQFTVRNGIGRGGP
FT                   KLIPYIGCKSGFMHIFDQLVPDDPGRIYDIFGGGGSFAFYACGRFGAKKVVYNDHNPVV
FT                   ANLVRTLQRDPGGLHAEYQKHYSKSSPEYYLGVRDKDLLDGTRGAGRFFYLAKNAFSGK
FT                   IRFNTKNKFNSPMRKGARCPRVDADALRSLASSISGMEITCRDFAEYDDISGSFVYLDP
FT                   PYMNNPNGHYNAVVGLDEFSRFVQKIEGRNRVMISEQNDPDSLRLSPGYTIFKVSLRRS
FT                   LQYFTQNGSSEIIAVNYDAGHG"
FT                   /transl_table="11"
FT                   /protein_id="YP_875497.1"
FT   gene            489649..490782
FT                   /db_xref="GeneID:6370741"
FT                   /locus_tag="CENSYa_0561"
FT   CDS_pept        489649..490782
FT                   /locus_tag="CENSYa_0561"
FT                   /gene_family="HOG000229931" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="N2,N2-dimethylguanosine tRNA methyltransferase"
FT                   /EC_number="2.1.1.32"
FT                   /note="COG1867"
FT                   /db_xref="GI:118575755"
FT                   /db_xref="GeneID:6370741"
FT                   /translation="MPAGPAQGCIETTEGSTRLLVPEGSLGPGVPPREPAFFNPRARAN
FT                   RDTSMAAYSAHLRGLHDAVLLDCMSGLGARGLRAANEVGGIEVCLNDTNEQALNIARES
FT                   AKLNCLDCVSTSNAEACSFLAEHWGRGKRAAIVDIDPFGSPAPHLDCCLRAVSHGGMLS
FT                   ITATDLQVLNGIFPDACRRIYGGSPARAVFGAEAAVRLLLGCLRNVAARLGVSFEPLLT
FT                   ESDQHYYRSYVRVLARRDTSENMGFLYRCVTCGDRGASPSPGTSCPCGGTLDIAGPLWT
FT                   GPLFEGRFLNMMLEEAGRLPLGEKCAKRIETCIGEQGLPPAYYTLDEMASRCRASPPKR
FT                   DFVIEYLRGRGYSAGPTSFDPSGFRTDAPVSEVRGAF"
FT                   /transl_table="11"
FT                   /protein_id="YP_875498.1"
FT   gene            complement(490779..491369)
FT                   /db_xref="GeneID:6370742"
FT                   /locus_tag="CENSYa_0562"
FT   CDS_pept        complement(490779..491369)
FT                   /locus_tag="CENSYa_0562"
FT                   /gene_family="HOG000162366" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="23S rRNA methylase"
FT                   /EC_number="2.1.1.-"
FT                   /note="COG0293"
FT                   /db_xref="GI:118575756"
FT                   /db_xref="GeneID:6370742"
FT                   /translation="MRPLDAKKDHYRKMAREQGYRSRAAYKLKELNKAYRIIGAGFTVL
FT                   DLGCAPGSWMQVAASAAGNRGTVLGVDLEYAEELNHAESMRGDVEDESLAETVAERLGR
FT                   ADAVICDLSPQVSGNWSVDHARQISLNYAAARIMGRVLAPKGNAVFKVFDGEYAAEFRE
FT                   HMGHMFSKTKSTKPQASRKQSSELYLVCLGFRG"
FT                   /transl_table="11"
FT                   /protein_id="YP_875499.1"
FT   gene            complement(491366..492454)
FT                   /db_xref="GeneID:6370743"
FT                   /locus_tag="CENSYa_0563"
FT   CDS_pept        complement(491366..492454)
FT                   /locus_tag="CENSYa_0563"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional regulator"
FT                   /transl_table="11"
FT                   /note="COG1522"
FT                   /db_xref="GI:118575757"
FT                   /db_xref="GeneID:6370743"
FT                   /translation="MTKNDELVGDKNKSELEAELAAYKLELSKLNAKKKPAGAGKNAAP
FT                   KAGSAAKAAGKKAAEPKKTVPAKTPDITKPAAKPVPKKPAAAKPVPKKPAAKPDATKPA
FT                   AKPDAAKPAAKPDATKPAAKPDATKPAAKPDATKPAAKPVPKKPAAAKPVPKKPAAKPV
FT                   PKKPAAKPVPKKPAAKPAAKPVPKKPEAKPPEPKPPRKTKKQLEEEARKEKEERERTIE
FT                   EEMEKSLSGEEIENFQIERVDMDRLTNKVCEMLAAYESAGAVQNVLWKRLKLNSRNGAR
FT                   LALKLERTGYITREKILEKGRWTYKLILKKTPISTASIENSPCLICPVEQQCSADGEIN
FT                   PRTCQWILDWVTSKGERPKMLQ"
FT                   /protein_id="YP_875500.1"
FT   gene            492785..494302
FT                   /db_xref="GeneID:6370744"
FT                   /locus_tag="CENSYa_0564"
FT   CDS_pept        492785..494302
FT                   /locus_tag="CENSYa_0564"
FT                   /gene_family="HOG000229394" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /EC_number="1.3.3.1"
FT                   /note="COG0167"
FT                   /db_xref="GI:118575758"
FT                   /db_xref="GeneID:6370744"
FT                   /translation="MEYPAVKGLVYNVHLQGYCLAGGIAWPEAENVHPAVAPVRRRREQ
FT                   RACGRSCGGACIRPFALLHGLGQHEPPEHKGEHRRKEEHDIDSLCGHRSTPRTSHISAL
FT                   SPAPRCRRGCPWATTHKSEAVRVPPVRITVSAIKADVGGIGGHTLPSSGLLDAVRRKVS
FT                   SSSLLIDHYIGYCGDDVHIVMTHTRGTDNSDIHKLAWDAFMEGTRVAKEEGLYGAGQDL
FT                   LRDSFSGNVKGMGPGVAELEFEERANEAFTVFAADKTEPGAFNYPFYRMFVDSLSNTGL
FT                   IVNKSLAEGVVINIMDVSKARTARLVLWEDKPTIEAALMYPGRFVVSSVETRDGEPIAS
FT                   ASTDRLHNIAGTYVGKDDPICLVRTQKRFPATEEAGSCFNNPHYVAGNTRGSHHMPLMP
FT                   VRLNSPASINFCIPIVEALVFSMHEGRLTGPFDGFSTPDWDDVRRTATRRAHAMRRQGF
FT                   VHPATLVPDELEYAEGYRSRMDVLDSKMVPLKDSGPAGTGRAYEDPD"
FT                   /transl_table="11"
FT                   /protein_id="YP_875501.1"
FT   gene            494502..499202
FT                   /db_xref="GeneID:6370745"
FT                   /locus_tag="CENSYa_0565"
FT   CDS_pept        494502..499202
FT                   /locus_tag="CENSYa_0565"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG3391"
FT                   /db_xref="GI:118575759"
FT                   /db_xref="GeneID:6370745"
FT                   /translation="MSPQGVAAGPDGSVYVTDLGNMRVQKFDDSGAFLLQWGGQGIANG
FT                   SFKSPEGIAVGENHTVYVVDGQLNRVQAFTPEGEFLFGWGTQGSNSGEFLLPRGIAADP
FT                   GGDIYVADTGNHRIQRFTPDGGYVSEIVGSSGSGFISPAGLAAAGNGTVYVTFAGGNAI
FT                   EKYGGTGELLSRYDSSVGGRPIRAHGLEADPEGNLYVADTGNDRILRLDANGEAISVWG
FT                   SSGSDGGMFKMPQDLALGPDNSLYVVDANGHRVQKFGTPLQAQPVQDEPAKDPAQGAPA
FT                   QGGPVQGAPAQGAAPVSGDLTKPVITPPNDLFIEATGALTPVNVGRATATDASGITSLT
FT                   HNTPGEFTLGTSTVIWTAIDGAGNIAVATQSVTVSDTTPPVIDGIGGVAVEAAGTGGNT
FT                   IDLGTPGVSDAVGVLSLENDAPQNYPLGKTVVTWTARDIAGNEASVQQEVSVVDSTPPA
FT                   VSAPPAITIEASSPGATEAFLGAPGVTDNGEIISISNDAPAGFALGNTTVTWLASDSSG
FT                   NTASDVQLVTVIDTTPPAISPPRDITSEASSQGTNSVDIGSPDVSDVQAVEVSSNAPAL
FT                   FPMGETVVIWTATDASGNNASAVQRVTIVDTIPPLVAVPADVTAEATGPGGAEAGLGEV
FT                   TVSDVSAISSIDNDAPASFPIGETVVTWTVRDAHGNIQAALQTISIVDTTPPSVIPPRD
FT                   IIIEAASAEGAHADPGLPTVNDIVGVHAVDSDAPEMYPVGMTTITWSAADAAGNTATAT
FT                   QAVTVVDSTAPVVEAPSDVTAEAAGPDGAAAETGEASASDATGISSTSSDAPAIFPLGT
FT                   TEVTWTAADNHGNTAQDIQAVTILDTTSPVISAPPDISIEAAGPGPEAADIGVADAGDL
FT                   VGVSYMQNDAPAAYPLGTTEVTWTATDDAGNSASAVQKITVYDTIPPVVLAPADVSAEA
FT                   ESAAGAAVRLIGVNASDAVGVVSVSSDAPEIFPLGETVVTWTASDEAGNTAADTQLVTI
FT                   SDTTPPSITAPRSVLAEATGAESSVDYGSAASADEVGVTSVYNDAPAVFPLGLTTVTWT
FT                   AEDAAGNSKSAVQQVSVVDTTPPEISAPEDLVLEAENDGGGKAQLGEAAADDLVLLESI
FT                   ENDAPGTFPIGETEVTWTATDSSQNTATAVQLVTVGDTVPPGITAPADITAEAEGPRGS
FT                   AVPLGVPEASDTAGSVAVSNNAPSIFPIGETEVTWTASDDAGNTASDVQQVTVLDTIPP
FT                   ELALPADVEAEALSPSGNVVDTGEAAAEDLVGVLSIESDAPELFPYGETVITWTAVDDA
FT                   GNTVSGEQTISVIDTTAPSVVAPPDVEMEAASAAGNPVDTGTATAEDTVGVASLESDAP
FT                   AEFTLGDTLVTWTATDADGNSASDVQRVVIVDTTAPEITPPPDVEVEASSMETEVEIVA
FT                   ATALDLVDPAPSVAGDARGLFPLGSTNVTWTASDMFGNEASTVQVVTVLACGRPAEYYN
FT                   LIEGTHDNDILQGTSQADLVFALGGDDIISGAGGNDCIFGGDGDDIILGGGGDDTLSGG
FT                   GGNDIIRGHSGVDAITGGGGADIADGGDDRDTCGIEPDDTAVKCEA"
FT                   /protein_id="YP_875502.1"
FT   gene            complement(499261..503295)
FT                   /db_xref="GeneID:6370746"
FT                   /locus_tag="CENSYa_0566"
FT   CDS_pept        complement(499261..503295)
FT                   /locus_tag="CENSYa_0566"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG3391"
FT                   /db_xref="GI:118575760"
FT                   /db_xref="GeneID:6370746"
FT                   /translation="MPEVHQAGAPPSGAPAPEGSPNAPLSAAQESGIRGAPQDGSVAGA
FT                   QGHTEPRSKSARQDSGAAPRIISAVLANGSITVTFDSAVDIASVRAERIHVRNGSEFSG
FT                   GLDLGGAAVSGGGGTLVIGLTGAQLDELAGYAGARLQFDEAALSGEGGALFPAAFKLPG
FT                   PVNTGERIINPTQTGPRGIAFSDDGLKMFVAHEYFGGLIYQYRLGSAFDVTGASRVGSV
FT                   AVGDQEEAPGAIAFSADGMRLFVAGPASEAVHGYDLSRPFAPGTLEYFGSLDLSAQDPD
FT                   PHGLAFSDDGLSMYVAGLGGFVHQYSLNGTYALDGAAHAASLDVRSEERIPTGLALSPG
FT                   GGFMYITGPEGFVHAYRLAEPFEVSTATLHTSFPYRGNLTSTDVAFGGGKMFIGRSHDL
FT                   GRDPVIQQYDLRAPYDIGAFPTRSLSVGGQDSSPTGVDVSGGGTVLVVSGNQNDAVYAY
FT                   DMVRHDIGTSTLSDTFVARNRQNALHDVRLSADGLLMYTVGLQPSIVHRYNLSGVNDIS
FT                   DPARSGAFDTSLQEGRPRGLEISAGGAGLFITGTGNQSVQQYVLGQPYNISAASHDGTF
FT                   PADDARPTAITFAPDGLRMYLLGRESVSIYGYDLEEPYNLSSAVLAGSFYAGGQGGVPQ
FT                   LASLQGLAFSSDGLHLFVADSGAGRIHQYAMNMHPLRVPLQAADVPHGGRDSPLLAEKV
FT                   SLGVHLPAGDVAAPRDAADAARNAGVVSVYVADAMEIGDGHNVDRARAAEGVDGPAVRD
FT                   GVALSTGLRADDAPAVGTSGDAALMGMINAGDASRLADAVLLNVGLLPEGAPELGDAGD
FT                   AVRNAGVVSVYVADAMELGDGHSVDRDSVVETMDGPAVRDGVALSAALLAEDAPSVGTF
FT                   ADAALAGMINARDAGRLADAVMLNVHLLAKDAPVVEASGDAITMGMINARDIGRPADAV
FT                   MLNVHLLAKDAPVVEASGDIITMGMINARDVGRLADAVKLNVHLQAKDAPVVEASGDII
FT                   TMGMINARDIGRPADAVMLNVHLLAKDAPMIEMAGELDGMLAVLDRPLPVEKITLGRFI
FT                   HVADSPGVADREGDVIRTGTSPVVADSAVADIATGVEDEAGPVRGDSGAAPTRSRSGGG
FT                   GGSSSLPAGTSLGYDVEFGFSSGGSNAALGPFSLRVEPGYPLVITPMLVPEGIMNIYDV
FT                   ELLFAGAGDSLAEVYYNRLGVFGKQCSGMIWQSDRVHACDMSSVLSGPARYDQPGSITV
FT                   PLEGFTGTLSIKLRNSQGIVLATHDDDRYYIFTPGAAAPRAPAQGPSDGPTEPPAPRAP
FT                   DILDAPASGTVPVQDAGRAEPPVQIGPEAGPAVPDAEPALPAAKGLFDVIMDFFRNLLG
FT                   L"
FT                   /protein_id="YP_875503.1"
FT   gene            complement(503339..503560)
FT                   /db_xref="GeneID:6370747"
FT                   /locus_tag="CENSYa_0567"
FT   CDS_pept        complement(503339..503560)
FT                   /locus_tag="CENSYa_0567"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575761"
FT                   /db_xref="GeneID:6370747"
FT                   /translation="MDLKRRVRRGAAGPCGMTGISYAVLAAVVLVHVTEAGALPGITQE
FT                   PAGQIIDPAVYESAMPAAAGAAPPPHEL"
FT                   /protein_id="YP_875504.1"
FT   gene            complement(503815..504495)
FT                   /db_xref="GeneID:6370748"
FT                   /locus_tag="CENSYa_0568"
FT   CDS_pept        complement(503815..504495)
FT                   /locus_tag="CENSYa_0568"
FT                   /gene_family="HOG000105404" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575762"
FT                   /db_xref="GeneID:6370748"
FT                   /translation="MSPALDTFWAMPPQRNRALYHKTFMENCATDPALAGDICIVCRQQ
FT                   LGDEYSEYTIKNLSDSKVGNLHFHKEPPCFDPGSDILARQLRGRVKKFVQVRTRAGGRE
FT                   YEYNMQPTAEGRLELIIIQSHPKFGMVPETKALKMLRDIYSDDKLVMLSTRHASKENGL
FT                   LMLAHVSDKIFSSHLEACPRDTPRLGELRQDLEIRGKDPLEEAEILGDFARELVCLVDG
FT                   EPGR"
FT                   /protein_id="YP_875505.1"
FT   gene            complement(504646..505296)
FT                   /db_xref="GeneID:6370749"
FT                   /locus_tag="CENSYa_0569"
FT   CDS_pept        complement(504646..505296)
FT                   /locus_tag="CENSYa_0569"
FT                   /gene_family="HOG000018858" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional activator, adenine-specific DNA
FT                   methyltransferase"
FT                   /transl_table="11"
FT                   /note="COG4725"
FT                   /db_xref="GI:118575763"
FT                   /db_xref="GeneID:6370749"
FT                   /translation="MSRQSSYSVYSKDVRNRTKQNRVPREILYQKLPNRKFDIIYADPP
FT                   WDYNGKLQYDKTDLYVSTSSFKYPTMKTEKMMEIPIKKIASSNSLLFLWATSPHLEQAI
FT                   QLGKAWGFEYRTVAFVWDKMNHNPGKYTLSNCELCLLFKHGKIPTPRGARNVRQLITVP
FT                   RSEHSRKPVQAMQGIERMFPFQKKIELFAREKYRGWSAWGLDLVLKNKIKNLI"
FT                   /protein_id="YP_875506.1"
FT   gene            505584..507107
FT                   /db_xref="GeneID:6370750"
FT                   /locus_tag="CENSYa_0570"
FT   CDS_pept        505584..507107
FT                   /locus_tag="CENSYa_0570"
FT                   /gene_family="HOG000236792" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ABC-type phosphate transport system, periplasmic
FT                   component"
FT                   /transl_table="11"
FT                   /note="COG0226"
FT                   /db_xref="GI:118575764"
FT                   /db_xref="GeneID:6370750"
FT                   /translation="MPGHVHYIRAMPGHRASASRSKKNHQSAPPAACPRPLGFCTSEVP
FT                   RQGIFPPRQKSSPARLCQAAHLARRSPDPRNFCTCALCLARPIRRDLKLIKRQPLPAAM
FT                   KAALSALAVAAVLAASFAHAQPEPHTGDELSINAAGATFPFPLIDLWRVEYNSLYESVN
FT                   LNYQSIGSGGGIKQHIEGTVSFAASDKPMSGSESERAPGTLHIPEAIGGIVIAYNLPEI
FT                   HRSGVQLTGSMIADIFLGKITRWDDPAIASANPGLELPAEDIITVHRSDGSGTTFVFTD
FT                   YMVHVSPEFDEMVGRGKSVPWPSGVGAAGNEGVAGVVKTTPYSIGYIELAYAFQAGITY
FT                   ADVQNADGTTFITPTLETLAAASEHAAEVGLPAAHEAWDGVSIVNAPGSDSYPIASLTY
FT                   LLVYEDLEKSTDSIEEARAVVHLVHWMITEGQQYSSSLLYVPLHAHVADIGKAGLKRVS
FT                   YEGELIWEEKYQIPQWIKDNALWWAEGKITDEDYISGLQYLISQGILKV"
FT                   /protein_id="YP_875507.1"
FT   gene            507471..508412
FT                   /db_xref="GeneID:6370751"
FT                   /locus_tag="CENSYa_0571"
FT   CDS_pept        507471..508412
FT                   /locus_tag="CENSYa_0571"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575765"
FT                   /db_xref="GeneID:6370751"
FT                   /translation="MLVEKTQTVPPVSKKKVEDRQAELGKQSGLLTRNLAETILDTPAI
FT                   RGMQGVIDAQDALIKKLNDLNKILMGNSSMPAAGTIHGEMDAPVKDSWKRAVRHSGAIA
FT                   DKQVTRTNIKGRVARVLFNAPRGKLTKYGVAKRAESGYPWVKTILQRLEGDGIIRGTQV
FT                   IDFRGLMKWWRLHQPSPKYRDYLMRRPLKALDTKLDYALTSYYAEDKIQGYLFTSSLEL
FT                   HIRESDKRFWHELVMKKGASAGKGDVRLISGDEHVFYGSFMVDGVRLASIPQIMLDLYD
FT                   LGGAAHEAADMIMEKWEKEATVTEPRPPHYPQ"
FT                   /protein_id="YP_875508.1"
FT   gene            508499..509341
FT                   /db_xref="GeneID:6370752"
FT                   /locus_tag="CENSYa_0572"
FT   CDS_pept        508499..509341
FT                   /locus_tag="CENSYa_0572"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575766"
FT                   /db_xref="GeneID:6370752"
FT                   /translation="MDSEVRRLYDKFETRISKDNMLHVLSAVEGPACLVGGWAVYLTVN
FT                   EKYEELYGRTYQESRDIDIAFHFSKNETADSLHISPFYQAVQALKNLEYEWSGFRLLRE
FT                   YDRDSMVPLAQEAAKKRPSFELFRLYVDLIADNVPENFQDVMGFTPVNQRIFEPIFTEN
FT                   LSVTKEISGVKVTLPAIEVLVASKTISMPDRPPDHKKTKDIMDVFTLIWQSEDRLAEMK
FT                   ADMLRLLSKYHGQEHPQKYVEQAFAKVSQSDCDDAAKPLGIDPAMITDALDNFARLPV"
FT                   /protein_id="YP_875509.1"
FT   gene            complement(509460..509918)
FT                   /db_xref="GeneID:6370753"
FT                   /locus_tag="CENSYa_0573"
FT   CDS_pept        complement(509460..509918)
FT                   /locus_tag="CENSYa_0573"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575767"
FT                   /db_xref="GeneID:6370753"
FT                   /translation="MVTRQASRIFRFPTQILSSTKSPGVNPGDDMVDNTKPGHAAHIVL
FT                   DEILLLEKASTNCMDHGAKTRIKQSGMQYTAHMLGDKLWTFPLTRIECWKCRFSSHAYM
FT                   IESPEGIPHAYCHRCGEDTMHRVTDDTSTTPDEAMRLITEYYRNMGLI"
FT                   /protein_id="YP_875510.1"
FT   gene            510093..511292
FT                   /db_xref="GeneID:6370754"
FT                   /locus_tag="CENSYa_0574"
FT   CDS_pept        510093..511292
FT                   /locus_tag="CENSYa_0574"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575768"
FT                   /db_xref="GeneID:6370754"
FT                   /translation="MALAAVLPLLLAGGMASSSAVTWDESTWDEDLYFAAAVDGSMAHL
FT                   RALDLNLQDRNGPLAEAHALHLMLLEYPKMEWQLQADPDFDERLVQTLQDVQVRATIKA
FT                   DPEDAQASMDDAAAILEEARMLVVGDELSRDKDFKLSVIVELLKMAKFFYDVGVSDGEV
FT                   VALAEFQQSSALVWRSDQILSGFSGDLHSGDLVRVNGLLEEIDRSFSARSNPDFVLLQM
FT                   DALIKVLESNVDRMPGEMMDDKMMDEKMMDDGHMAGDEHMDDGHMEDEMMGDNMMDDDK
FT                   MMGDNMMDGDEMMGDNMMDDDKMMDDRMMGDKMMDDRMMGDKMMDDRMMGDKMMDDRMM
FT                   GDKMMDGMVLPPLKQIMAGVEPAEIECMDGFELLFGPSGRPACIMEDTVSRLVQAGWTS
FT                   "
FT                   /protein_id="YP_875511.1"
FT   gene            511392..512279
FT                   /db_xref="GeneID:6370755"
FT                   /locus_tag="CENSYa_0575"
FT   CDS_pept        511392..512279
FT                   /locus_tag="CENSYa_0575"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575769"
FT                   /db_xref="GeneID:6370755"
FT                   /translation="MKLSQIHAMKMVAAILPLLLAGGMAASSAESWGDELEFSSAVEES
FT                   LSHYHAFELNLDAGNTELAAAHAAHPALELYPVMSPHLQAYPELAERLRLALLDVPSTA
FT                   GPGAERADAQAAVDAATALLEEARLLVAGGELSSDDDFKLALTAGLLGTAGHEYGEAVS
FT                   GGEIINMVEFQDSSAFVWRSQQILKNLDLPDGDLERVMALYAEIQGGFDSRSDPSLMTP
FT                   RFDALAAALESNMDAGPTARGDIAPPLKQLNMGVDPADIQCIDGLGLLFSPSGRPACIS
FT                   EKTAPMLQSEGWTS"
FT                   /protein_id="YP_875512.1"
FT   gene            512356..513321
FT                   /db_xref="GeneID:6370756"
FT                   /locus_tag="CENSYa_0576"
FT   CDS_pept        512356..513321
FT                   /locus_tag="CENSYa_0576"
FT                   /gene_family="HOG000074139" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ABC-type phosphate transport system, permease
FT                   component"
FT                   /transl_table="11"
FT                   /note="COG0573"
FT                   /db_xref="GI:118575770"
FT                   /db_xref="GeneID:6370756"
FT                   /translation="MRHSRHRPGGRAISDRLFRLGATIAGAYVLAVILVIFLQLGIESA
FT                   PIWEKEGAAFIWGTDWNPVEGRDSFGALPYIVGTLLTAGIAMAIGVPLSIGIAMLVIIA
FT                   PGKIGAPLGYLVELIEAVPSVIFGLWGLFVFRVYLRDWVEKPLHDMFGDSIFLFSGTPF
FT                   GLDVLSASLILAIMIIPTISAVSREVMTAVPQQQKEAAYMLGSTTWEMFRMAVFPYSKA
FT                   GLIGASVLGLGRAVGETMAVTMLIGNATGLRAIPESLFDPAQSMASIMANEFIEADLVF
FT                   HVPALIGVALVLLLISMAINVGAHFLVSRMLHIRQEAVNS"
FT                   /protein_id="YP_875513.1"
FT   gene            513354..514232
FT                   /db_xref="GeneID:6370757"
FT                   /locus_tag="CENSYa_0577"
FT   CDS_pept        513354..514232
FT                   /locus_tag="CENSYa_0577"
FT                   /gene_family="HOG000074142" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ABC-type phosphate transport system, permease
FT                   component"
FT                   /transl_table="11"
FT                   /note="COG0581"
FT                   /db_xref="GI:118575771"
FT                   /db_xref="GeneID:6370757"
FT                   /translation="MFQSNVRKRLAVNKAMTLVIIACAATAITPLLWILGTLFVGGAGA
FT                   LSWEFLTAEPGAVGTGVPLAIGPAIQGTLIIIGLSGILGIPVGVMAGVYLAEIGRGRLA
FT                   AQVRFFMDVFMQVPSIVLGIFAFLAIVLLVGGFSLWAGAFALSLIMFPIVARSTEGAMR
FT                   MVPWSLREAGTALGLRGWVVTLRVVLPAAKRGIITGVLLSVSRVGGETAPLIMTILGSS
FT                   QFFAGLSDPMDALPLRIWRLSLQPYDEARLAGWGAALVLVLVILAIHVGVRYWFVHRGK
FT                   GLIASPGRAGA"
FT                   /protein_id="YP_875514.1"
FT   gene            514235..515056
FT                   /db_xref="GeneID:6370758"
FT                   /locus_tag="CENSYa_0578"
FT   CDS_pept        514235..515056
FT                   /locus_tag="CENSYa_0578"
FT                   /codon_start="1"
FT                   /product="ABC-type phosphate transport system, ATPase
FT                   component"
FT                   /EC_number="3.6.3.27"
FT                   /note="COG1117"
FT                   /db_xref="GI:118575772"
FT                   /db_xref="GeneID:6370758"
FT                   /translation="MAATASTLRPDTSAEIPAGPADGYKMIAENVTVHYGDVCAVSDVS
FT                   IKFHERSVTALIGPSGCGKTTFLRCLNRMHDMTGSARVEGRVSIDGTDLYGGDVDPIYH
FT                   RRKVGMVFQKPNPFPTMSIYDNAVAGVRLNGVRDRGILDEIARDALEMAYLWDEVKDSL
FT                   KRPAMELSGGQQQRLCIARALAIQPEVLLMDEPASALDPIATQKIEETITELKREYCII
FT                   IITHNMQQAVRCSDYTGFMYMGKLIEFGKTGRVFTQPRSELTSKYVKGQFG"
FT                   /transl_table="11"
FT                   /protein_id="YP_875515.1"
FT   gene            515094..515630
FT                   /db_xref="GeneID:6370759"
FT                   /locus_tag="CENSYa_0579"
FT   CDS_pept        515094..515630
FT                   /locus_tag="CENSYa_0579"
FT                   /gene_family="HOG000106742" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575773"
FT                   /db_xref="GeneID:6370759"
FT                   /translation="MRAKRSAAYHRKVSRTRRQRGYAWEDAIVKRFNGAEGWRAFRLGS
FT                   PSTGLPDVLAVGPAGLYAIEAKSGTATSLTVPADQIERCLSWTRAFGAYHDRRAVLAFK
FT                   FLSKKRTGTGTYESRRLREYFVVWDGSPVDCICTYDGETYARRDGERSRIRLARCSLPF
FT                   ATRTPDGPPVKGARG"
FT                   /protein_id="YP_875516.1"
FT   gene            515690..516448
FT                   /db_xref="GeneID:6370760"
FT                   /locus_tag="CENSYa_0580"
FT   CDS_pept        515690..516448
FT                   /locus_tag="CENSYa_0580"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575774"
FT                   /db_xref="GeneID:6370760"
FT                   /translation="MPDEEKSGKDRPEKPEIDSHLKEEKIDKSLDEVSNVIHDLLSEPD
FT                   HPDTDEQVERVLSGNTGAPPEPKPKGLSRLGGLFKRRRSDEGPPEPAEELPEPADVVPG
FT                   EDGSAGNLPEKVLKSILEPVDVYPKDGGKYAFDEFVDERILVSRDAFGKKEMKIKVLEV
FT                   SDEKAPTQWKLGDRVKIDKILITIKHLESQEIEEGEFDIKAIEEELIEKRHYTSTNRWV
FT                   PVDEIKNGYVSGARHTTLVSDAAALDYIAF"
FT                   /protein_id="YP_875517.1"
FT   gene            complement(516472..523653)
FT                   /db_xref="GeneID:6370761"
FT                   /locus_tag="CENSYa_0581"
FT   CDS_pept        complement(516472..523653)
FT                   /locus_tag="CENSYa_0581"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="WD-40 repeat protein; COG3391"
FT                   /db_xref="GI:118575775"
FT                   /db_xref="GeneID:6370761"
FT                   /translation="MIVGAYRPAWILVIVLAAAAIAGIAALAPDAYAHPPGSTEDPGEG
FT                   HRANNRDFHHIQPSYKFERVPQGGGTFGIPLYGFKPLLSDRGSRIEVYANGEELGLPVA
FT                   WGGHGVKIYKIHYEYTYSGGRLGADYLFSEFSQIPAGAFAYSEAIPNPLDFSSNFAAFS
FT                   CDDRTYSRSLVGAYDYSHLGVTNVVQQSFFPYSQKITYTDGTEECVLPGALDGDVGLLE
FT                   GVHLNSNYPPYRPTGNISSVEIVGMAPNSTIKMTQSFTCTSSSCLDPDHVDFGHALPTQ
FT                   TYWMQCDVEDETLDPRCTLNSTMTGDYIFELPGEHNREDILAAEGRSSRLSIPNNAVCG
FT                   DPSLFGTGNNPGPGQLYPDNCGYVLPSDIMRPEPAPYVVSAQLDGELGIFRIIFDRPIL
FT                   SVNSSSMRIVDPDGRGEITLSGNRTPGTPPEVVEIPLSSSDQTALGLFDGPSLYFSPQA
FT                   VTGEDGSFPTGHELPSPRYLRSYTTGVELIEDRAVAFSEDGLFMAIGGRRTNFVDWVHP
FT                   YVLSEGFDIGTAALAGNSLDVGSQAGVIHHISFSDSGLRLFVTGDEQPRVHSYDLTVPY
FT                   NIQTAGGYKRSDPLPGTGDVYGAAFSLNGRQMYVIRGDDTIYQMPLSEKFRPDTADVSD
FT                   SRSFDISVNVADGRGISITPDGNTMHISDRTGSLVHTYSLGTSGSILSATYMGAFSAAP
FT                   QSGEIHGLTFSSDGSFLFVAASDGIHQYELSRPHDTSAPEQDLSALSVRGGSPRGMFFA
FT                   PDGFSLYIANEVNGRVHWYTMSSGYDLSTAAFRSTLVTPWQTSPEGLYFPAGGTEMYTS
FT                   GSSPAAVHRVALPGAYDTSSAVLMGQFDVSERDIDPSGVALSDDGTRMLVAGGANNIVY
FT                   QYGLGTPYNVTGAAYEGGLELDMITPTDLAFSRQGDALYVSDDEGQVHHFALDAAYNVL
FT                   NATRVGSFFTGVESLEALSFSDDGRTLFGLDEGNRVMAYFEFGGYPVTSTNNITVLEEP
FT                   GIAEVDSTGIHAGDSPGVLEIGRSASFFLYPEDDPGGPVILDEYELEHVRKRNSASAPA
FT                   AADAASAELRSPPIALISAELGADGLLQVAFDRPLVAANASRMEINDGTTSLGAEDAEP
FT                   VDAEPHIVSFRFDPNATGALNQTSLELIFGAGAVEGPNGKIFPEQFVIPGPAYHDSMLT
FT                   LGDSIHPKGIAISPGGTTMIGAGFAVLDGAERGILFEYHLGEIFDVSGAGLAGGGIALV
FT                   DGGGPAGSAHIVAGAAESRPTDVRVVPGGMQAFVVGSTTDTVYEFSMAEPYNISTAAFS
FT                   SGSLDVSGEDAEPAGLAFSRDGRSMYVAGAAGGAIHQYTLGGPYNLTGASHSGSVQVDG
FT                   QAGVPRGVQFSADGARMFVVGDTNSVHVYSTDSFDATAAVYEGALDALWSPTIQGIDFS
FT                   IDGRHLYVAGEDAGSGRMGESAAHTGDAIHRFDLDAPYDVFPPVPTEITVADSTPTGVV
FT                   FSPDGLQMLVSGTGNNSVYGYTLQDPYVITGAEYNGTSLDTEQGAQGQGDPRGLAVSDD
FT                   GTSLFITGVDPPAVHTFSLQSPYDVEGATISASVLDDTQILAVGGSVPESIAFSADGTR
FT                   LFIVEESTDRVYQFILQEPYNVSAAASNGSYRLEEPSYTASSSLMPLRESLPTSVAFSN
FT                   DGTSMFISGDEHNIIYAHSLGTPFDVTTAEYTGGFAMAGSLLGLAFSDDGLNMFTVDGI
FT                   PDTISRYALASYPLKGAQGIEVSDEPGTRDSVVIAHDRKTGDSPAVNDGIWAVFMGEIT
FT                   AGDAPSIIDGGVRNATGITRENATGKSEPGVGDGAAADHIRVLKANDTLGITDDGVRGV
FT                   MGEITGVDAPSIIDGGVNNATGITRENATGKSEPGVVDGATAVPENTRMAESMPGVVDG
FT                   ARIIYMGVITADDTPSIADEGARNVMGKHERMGRSMPEVLDGARIIYMGDIMAADTPSI
FT                   ADEGARNVMGMHERMGRSMPGVLDGAKAELEDTANGKSTPEVDDGATITRMWEISAYDT
FT                   PGLMDAIRTGPVVLSVSAASTTESEGGTVSITVTFSEPVNVTGAPSLELETGASAVYVS
FT                   GSGSTEILFRYTVAAGHTSDDLAYTGTGALALNGGAIFAADNGAAADLTLPPPGSSLSL
FT                   SGSSDVRIIVPDVPRPAPAPLPRRGGGGGGGGGGGGGAIGSVTLGGSDVGYGVGFDFAA
FT                   GGESIQLDGTRIRAEPGSALTISPYRTPEGGLSIFDMEVILTGDGGSSTIAYNRIGSFL
FT                   DRTCPVGPEEAAWFYVCDAASIIAPDGAYYGTGAGTLESFTVQFEGEFSGMLSIMLRDN
FT                   QGIVMASHASDVYAVDLLPAAVPQEPAPAALVPEMDPEPVMDPEPEVESVIEPVIESVI
FT                   EPVAESVPEPVAESEPERAPESEPAADPAEEPGFFDSIIAFFQSLFE"
FT                   /protein_id="YP_875518.1"
FT   gene            complement(523798..533031)
FT                   /db_xref="GeneID:6370762"
FT                   /locus_tag="CENSYa_0582"
FT   CDS_pept        complement(523798..533031)
FT                   /locus_tag="CENSYa_0582"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="WD-40 repeat protein"
FT                   /db_xref="GI:118575776"
FT                   /db_xref="GeneID:6370762"
FT                   /translation="MLVDAGIPGKLNVRDSPTLDVGVMRTAMVDVKAGDKPGINSDASA
FT                   IPPTGESPVLLSADVDSTGLLRMVFDLPIDHSTINVSRIHVRDGNAAAGLTLLPGELSS
FT                   TGAGNTVSFSLNETRIGEALAQSGPRLHFDAGALNTTVRGVFPEPFVLPLPAQKGSLNV
FT                   AAQDRTPQGAAFSPDGMIMLMAGTSSDAIHQYDLPAAYDVEAAEYSGLSLATPGMEPVA
FT                   LVFADGGRLLIILDGAGFEARAYEMADPYNISTAAPSGDVLSTSGREVEPRGIAISPDG
FT                   LSVFVTGQGSNSVHQYSLGTAFDLSTGSYSGKSVSVAQQETNIQGVAFSARGDLMFIVG
FT                   TESDLLHRYELSGAFDLSGRTHTGSLYIAGTGGNAMDLALSSDGRLAFIPDSSSDSIHR
FT                   YELDGPYGIDGTPTGEYGLPDSAPTGVAFSADGTLMLISGNGGDAVYGFALDPPFDLSA
FT                   PRSSGSFSTAAEDTVPRDVDITADGGSVFVMGRQTDSVHRYDLASPFEITAPTHNGSFF
FT                   VGETETTPNGLAFTQDGDGLFIVGFAEDAVYEYNLEGPYDLNGSMPNSSLAGSFSLRDR
FT                   GENPTDVYFLPGGDVMLAASVGAASVLRYDLGAPYDIGTAEYAGSFSVKNEGTSPTGLA
FT                   YSADGLRLFVTDAVTDAIHWYELGTYPVRITRFSTSLDEPIISDNASAGIPPPPKPKLI
FT                   SVTAETGGTLRIVFDQPIDHSTVNASRIHARDGNSTAGLTLVQGELSDRGTGDTVSFSL
FT                   DKTRIGEIFNHSSPRLHFDAGALSSAYGDAFPQPFAMPLPAYRSSLDVVAQDDRIEGVA
FT                   ISPDGRRMIIAGTGSGAVHQYDLPRAYDVPAAVYTGISLDTATDPVDLVIADEGRLMIV
FT                   LGGTNGTAHAYRLAEPYDIVNATPTGEMLSVISEAAEPRGIAISPDGRRVFITGQDSDS
FT                   VHEYSLGIPFDLSTGAYSGASVNVSGQASNPHGVAFSADGTLMFITGPTSKSMHRYELD
FT                   GAFNITGHTYTGSFYLADNVGSPSGLAFSADGRFVYITDFVHDAVHEYELDGPYDIDGP
FT                   PVAVYGLTDGEPTGVALSADGTVMLVSGSERDSVYGFTLDPPFDLSAPESSGFFSVSAQ
FT                   DADPQDVDISADGGLVFVIGRDNDRVYRYDLASPFDITAPTPNGSFFVGENETFPTGLD
FT                   FTPDGEVLFIAGADKDTVYKYSLAGPYDLDGTVPADSLVGSFSVKEQDDNPVAVSFSPD
FT                   GRVMFAASETRDRVLRYELGSAHDLDSAEYTGSFNLRDQVAIPTGMAFSADGLRMFFTD
FT                   SDSDAVYSYQLGTYPVVLAREDFPPDAPRISDDASVTISFAPKPKLVSVTAHTGGILGI
FT                   VFDQPIDHSTIDASKIHARDGNGTAGVTLVQSDIVPGTGSTVSFNMSDNLGEILNYSSP
FT                   RLHFDAGALRSASGDAFPRQFELPLPAYRGGFGVAAQDDAIQGVAFSPDGRRMLIVGTG
FT                   SSAIHQYDLPEAYNAQAAEYSGTSLDTTIDPVDLALADGGRLLIILGGTADTAHAYRLA
FT                   EPYDIVNATPTGETVFVRDQAGAPRGIAISPDGMRLFVTGQINDSVHQYNMSTAFDIST
FT                   AVHSGISINVSAQENAPQGVAFSADGTVMLITGTNSKALHRYELDGAFDLAGSTYAGSH
FT                   YLGSYATSPTGLAFSADGRFAFIADSASDAIHEYELDGPYGVGGPPRAMYGLSDSEPTG
FT                   MAFSANGTIMLVSGNGGDRVYGFALDPPFDLSAPEPMESFGTAAREGAPRDVEFSADGS
FT                   SVFIIGRGSDSVLRYDLSPPFSLAAPTPGGSFFINDFEMASTDLAFTPDGEGLFIVGTG
FT                   NDTVYEYSLAGPYDLDSMPADSLVGSFSVKGQGDNPTGIYFSPDGHVMFAASDGKNTVL
FT                   RYVLGSPHDTSTAEYTGSFSVRDQGRSPTGLAFSADGLRMFFTDVGSPAVGGPSVHSYQ
FT                   MGTYPIDSSQAAAVRSFAVPAGDKPGATDGANSARIATITGADGPDAADGAVHVKKTAV
FT                   VVVDGPDVVDGLPPEGIDPIMEGDAPDIVDGLQLAKMSIIMEVDAPGIADGGVPKREGS
FT                   HAAIGNSTAVVVDEATVSRMGDITADDAPSVADGGVPKREGSHAAIGNSTVIVVDEATV
FT                   SRMGDITADDTPSVADGGVPKREGSHAAIGNSTVIVADGATTARMVDIMANDTLDVDDE
FT                   SVRNATGKHDAAGNSMPGVVDGAMTARMVDIMANDTLDVDDESVRNATGKHDAAGNSTP
FT                   GVLDGATTVRMGEITADDTPSVIDGGMRNVTGKHDATGKSAPVVVDSAATVFMGRITAD
FT                   DTPSVIDGGMRNVTGMHDATGKSAPIVADSARTVFMGGITGYDTPSVNDEIRSEIMGDA
FT                   TAYDGPSVGDGATTSRMGDIAEGDAPGIADGGLSAKMSNTRVGALDKPIVGDAAHTVPV
FT                   VRSVSAADAAEREGGMVAITVTFSEPVSVTGAPSLLLNVNASAGYVQGSGGTALIFNYT
FT                   VGAGHNAADLAYAGRDALVLNGGSISAGNGAAADLTLPQPGSPSSLSGSSDVTIDTMRP
FT                   SIERILVTGNNTLEATADEPLHEGTDGSGITLKINGSDAGGVSAELIAGNNLLVTTTDG
FT                   FLTAQSITVRFENVTDPAGNPLTAANYSLSLESRTLLDNQTITMTDDDNLLVMHGDMPP
FT                   EFSVIDETTEGIPAILHLGIAGDNRSAVLPSSVTVTSGEVTALLPADLDLSGLAERQIT
FT                   IEDPGRVPTGLDGTLQGNSIEVGQLDEDIELNEPVRISLPGRAGNDGYRINSDNITTEI
FT                   GARCSADSAAAAAAHAGSGACRVDAGPDLAIWTHALSAFGAYTHTPAEIPAPAPLPRRG
FT                   GGGGGGGGGSSGAIIGGGSLGFSVSFDIMADGENALRGVSTVSAAPGGTLAISPVLNPP
FT                   STLNVFDMEVSLHGADGDTTDVYYNRVGSFFGRQCDTDPVITDVLYTCDPQSAISGSGA
FT                   SVRTNGGFLEGMNIPLEGEFSGTMSIALRDSQGIVLANHDRDRYSIMAGAGPVPVAMVM
FT                   DPAPAPVEPEPAPEQVAPEPEPVVPEPAPEPVAPEPEMDPEPEREGEPEPAPEAPVDEP
FT                   GTDAAREQGFLDRIIEFFASLFG"
FT                   /protein_id="YP_875519.1"
FT   gene            complement(533070..536303)
FT                   /db_xref="GeneID:6370763"
FT                   /locus_tag="CENSYa_0583"
FT   CDS_pept        complement(533070..536303)
FT                   /locus_tag="CENSYa_0583"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="COG3391"
FT                   /db_xref="GI:118575777"
FT                   /db_xref="GeneID:6370763"
FT                   /translation="MIRAKRSAGILMLAVAVMAGAAALSGTVPFTQEAYAHPPGSTEDP
FT                   GEGHRSGTSDYHHTEIRYRFGPVPPGGGDFGPVFGYKALIGDSERRIEVYANGEELALP
FT                   VTWGGYGVEWYETEFRTTLVNGRTGSSYQRTEVSSIPAGAFAYSDAIGFHPVSFEPRLT
FT                   AFSCDDHTNTVSFRQDYIVRDQVNYMYHSFFPYSQKITYTDGTEECILPGALDGDEGQL
FT                   EGAFSAFNRYAPYVPKGEISSVETVRMSPDSVIEMTRTLECTSSSCRNPDHVDFGHALP
FT                   PQTFWQWCDVEDETLRPRCMANSTLTGDYVFELPGQHDREDVLAAEGVSPDLQIPNNAV
FT                   CTDPSEFGAVNRPGPGEFYPDNCGYVLPEDVIRPDPTPYVVSVQLDEGLGTLRVVFDRP
FT                   ILSVDGSGMRIADAGGSGEIAPSGNRISGTPPEVVELPVNASSIGAAASFADPRLYFEP
FT                   SAVTSEVGAFPAGHELPSPRYLRTYSTGTELNRDRAVAFSSDGSSMVIGGLWRTFQGWI
FT                   YPYVMTEKFDVSTAERSGKFLDVDDRVGLSIHHISFSDDGLFMFVTGNKSPKVFPYELT
FT                   TPYTINSVRGRTPSPNIPGEGQLYGIAFSLDGRQMYTIGNSDTVQQFPLSEKFTVSTAD
FT                   VSSPVSFDVSAVEDDARGVAVSPDGKTMYVSGGGDVHAYTLVEKNDVSSARYETSFSIS
FT                   PQTESVFGIKFSPDGRFLFAVSFEGVHQYELSRPHDISGPVQDLAALEADGDSPSGMFI
FT                   APGGTDLYLTDDARGRLRWYDISSEYDLSTATLRRTQITTWQDSPQGVYFPAGRAEMYT
FT                   VGSSPPFVHRLTLPGEYDTSSITEHSMLNVSLRDINPVGVALSGDGKKMLVAGGASGTV
FT                   FQYGLVPAYNLNGAVYNRALDLGGPTPTDLAFSRQGDALYVSDDEGQVHHYALKPAYNI
FT                   VNAKRVGSFLMGTESLHGLSFSDDGRMLFGLDGDAGTVAQFNFGGYPARRTAAVGASDG
FT                   PGLAETGDRDLNKFLPREAGDRLAFSDFALRDGESRAVIRDEPGVAMRADVLHNRMTDA
FT                   LDGAITSDAASAVRGKLVLDAPGVGEIPT"
FT                   /protein_id="YP_875520.1"
FT   gene            536523..536852
FT                   /db_xref="GeneID:6370764"
FT                   /locus_tag="CENSYa_0584"
FT   CDS_pept        536523..536852
FT                   /locus_tag="CENSYa_0584"
FT                   /gene_family="HOG000106753" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575778"
FT                   /db_xref="GeneID:6370764"
FT                   /translation="MITKEITINGTDFRLTLTDQVISQVNNLKSLYATAYEDPESFEQV
FT                   SSEISSAIKEISTAVEPAVSDGDLDGLIQEVIRVVDSRAAEMEQELSNHAAESARKSKR
FT                   SRRRS"
FT                   /protein_id="YP_875521.1"
FT   gene            536902..537030
FT                   /db_xref="GeneID:6370765"
FT                   /locus_tag="CENSYa_0585"
FT   CDS_pept        536902..537030
FT                   /locus_tag="CENSYa_0585"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575779"
FT                   /db_xref="GeneID:6370765"
FT                   /translation="MPSCECGICGHFSEEECIKRECRCCMNFHIRSGSVIRGGARA"
FT                   /protein_id="YP_875522.1"
FT   gene            complement(537033..537323)
FT                   /db_xref="GeneID:6370766"
FT                   /locus_tag="CENSYa_0586"
FT   CDS_pept        complement(537033..537323)
FT                   /locus_tag="CENSYa_0586"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575780"
FT                   /db_xref="GeneID:6370766"
FT                   /translation="MSGISPDYCSSCKHTVWPPSGRCPRCLGRTVRGILPDTGRIVGFS
FT                   GDKSGRYCLVDMDGVRLVASYSGKSPADGQKVRLLRAWTEGGRSRFEVGPS"
FT                   /protein_id="YP_875523.1"
FT   gene            complement(537320..538423)
FT                   /db_xref="GeneID:6370767"
FT                   /locus_tag="CENSYa_0587"
FT   CDS_pept        complement(537320..538423)
FT                   /locus_tag="CENSYa_0587"
FT                   /gene_family="HOG000221739" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="3-ketoacyl-CoA thiolase/acetyl-CoA
FT                   acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="COG0183"
FT                   /db_xref="GI:118575781"
FT                   /db_xref="GeneID:6370767"
FT                   /translation="MRPVFAVGTGGTKFGLQDVPVEESLLEASAELFLGTDIQRESVDA
FT                   VIASTNDNSKYLGAILAEKCGITPRIAHTVESLCSSGTSAIVSGVSYIASGMAEVVLVA
FT                   GAEKSKSPGGILEWDQSRGGYPEPVFWASLFAGAYKREHGASAEDLAAVAAKNHRNAAS
FT                   NPRACSAMDITIQDVLESRSITDDLKLYECSRECSGGAAILLASKDAARGQEAPVRISG
FT                   IGQRTVSASLSGAGPLVHMESTAMAAADALAASNRSAKEIDVMELHDAFGICEPMALEG
FT                   IGIAGKGRGAAFCSKLYETGDNFVNPRGGLIGAGHPLGATGIAQANEIVMQLQGAAKGR
FT                   QVEGAAAGLVHNMSAAATSSTVLVMEA"
FT                   /transl_table="11"
FT                   /protein_id="YP_875524.1"
FT   gene            complement(538420..539382)
FT                   /db_xref="GeneID:6370768"
FT                   /locus_tag="CENSYa_0588"
FT   CDS_pept        complement(538420..539382)
FT                   /locus_tag="CENSYa_0588"
FT                   /gene_family="HOG000106764" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="flavin-dependent oxidoreductase"
FT                   /transl_table="11"
FT                   /note="COG2141"
FT                   /db_xref="GI:118575782"
FT                   /db_xref="GeneID:6370768"
FT                   /translation="MRVSYSLGSLLSIGEVLGCSKILDSARPDTVWIPETWGMENFAML
FT                   SAVSQVVGCKVGSSITNIYSRSPALAAMGAVTVDALSGGRMVMGLGAGSPPIVGGLHGM
FT                   SFERPVERMREYVEVVRLASSGNRIDYSGEFFKLKGFTLIVKPVREQIPVYMAAVNRRM
FT                   LELAWEIADGALLFLRPLGELRGTIKRMQSRRKIDAACQVITAVSHDSEAAAARARTTV
FT                   AFYVSVGSIYREFLAASGFDAEVGNIYGEYKKSGIEAAAGQVTPRMVSELAVCGTPDEC
FT                   RKGIERFAAAGIDLPIIQLNPVGDALESCRLIASAMEGA"
FT                   /protein_id="YP_875525.1"
FT   gene            complement(539411..540283)
FT                   /db_xref="GeneID:6370769"
FT                   /locus_tag="CENSYa_0589"
FT   CDS_pept        complement(539411..540283)
FT                   /locus_tag="CENSYa_0589"
FT                   /gene_family="HOG000106775" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575783"
FT                   /db_xref="GeneID:6370769"
FT                   /translation="MASKDVVAGLGEIGLPIQKVLSRGRTVLGYDADPARSEGKRLKAH
FT                   KDDRTGFLHVCIPFTVNFEDDVISLAEMFRPEAVAVHSTISPYTTERLQKGLGVPVIYS
FT                   ATRGVHRRMAGDLKRYTKFYAVYPWAPRAAWAGRAFASLMRASGVKTKKMSTPLVLELA
FT                   KIVVDTSYYGWLISYAQISNAIAAEHGINYDEMWSFSDEIHKALGNRPKMYPGVIGGHC
FT                   VIPNLELVQNESLDMIRSLNDAYSSRPPGRRRPAGGSARRKPAGGTPRRACTRGSPRRI
FT                   PRTRRRQNS"
FT                   /protein_id="YP_875526.1"
FT   gene            complement(540324..541418)
FT                   /db_xref="GeneID:6370770"
FT                   /locus_tag="CENSYa_0590"
FT   CDS_pept        complement(540324..541418)
FT                   /locus_tag="CENSYa_0590"
FT                   /gene_family="HOG000106786" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="COG0166"
FT                   /db_xref="GI:118575784"
FT                   /db_xref="GeneID:6370770"
FT                   /translation="MLQRLDILYLKQGGPYTVNRYIFKENQPECLNHSCWLDKGDPGGM
FT                   HRTYDRWPEIAEESYSEEYGQAESGGVSDVVFAGMGGSGAIGDVLYSMLSKTGIHVSVV
FT                   KGYVLPRTAGPGTLVVSTSISGNTRETLTVIEAAREAGCQTACFCSGGEMLEYCTRHKM
FT                   PHWVVPMHHSPRTSFPSFLYAMLSVLGGVIPVDEKDVRDSISDMRELRSRISPEREDNP
FT                   ALELARWIKGMPVIYYPWGLQAAAVRFKNSLQENAKCHVIAEDVIEACHNGIVSWEGGG
FT                   NAQPILIEGADDYYKTKERWAILRGFFESRGIGYREVRSVKGGVLSKIINLVYLLDYAS
FT                   IYLAVLRGVEPSPVPAIDYIKRHL"
FT                   /transl_table="11"
FT                   /protein_id="YP_875527.1"
FT   gene            541417..542457
FT                   /db_xref="GeneID:6370771"
FT                   /locus_tag="CENSYa_0591"
FT   CDS_pept        541417..542457
FT                   /locus_tag="CENSYa_0591"
FT                   /gene_family="HOG000224730" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="translation initiation factor 2B subunit, eIF-2B
FT                   alpha/beta/delta family"
FT                   /transl_table="11"
FT                   /note="COG0182"
FT                   /db_xref="GI:118575785"
FT                   /db_xref="GeneID:6370771"
FT                   /translation="MDIPQDLKTVEWRDGRVVMIDQTRLPGELVFVEYETYGQVADAIR
FT                   NLVIRGAPAIGVAGAFGLALAASRSTAGTVDSLMADLCTARDELLGTRPTAVNLKWGLE
FT                   RALAAAEKCTDADSMRRAVVDESLAMAEEDVKTNKEMGKNGSGLIGDGETVMTHCNAGA
FT                   LATVSYGTALGVIRATREAGKNIRVIATETRPVQQGSRLTAFELMHDGIDVRLIPDTAV
FT                   GYSMAQGLVDKVVVGADRILGTGHVYNKIGTYQVAAMAARHGIPFYVAAPLSTFDLDSG
FT                   PEDVVIEQRKAAEVTGIGDSMTAPDGVGVINPAFDVTPPELISGIITEKGVAAPPFKES
FT                   IRALFG"
FT                   /protein_id="YP_875528.1"
FT   gene            542525..543196
FT                   /db_xref="GeneID:6370772"
FT                   /locus_tag="CENSYa_0592"
FT   CDS_pept        542525..543196
FT                   /locus_tag="CENSYa_0592"
FT                   /gene_family="HOG000105992" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575786"
FT                   /db_xref="GeneID:6370772"
FT                   /translation="MLTRRYGIALTGFAAVFALLAITPASASFLPASQADTPVLFGMAE
FT                   LVHKNVDGEVLSSHTVHNQLVDYGESILIKGTFGVDSVGTTSNFERSMVLCVTDALTGA
FT                   DISDTTIAGDLTPTTAVDDGDQSCIDATVLLNSEPGSAVLNTEPGLAVLNATFDGDDVV
FT                   DDAVITAIAVCNTLNEDFNDRDDCQASGGLFSAVGVVNTTIGADDTLDITYTFDIRSPI
FT                   N"
FT                   /protein_id="YP_875529.1"
FT   gene            543293..543952
FT                   /db_xref="GeneID:6370773"
FT                   /locus_tag="CENSYa_0593"
FT   CDS_pept        543293..543952
FT                   /locus_tag="CENSYa_0593"
FT                   /gene_family="HOG000105992" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575787"
FT                   /db_xref="GeneID:6370773"
FT                   /translation="MRGKSMVKPTVGIALTGFAAVFALLALTPASASFFPADQADSPVL
FT                   FGMAELVHKNVDGEVLSSQTVHNQLLDSGESILIRGAFGPTNLDESDQPAAICIGDAEA
FT                   TDVTEDAVAADFVPALAFADSGESTCILTNNVDSTDTTTDTSQAVLRANFTDANIAAGE
FT                   TITSLVICTNSLDNSNDNCSTLGEAFAVVIVPQPTLVNADDMVEVTYTFDLTSTNT"
FT                   /protein_id="YP_875530.1"
FT   gene            complement(544021..544236)
FT                   /db_xref="GeneID:6370774"
FT                   /locus_tag="CENSYa_0594"
FT   CDS_pept        complement(544021..544236)
FT                   /locus_tag="CENSYa_0594"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575788"
FT                   /db_xref="GeneID:6370774"
FT                   /translation="MPGPRASASRSKKTTSRPRPLHAPAPGILCARGALAGYPSCTRLL
FT                   TLFEPCTRNLTGPPGGTGPGVCHTWY"
FT                   /protein_id="YP_875531.1"
FT   gene            544554..545204
FT                   /db_xref="GeneID:6370775"
FT                   /locus_tag="CENSYa_0595"
FT   CDS_pept        544554..545204
FT                   /locus_tag="CENSYa_0595"
FT                   /gene_family="HOG000018858" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="transcriptional activator, adenine-specific DNA
FT                   methyltransferase"
FT                   /transl_table="11"
FT                   /note="COG4725"
FT                   /db_xref="GI:118575789"
FT                   /db_xref="GeneID:6370775"
FT                   /translation="MSRQSSYSVYSKDVRNRTKQNKIPQEILYQKLPNRKFDIIYADPP
FT                   WDYNGKLQYDKTDLYVSTSSFKYPTMKTKKMMEIPIKKIASSNSLLFLWATSPHLEQAI
FT                   QLGKAWGFEYRTVAFVWDKMNHNPGKYTLSNCELCLLFKHGKIPTPRGARNVRQLITIP
FT                   RTEHSRKPVQAMQGIERMFPFQKKIELFAREKYRGWSAWGLDLVLKNKIKNLI"
FT                   /protein_id="YP_875532.1"
FT   gene            complement(545196..545744)
FT                   /db_xref="GeneID:6370776"
FT                   /locus_tag="CENSYa_0596"
FT   CDS_pept        complement(545196..545744)
FT                   /locus_tag="CENSYa_0596"
FT                   /gene_family="HOG000106797" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="MunI restriction endonuclease"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575790"
FT                   /db_xref="GeneID:6370776"
FT                   /translation="MGKKELRDRDVWQKKSGLMGKKAEDEFEAVFLAEFTGTEYVIRKE
FT                   PKELKDIYSKNPKHGVSIDYAITNKKTKKTLYVEIKSQEGYVPGETLPKDGRGNAHERS
FT                   CKFFTPGLLKVMCKLSNLPVGTLPFWIVYQGRITRDAKRTREITYWFDEYGAHFFLWKS
FT                   SSSTPLINHFKKNLRHILD"
FT                   /protein_id="YP_875533.1"
FT   gene            545878..546261
FT                   /db_xref="GeneID:6370777"
FT                   /locus_tag="CENSYa_0597"
FT   CDS_pept        545878..546261
FT                   /locus_tag="CENSYa_0597"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575791"
FT                   /db_xref="GeneID:6370777"
FT                   /translation="MNPNSYFSLRKTRPAREFYPSHFLLHPRLDSCLCGSPEVGCVSSL
FT                   CFHRKSAPKKCSKAGLLTRDVLPNLTLLGQAISRTAQISQILTPTEASAWRLYKIGAMY
FT                   TSIHSCVKVSLVFVPCSIHVPAD"
FT                   /protein_id="YP_875534.1"
FT   gene            546285..546935
FT                   /db_xref="GeneID:6370778"
FT                   /locus_tag="CENSYa_0598"
FT   CDS_pept        546285..546935
FT                   /locus_tag="CENSYa_0598"
FT                   /gene_family="HOG000196501" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="uracil-DNA glycosylase"
FT                   /EC_number="2.7.7.7"
FT                   /note="COG1573"
FT                   /db_xref="GI:118575792"
FT                   /db_xref="GeneID:6370778"
FT                   /translation="MSPALDTFCVTCPQLNRARPVCTFIGARIIHRMVDGPLGGIAARV
FT                   SVCTRCGLCEGRTNAVPGTGPASARAILVGEAPGREEDLQGKPFVGGAGRVLDKELERA
FT                   GIPRSTVYITNVVKCRPPKNRVPSDEERDACIEYLKEEISVINPRIVCILGATALRSLL
FT                   GLGGITGIRGTIINQDNTDYLVSLHPAATMYRRDLLPAFRRDMKKLAGMILST"
FT                   /transl_table="11"
FT                   /protein_id="YP_875535.1"
FT   gene            546932..547480
FT                   /db_xref="GeneID:6370779"
FT                   /locus_tag="CENSYa_0599"
FT   CDS_pept        546932..547480
FT                   /locus_tag="CENSYa_0599"
FT                   /gene_family="HOG000224224" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="3-methyladenine DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="COG2094"
FT                   /db_xref="GI:118575793"
FT                   /db_xref="GeneID:6370779"
FT                   /translation="MTPLDRAFYSREPAAVARGLLGKRLARKIDGITMSGVIIETEAYG
FT                   SSDDPASHAHRGMTGRNRAMFGEVGRAYVYFTYGMHYCMNVVARRGRSDAGAVLIRAIR
FT                   PELGAAQMSKNRNGRAAISDGPAKLTQAMRISAEQYGEDLTRRGALYIAEGPRIRSITA
FT                   SPRVGIRRGTDLLWNFKVK"
FT                   /transl_table="11"
FT                   /protein_id="YP_875536.1"
FT   gene            complement(547482..548114)
FT                   /db_xref="GeneID:6370780"
FT                   /locus_tag="CENSYa_0600"
FT   CDS_pept        complement(547482..548114)
FT                   /locus_tag="CENSYa_0600"
FT                   /gene_family="HOG000106808" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="uncharacterized membrane-associated protein"
FT                   /transl_table="11"
FT                   /note="COG0586"
FT                   /db_xref="GI:118575794"
FT                   /db_xref="GeneID:6370780"
FT                   /translation="MDVIDLFPFGAEIGYLGLAVVSFLGSLVPFLPVPSFLLLVTMAVG
FT                   DTFNLHILVLLSAACATGAKQIIFYASYGGRKMMSEEARRRMRPFERLVKRYGAAAVFV
FT                   AAATPMPDDLVYVPLGLARYNPRRFFIATFTGKIVLHYIIVLISHYLGASILEAYFANN
FT                   TDPTPVYIGVAVFAAALTVIVVLMLRLDWGKILGKRLPWTLEDDESK"
FT                   /protein_id="YP_875537.1"
FT   gene            548192..548584
FT                   /db_xref="GeneID:6370781"
FT                   /locus_tag="CENSYa_0601"
FT   CDS_pept        548192..548584
FT                   /locus_tag="CENSYa_0601"
FT                   /gene_family="HOG000106821" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575795"
FT                   /db_xref="GeneID:6370781"
FT                   /translation="MVRQISLRKKEYSEIAGEIAGISPYIRFVAVVGGRGDLLYHHRRR
FT                   GLRPMLDSKDTHYQFSHIAIKTGLEAAFDRALGPLEFVWEERKKVQILSFAIKKTRVWV
FT                   SVDKKVVRSEMLRIIDSCLPVVRRYS"
FT                   /protein_id="YP_875538.1"
FT   gene            complement(548575..549555)
FT                   /db_xref="GeneID:6370782"
FT                   /locus_tag="CENSYa_0602"
FT   CDS_pept        complement(548575..549555)
FT                   /locus_tag="CENSYa_0602"
FT                   /codon_start="1"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, ATPase component"
FT                   /transl_table="11"
FT                   /note="COG0444"
FT                   /db_xref="GI:118575796"
FT                   /db_xref="GeneID:6370782"
FT                   /translation="MPRLRKTKIPQEYSPPMAFLDVEGLSVSYGTRAGRVHALDDVGFS
FT                   LKEGESLGIAGESACGKSTLGLAIMRMLQGGRIDSGAISMRGESLLDMAERRFSAEYRW
FT                   KRISMIFQGAMSSLDPVYTIRSQFSEVLRQHGFEGDREGRMEEAATSVGLEPGVLGRYP
FT                   HELSGGMKQRAVTAMALLLKPDLVIADEPTTALDVLVQAQIINLLKRLKKEGTSFIIIT
FT                   HDLSILSEIADKVGIMYGGQIAELGSSEDVYGSPRHPYTQGLLASIPKLRGEKPGYIRG
FT                   SPPGLISPGSGCRFADRCPDVMEKCSTDPPKAGTKSGYAKCWLYE"
FT                   /protein_id="YP_875539.1"
FT   gene            549997..550815
FT                   /db_xref="GeneID:6370783"
FT                   /locus_tag="CENSYa_0603"
FT   CDS_pept        549997..550815
FT                   /locus_tag="CENSYa_0603"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575797"
FT                   /db_xref="GeneID:6370783"
FT                   /translation="MGDSGLTGKRRGMVRFFKDKKTRLLYLALPTFGLSLQIAPYPPEV
FT                   TSLPLALPFGYIPLNPVAFTAILGFAAAPLIGHGAAMFVLLAFIGAATWLGVAHGMVLL
FT                   AGLLPRAVRGTAGLLRGEVPELHMTRRTAAALIVIALIILSPVMVWGVLMYDFHMRSLW
FT                   PFQNGTRHGSIEDNMGEIRGLPEVEAFHEVYAGRNITFSDQSMSSVRFDYTVRDDGRSA
FT                   SLVIGYYDREPSRFYHSCYNTDLRYELFREDGVQTDCFSFVDEHGPPETD"
FT                   /protein_id="YP_875540.1"
FT   gene            complement(550812..552569)
FT                   /db_xref="GeneID:6370784"
FT                   /locus_tag="CENSYa_0604"
FT   CDS_pept        complement(550812..552569)
FT                   /locus_tag="CENSYa_0604"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="adenine specific DNA methylase"
FT                   /transl_table="11"
FT                   /note="COG1743"
FT                   /db_xref="GI:118575798"
FT                   /db_xref="GeneID:6370784"
FT                   /translation="MHPRQPLHSPDAAARTRPLSKLRRQSAPRVEGPQIKRHKFPRGKT
FT                   AIMQRVQKARPDPEPYTGIYAMHKYWSKKPFNVVRSYIKEYSRPGEIVLDPFCGSGISN
FT                   TESLVLGRRTIGIDINPMAVFITGQMIYGLDTKKARAEFARLQDRCMNRVHSLYPVYRN
FT                   GAQHTGSHYIYKDGKMAEIWCKHGGKKLVFRPLKRDVEHAGSFAYDSIDLPHPRGRMPE
FT                   NSRINVRRGMRVYELFTPRNLLALSMLMEGIRAVREKRMCDFFRFCFTASVGQASRMVF
FT                   VVRRRGRLSGARTQGRKEVGSWVIGYWVPRNNFEINVWNCFEHRYSRIIRAKEGQHSAV
FT                   PQARCSMGGMLGGSGNALLLNADCYRTLSSMPGGSVDYIITDPPHGDRLPYMELSAMWN
FT                   GWMGSSADAEEELVISDSPERDKTPAAYNAQMARILSEAERVLRPGRHLTIMFNNMDAG
FT                   TWEGLQRVLFGLRLELAGVDVLGYSAASVVQDSRKGGLKTDFVFTFKKTGRRGRSPREV
FT                   PGMADSAIRDYVRENPGCKRYEALNHAVKQMMKKRALFDIAKMARLAASLEVIPGGGRE
FT                   DPDSARPPG"
FT                   /protein_id="YP_875541.1"
FT   gene            complement(552689..552883)
FT                   /db_xref="GeneID:6370785"
FT                   /locus_tag="CENSYa_0605"
FT   CDS_pept        complement(552689..552883)
FT                   /locus_tag="CENSYa_0605"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575799"
FT                   /db_xref="GeneID:6370785"
FT                   /translation="MRYAFEKGGCLKFYSRAEDPAIVRDGDVFVYAGGVSKRIGEALRD
FT                   MSEIHTYSGIELRRMMEKE"
FT                   /protein_id="YP_875542.1"
FT   gene            complement(552922..553812)
FT                   /db_xref="GeneID:6370786"
FT                   /locus_tag="CENSYa_0606"
FT   CDS_pept        complement(552922..553812)
FT                   /locus_tag="CENSYa_0606"
FT                   /gene_family="HOG000106832" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575800"
FT                   /db_xref="GeneID:6370786"
FT                   /translation="MTIVGFDSKQFTRGKTQYASAMGKDYRYHGFNTQLGVGVSTEQPE
FT                   RFVEEYVSLNEKLKEGFGISRNALFFSSRHLENSLGVSKAASFADQLIAGMQEHIKSVH
FT                   FSYVILSRSSLPRIMVGGLQHYKKIMPTDAFIDNLGPMFSYLTAHSFLWMRGYKNAEKV
FT                   ELHINSFRSKFTPAWNQIIDNTEPKIFIKGNECNPYISCASIIAFLTDVKLRRQMLDLN
FT                   VENLGKIWAGHSFDTSTQFFDKKNIPYYSWKDNSNINITGYLARPVIFLSVDKMELENG
FT                   ILKRQRGRILKSQES"
FT                   /protein_id="YP_875543.1"
FT   gene            553931..554269
FT                   /db_xref="GeneID:6370787"
FT                   /locus_tag="CENSYa_0607"
FT   CDS_pept        553931..554269
FT                   /locus_tag="CENSYa_0607"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575801"
FT                   /db_xref="GeneID:6370787"
FT                   /translation="MSLGCVAQCASFGWKYPVSRRCIRGAAGFELLPERRLMAGWRPIW
FT                   SISARNSSVMRMFSLRSSVLSESMRIPRSHNQQIFRFGGDYSVPGLNTHLFYFFKYFRI
FT                   TCRRHKNP"
FT                   /protein_id="YP_875544.1"
FT   gene            complement(554585..555085)
FT                   /db_xref="GeneID:6370788"
FT                   /locus_tag="CENSYa_0608"
FT   CDS_pept        complement(554585..555085)
FT                   /locus_tag="CENSYa_0608"
FT                   /gene_family="HOG000106843" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="flavin-nucleotide-binding protein"
FT                   /transl_table="11"
FT                   /note="COG3467"
FT                   /db_xref="GI:118575802"
FT                   /db_xref="GeneID:6370788"
FT                   /translation="MAGIAAGTISPSKRDAFLQSQKLLRLATVGSDGTPHVVPVWYVYK
FT                   NGKIYIGTNTQTQKAHNLEGRPRAGFSVDEGSGMYNVTAVTGSGSVTFIMDKMEVERIE
FT                   RLIMDKYHLSGDDADKVLTITDCIIVITPDRFSAWHVPDPLAGQSHPKGIMSKKEAAKL
FT                   IYG"
FT                   /protein_id="YP_875545.1"
FT   gene            complement(555350..555580)
FT                   /db_xref="GeneID:6370789"
FT                   /locus_tag="CENSYa_0609"
FT   CDS_pept        complement(555350..555580)
FT                   /locus_tag="CENSYa_0609"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575803"
FT                   /db_xref="GeneID:6370789"
FT                   /translation="MFNSVYPSGYRICLTIRNGRPAPAGNPRGSPSGTSLIKAAGSDNK
FT                   RHGNVLAPMTRIRGAETSIQVLQSCTVHDSF"
FT                   /protein_id="YP_875546.1"
FT   gene            555625..556125
FT                   /db_xref="GeneID:6370790"
FT                   /locus_tag="CENSYa_0610"
FT   CDS_pept        555625..556125
FT                   /locus_tag="CENSYa_0610"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575804"
FT                   /db_xref="GeneID:6370790"
FT                   /translation="MIGNRGKDKEYEKIRSRLRDGEEILLTVTQSKAILPATYFVTNER
FT                   IITRDPSITGEGITSIQWVDVGDFSLKKRLFRAYIEFVIRSGSTVTLDNISRGDAEEMY
FT                   RLIEKYVKRLREAANEQHAKEQAHTGQGEDKSASDPLAVLKMKLVNDEITEEEFEKKKK
FT                   LLE"
FT                   /protein_id="YP_875547.1"
FT   gene            556181..557458
FT                   /db_xref="GeneID:6370791"
FT                   /locus_tag="CENSYa_0611"
FT   CDS_pept        556181..557458
FT                   /locus_tag="CENSYa_0611"
FT                   /gene_family="HOG000226032" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="aspartyl/asparaginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.12"
FT                   /note="COG0017"
FT                   /db_xref="GI:118575805"
FT                   /db_xref="GeneID:6370791"
FT                   /translation="MGAGGRIHIADMAKPMAGQKVLLAGWVEDLRELGKVSFVTLRDAT
FT                   GLAQIVVKGGLQASMDGLTRQSVVAVSGTVAETRARDFEVEVSAEQIDVLSRAIHPLPI
FT                   DPLGRLESGMDNRLNARALDMRNQKTASIFRLRHRVLESLRQGLSKRRFTEITTPKIIG
FT                   SASEGGANLFSLEYFGKTAYLAQSPQLYKEQMTMGLERVYEISGFYRAENSHTGRHLSE
FT                   FTSVDIEAAFMDYTDVMDVLEQLVREACVAASECTIEQEATGHKAEVPSDIPRITYSQA
FT                   VDELGSDCGVSFGDDLLDSHLRLLGEKHPGYYFLTDWPTKLKPFYIRPKDDDAEVSRSF
FT                   DLQHGYLELSSGGSRLHDPSILRSRLEQQGLDPALFADHLRAFDWGMPPHSGWGMGLDR
FT                   FMAVLVGVDNVREAVLYPRDPDRLSP"
FT                   /transl_table="11"
FT                   /protein_id="YP_875548.1"
FT   gene            complement(557455..558453)
FT                   /db_xref="GeneID:6370792"
FT                   /locus_tag="CENSYa_0612"
FT   CDS_pept        complement(557455..558453)
FT                   /locus_tag="CENSYa_0612"
FT                   /gene_family="HOG000021111" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="isocitrate/isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="COG0473"
FT                   /db_xref="GI:118575806"
FT                   /db_xref="GeneID:6370792"
FT                   /translation="MYRIALIEGDGIGPEISRSVTDVLGALKEPKLSIERFDAGDRALK
FT                   EHGTALPPETIRGVEESDACLKAPVGESAADVIVALRRRLDLYANVRPAKSHPGMPAIR
FT                   DDIDLLIARENTEDLYTGNEFFIDGAAVALRTITERASERIARYALKAAMTRRRKVTCV
FT                   HKANVMRVTDGLFASTCRRVAAEYPDVEFGEMYVDACAMNLIRRPEWFDVIVTTNLFGD
FT                   ILSDESSQAAGGLGMAPAGNIGDKFAIFEPVHGAAFDIAGKNEANPSSFLLSAAMMLGW
FT                   LGGRNDDATCLVAATRLNAAVYGAVKEGIKTKDMGGSAGTDKFTAEIISRL"
FT                   /transl_table="11"
FT                   /protein_id="YP_875549.1"
FT   gene            complement(558460..559977)
FT                   /db_xref="GeneID:6370793"
FT                   /locus_tag="CENSYa_0613"
FT   CDS_pept        complement(558460..559977)
FT                   /locus_tag="CENSYa_0613"
FT                   /gene_family="HOG000046859" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="isopropylmalate/homocitrate/citramalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="COG0119"
FT                   /db_xref="GI:118575807"
FT                   /db_xref="GeneID:6370793"
FT                   /translation="MRIRIFDTTLRDGEQTPGVSLSPEQKLQIARMLDELGVDAIEAGF
FT                   PVISEGESKAVKMIATAGLSADICGLARADKRDIDAAADAGLDYVHLFIATSDIHLKHK
FT                   LMMDREEAVRRAISSIEYAKSRGMKVEFSAEDATRTERGFLRDFFKQVAEAGADRADIP
FT                   DTVGYSTPAYMAEITRDAVEATGLPVSVHCHNDFGLAVANTISGLQAGATCAHVTINGI
FT                   GERAGNASLEELVMALQCLQFDEARSTGIHTEKLYGTSRAVSGLVGIQVQPNKAIVGEN
FT                   AFGHESGIHTHGVLSNPLTYEPISPELVGHTRRLEVGKHAGLHGMNAMLGEYGVKPTAE
FT                   QSKVILSRVKALGDQGKKVTDVELLSIAGEVIGEPGLRRMVQLSGFSVSTGIGTMPYAF
FT                   VKLNVDGKEFSATDYGVGPVDASLSAMQKITGEIAEVRIREYGLASISGGSNALCEVTI
FT                   GVEDAKGNKASARSVGEDIVTTSVQAVIDGMNRIMLKKMLGGKKTRG"
FT                   /transl_table="11"
FT                   /protein_id="YP_875550.1"
FT   gene            complement(559974..560462)
FT                   /db_xref="GeneID:6370794"
FT                   /locus_tag="CENSYa_0614"
FT   CDS_pept        complement(559974..560462)
FT                   /locus_tag="CENSYa_0614"
FT                   /gene_family="HOG000046747" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="acetolactate synthase, small (regulatory)
FT                   subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="COG0440"
FT                   /db_xref="GI:118575808"
FT                   /db_xref="GeneID:6370794"
FT                   /translation="MNMWAILSILVENKPGILFQVTHLFRSRNFNIDSISVGVTEDPEF
FT                   SRMTITTYGDEKRIRQIVKQLDKMIDTVEVRQIDEHHAVFRELILFKIKVGSADDSMKI
FT                   NSLANTYGGKVHDAKKDSIMVELTATPDQIRAFEELARPFGIIETARTGIAALQRSRS"
FT                   /transl_table="11"
FT                   /protein_id="YP_875551.1"
FT   gene            complement(560465..562120)
FT                   /db_xref="GeneID:6370795"
FT                   /locus_tag="CENSYa_0615"
FT   CDS_pept        complement(560465..562120)
FT                   /locus_tag="CENSYa_0615"
FT                   /gene_family="HOG000258448" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thiamine pyrophosphate-requiring enzyme"
FT                   /EC_number="2.2.1.6"
FT                   /note="COG0028"
FT                   /db_xref="GI:118575809"
FT                   /db_xref="GeneID:6370795"
FT                   /translation="MKSLQKEGVKQVFGLPGGANLPIYDELFKSDIRHILVRHEQSAAH
FT                   MADGFGRVSRKPGVCFATSGPGATNILTGIATAQADSAPMVAVTGQVPVHMIGKDAFQE
FT                   SDIIGMANPVVKYAFQPREASEVPLAVKKGFYIAETGRPGPVLIDMPKDVQQNEAEMTF
FT                   PDEFKIRGYHPWTDPDIPSIEKAIDMLLHSERPIILAGGGTIISSAFAELQAVAELMMI
FT                   PVVTTFKGKGAFPENHPLSLGPIGMHGHAEANKLMTEADCVLAIGTRFSDRSVGTFEEF
FT                   EKKLSIIHMDVDPAEIGKNQTAQVAVVGDVRASLKIMVKMLAGRALKKDQDGWFAHVKK
FT                   VKEYWRENLKIHPGEMGAAKILRKLREMLPHESIVTTEVGQHQMWASLFYDVIHPGTFF
FT                   SSTGLGTMGWGFPAAIGAKVARPDVPVVDIAGDGSFNMTENSLATSVLEGIPVIVFLIN
FT                   NFTLGMVAQWQRTFYDRRMIGVDQKHCPDYVKLAESYGAQGIRAQSLDELGAAIKAGLK
FT                   SDVSTVIDIPIDPEEDVLPFVAPGTPLKDMILPS"
FT                   /transl_table="11"
FT                   /protein_id="YP_875552.1"
FT   gene            complement(562176..563447)
FT                   /db_xref="GeneID:6370796"
FT                   /locus_tag="CENSYa_0616"
FT   CDS_pept        complement(562176..563447)
FT                   /locus_tag="CENSYa_0616"
FT                   /gene_family="HOG000106488" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   system, periplasmic component"
FT                   /transl_table="11"
FT                   /note="COG0683"
FT                   /db_xref="GI:118575810"
FT                   /db_xref="GeneID:6370796"
FT                   /translation="MQRSAGMMGAVGLAAGLSIGLSIGFSYMTTGADDPAAPEQLTAST
FT                   GPSGTIDIGLVLPATGDVSWHGYDNGLAAQLALEDFNRYLDKIDAGWEFNLVVEDSQSD
FT                   PVVALEKIQSLNSKGIKLVLGTETSAELRNVRNYAESNGMLLISPSSSSSALSIDDRIF
FT                   RLVPDDTQQGRVTASLLESRGITAAIPVYRGDVWGDGLYKTTKGSFESRGGTLDEGIRY
FT                   SPESAVFSTEAHLLNERLGEYLQERPASEVAIVMMGFEEAVHFFNAASPYDGLSSVLWT
FT                   GTDALTNNGLLVEDPIATAFMEEVGFVSAQFAASQNDRYEHVKKELTSQIGSSPNSFAY
FT                   SSYDSLWLLGMSILQVQSADPELISVALPTVARHHSGSLGPIILNDAGDLAASDYELYT
FT                   VRGGEWVAYGMYKADTEKINSGTL"
FT                   /protein_id="YP_875553.1"
FT   gene            complement(563637..564236)
FT                   /db_xref="GeneID:6370797"
FT                   /locus_tag="CENSYa_0617"
FT   CDS_pept        complement(563637..564236)
FT                   /product="N-6-adenine-methyltransferase"
FT                   /gene_family="HOG000106854" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /locus_tag="CENSYa_0617"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="GI:118575811"
FT                   /db_xref="GeneID:6370797"
FT                   /translation="MDSVTAGRHSTTENKDWGTPPVYVDAVRRVLGGVICLDPCSNPRS
FT                   VVGAEVEYMLPARDGLEEKWNYPKIYVNPPYGADRARGTKISDWLRRCAEAGKSGSEVL
FT                   ALVPVATNTSHWKMHVFGRADAVCFLRDTRLRFLVDGRDGGKGAPMACAMVYYGGNVRR
FT                   FSTVFREHGAVVDLRDLKVRKRHGRPGVKSRPEIRA"
FT                   /transl_table="11"
FT                   /protein_id="YP_875554.1"
FT   gene            564426..564725
FT                   /db_xref="GeneID:6370798"
FT                   /locus_tag="CENSYa_0618"
FT   CDS_pept        564426..564725
FT                   /locus_tag="CENSYa_0618"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575812"
FT                   /db_xref="GeneID:6370798"
FT                   /translation="MTCGRLRMPVCAPRQAPDVEEPRTEPVPRDEPEPIQDREAPEEEP
FT                   AAEPADEPRTEPQQDREAPEDRQDSGPEAEPAGDSEVGFFEAIGNFFRSPFGLN"
FT                   /protein_id="YP_875555.1"
FT   gene            complement(565055..565405)
FT                   /db_xref="GeneID:6370799"
FT                   /locus_tag="CENSYa_0619"
FT   CDS_pept        complement(565055..565405)
FT                   /locus_tag="CENSYa_0619"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575813"
FT                   /db_xref="GeneID:6370799"
FT                   /translation="MRVNGGPSDRVAVQAGCSGRADLKSCSPPRFNVDPAIPNYMYSRM
FT                   QDACSDQIQIRVRQALVPTSDTGRNSVRACDMGTWVAQHQSPLVLWPGIYQCPVSSTYW
FT                   GFPRYRCKPAVS"
FT                   /protein_id="YP_875556.1"
FT   gene            complement(565622..566005)
FT                   /db_xref="GeneID:6370800"
FT                   /locus_tag="CENSYa_0620"
FT   CDS_pept        complement(565622..566005)
FT                   /locus_tag="CENSYa_0620"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575814"
FT                   /db_xref="GeneID:6370800"
FT                   /translation="MTLSQKELDEINEAFPDDGVDPHMEAMLTVFKKNLATVPDGFMTI
FT                   RINGKDIVFVKPHVTEMKKNDSYPFMISEGRDEEKYPGKPTHSDDMINVVCNHTGVGRK
FT                   RAMEALDDAKGDTQQAIILLRND"
FT                   /protein_id="YP_875557.1"
FT   gene            complement(566008..566853)
FT                   /db_xref="GeneID:6370801"
FT                   /locus_tag="CENSYa_0621"
FT   CDS_pept        complement(566008..566853)
FT                   /locus_tag="CENSYa_0621"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575815"
FT                   /db_xref="GeneID:6370801"
FT                   /translation="MSGDHHTSEAEKSELFKMEIRDLSRRTENMSHTYLGFISQDEGCW
FT                   IRDQLQLKRVWDRGRAFTGVEDDSDIRTDEELEQFRQDIETANQLMCEVAARNPNGNAA
FT                   KVVKELDHINEALPALVRKTCKVYRATSVNEILTLARGGAVGDGREKRDKDYGQDDNIS
FT                   ASVSFAVAKHFAQDLKDKIIMEMDVSALNEGKEWLAQKYDHRPICRRIRDGKPAGAVLQ
FT                   KFGNAHSAASSYFMEVRLKYGAKPKIKRVHIPAKTSPKVVKNLKKELIPLGIKVKEAPD
FT                   "
FT                   /protein_id="YP_875558.1"
FT   gene            complement(566850..567062)
FT                   /db_xref="GeneID:6370802"
FT                   /locus_tag="CENSYa_0622"
FT   CDS_pept        complement(566850..567062)
FT                   /locus_tag="CENSYa_0622"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575816"
FT                   /db_xref="GeneID:6370802"
FT                   /translation="MNDTMYGRCGPGILRSGAMSLTVGALDTFEFPTGTGKPDLLRHLY
FT                   GCPGGITTTASSLAVRKALDRCQKS"
FT                   /protein_id="YP_875559.1"
FT   gene            complement(567257..573502)
FT                   /db_xref="GeneID:6370803"
FT                   /locus_tag="CENSYa_0623"
FT   CDS_pept        complement(567257..573502)
FT                   /locus_tag="CENSYa_0623"
FT                   /gene_family="HOG000106865" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="subtilisin-like serine protease"
FT                   /transl_table="11"
FT                   /note="COG1404"
FT                   /db_xref="GI:118575817"
FT                   /db_xref="GeneID:6370803"
FT                   /translation="MDGRQIPMRRGSGARRLGYMAGLAAFLGIAALVLAGAPNSQAEEA
FT                   HMQLVHRMTDGEITVSTVPVQVTAEEYAQPRQFQAEEVSRPKVSSELQRYAETGIHPMC
FT                   GRGMDDNATERFGIDCSVPVDRPVSVLILLEQEKIQVNYAEYNYNMEAVYSRLQEEKER
FT                   RAEAISAPIERVTEYLLGINGTGIEKHASIGGITAKVPASAISGIAALEQVERIEATEY
FT                   LYEYSLDSSRRSTGINAPYYAGFGGEGTRIASIDSGLDIVFGSYDNVTGTAEPVHDDLD
FT                   DLDDDPLTDDPKVVYIRDTVTADGMDDPRGCVPHGTNVAGAAAGTGSLDPRFRGFAPGA
FT                   ELVIYSNCFRGNADLGGSVRAVIELINSSSAAPSVDVLTLSYGGPADGYGTGPDAILGD
FT                   AAYDNGIAVTWSAGNSLEDPGFYNGTADSHKVFTVGQVFEDGRNSDSNNYGTTLDGRIK
FT                   PEIVAPVFPMTLPTMGNTYSGFNGGTSFSTPAVAGAMATMIGLYKGQGIVLEPGHVYAM
FT                   MLSQADGTGGSFSDIRMDERRGAGIMGMDYGRIETHSGTYVFNSTGNVTIPLPDIPGGT
FT                   EKMAAALWWPEEALDTADTDGDDHNEVHLHLRANGTVQESSDNSGSILQRAVLVGPEGA
FT                   GYDMVMDFVDGEVSSQKVFYSYTFFAGEGGFDTEYAALSSDGESITVGFTRAVDPPTAG
FT                   PVAFGVTGGTVTDTAVSGSEVVLSLSEPLQIAEPPRVVLYGSVSARDADVRLGVQNVAN
FT                   VTGAGGMPFASLSDAAHNSTHLFLVDFRNNTLDILDSSLDIADRVNATTLGEQWLPRAA
FT                   GVNGTNIVVASHLGNIHVLDPSGNQTGSFEIPDTVGIPFDLELGPGIIISSLLNNTVTV
FT                   FEPDGSSHIAFGTDGMPDRSRPGQLSVPIGVSSNGTHIFVADNGNFRIHVFNASGAPRG
FT                   AVDGSAVPGWGTFSPYDVHVSDGFMLVADGVGAAAMGLQGGLLQDFGVPAPGHSHFSIT
FT                   SNGTHVFIPETPGQATPDPVVQVRVLEYHSVQSGAEPRVLSVAAPAGTYDTGDTVPITV
FT                   TFSEEVYIGGMPHILLDIPGATANYSSGNGTVDIVFGYTVGSGDISAGLNYVDEDSLVL
FT                   GGGSITAAGSAVPALLGLPPTTSASSLAGTVVAVGAPSITIVVMDSPVPTDELRRSTAQ
FT                   SVSVSAFDSPSVADSVAANGTASSVGVMRDAADALPLTEGATIHTSLTRSASDEPAIAD
FT                   SASADSTTAPASLAISAADLPAIADSTVSDRTDNSMAGMRAAADEPSATDRADISLTAI
FT                   RTGGDAPAVSEIPGADLSGMTQGTDAPMASDVVMFSIHIGATDRPAAADGIEAMQDGII
FT                   QETDAPAFSETVLRAISLGTGDAPGILETETSMGMILLDTSDAPGIADSAHTTPTVSSV
FT                   SASSAAEKENGTVAITITFSEPVNVAGVPLLGLDVGANATFESGSGTAELVFNYTVLDG
FT                   HNSPDLSYISTGALVPGNGSITAADDGIPADLTLPQPGSASSLSGSSDVVIDTIVPSIA
FT                   RILATGNYTLVATISEPLDSTPGNTILVINGTSASNPMVEIVAGSNLLINTSSALFNAQ
FT                   NITVRFSDVADPAGNTLAAYAYNLTDNDRALLDDREVVINDTSNLLVIHDGISDVRLND
FT                   ETRDKPLILNLEQVKSPDNANATLPSNITVTRMNVNRDNVTLLLPANLTLSGFNGTQQI
FT                   IIQNSTRTPDVDGDPGNTPVEVGLPDADLGLDAPVRIGLVGSPGDLGYRINSTNNTTVI
FT                   DVRCNDDTPDGSAPGQGADAGACLFNTGENFAIWTYRLSTYGLFTPAPPEPVTVQQPAP
FT                   LPRRGGGGGGGGGGGGGGSILTGSDAGRSASLGFTVGGQDARESPSGILLSPGGTLVIT
FT                   PEIESGSFEARVFGMEAILYGAGGQQDARVRYSAVPALLGSEQCAGESYSSDRIFACDV
FT                   SSVITEENAGYTLDSSDQISLEVPLEGEFEGTMSVRLQDSRGILLLSHEGTMYRLSTGQ
FT                   EEPVLEIDPEPAGIIEEAPGGTEPEPAKVPPEPLIAEPEPGAEPEADTAAGPGAMPDGP
FT                   SESEPSPEGTGEPDGLLDMIVEWFRSLFGG"
FT                   /protein_id="YP_875560.1"
FT   gene            complement(573573..574379)
FT                   /db_xref="GeneID:6370804"
FT                   /locus_tag="CENSYa_0624"
FT   CDS_pept        complement(573573..574379)
FT                   /locus_tag="CENSYa_0624"
FT                   /gene_family="HOG000224792" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="DhnA-type fructose-1,6-bisphosphate aldolase"
FT                   /EC_number="4.2.1.-"
FT                   /note="COG1830"
FT                   /db_xref="GI:118575818"
FT                   /db_xref="GeneID:6370804"
FT                   /translation="MDWGLKNRISGIIRPPDGKAVMLAVDHGYFLGPTEKLEAPARAIR
FT                   PLLRHCDSLMVTRGVLRSSVSATQHIPIVLRVSGGSSIIGEDLSNERITTGIKDALRLN
FT                   SSALAMSIFVGAKHEHRTIVSLGRLVNEAEEYGMPVLAVTAVGKDMGKDARYLSLACRI
FT                   AAEQGAHIIKTYYCENFEKVIESCPVPVIIAGGKKIPERDALHLTYNAVNAGAVGVDMG
FT                   RNIWQSENPVPMIRAVRAIVHGNMKADEAYELYQRLSKPEHAKARA"
FT                   /transl_table="11"
FT                   /protein_id="YP_875561.1"
FT   gene            574697..575239
FT                   /db_xref="GeneID:6370805"
FT                   /locus_tag="CENSYa_0625"
FT   CDS_pept        574697..575239
FT                   /locus_tag="CENSYa_0625"
FT                   /gene_family="HOG000105881" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575819"
FT                   /db_xref="GeneID:6370805"
FT                   /translation="MDAFEWVVLIASMFAVCGAIAAIATVWISARRYLKEKNTEEVDSA
FT                   QNLYCELNTDSKYLDKTEYPYSFLSLKTTDSTGNKKMARFMLQFLNHDFYDSMMYSGKL
FT                   YFLKRDTHRSIQYAFKLIKTYNKYLEMVSPVLIQPEPELEEIWLYCKLLEEYQSRIKVA
FT                   IQESMRKLEQDFKIVKC"
FT                   /protein_id="YP_875562.1"
FT   gene            complement(575399..576217)
FT                   /db_xref="GeneID:6370806"
FT                   /locus_tag="CENSYa_0626"
FT   CDS_pept        complement(575399..576217)
FT                   /locus_tag="CENSYa_0626"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575820"
FT                   /db_xref="GeneID:6370806"
FT                   /translation="MPDKIEKKAKEKMLYSHAKTIEMPLEFKLDDMPGKPDGIEVPVKI
FT                   ILKAVIDMPGEPDGSEMRKTEEPFHGTVEPFPVPEKYRATPEDLAAADKAVGKVEESHH
FT                   GTVEPFPVPEKYRATPEDLAAADKAVGKVEEPLYGSVEPFLVPEKYRATPEELAAPDEP
FT                   VGKVEEPLYGSVEPFLVPEKYRATPEELAAPDEPVGKVEEPLYGSVEPFLVPKKYRATP
FT                   EELAAPDEPVGKVEEPLYGSVEPFLVPKKYRATPEELAAPDEPIRSEKGN"
FT                   /protein_id="YP_875563.1"
FT   gene            complement(576327..576548)
FT                   /db_xref="GeneID:6370807"
FT                   /locus_tag="CENSYa_0627"
FT   CDS_pept        complement(576327..576548)
FT                   /locus_tag="CENSYa_0627"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:118575821"
FT                   /db_xref="GeneID:6370807"
FT                   /translation="MSGLIAACERSGSAFAGTPKRAEPRLFIFLRYKDAESANNSAEAA
FT                   IKAVRQRCREQLKTPDGMMIFGALLTCL"
FT                   /protein_id="YP_875564.1"
FT   gene            complement(576545..577414)
FT                   /db_xref="GeneID:6370808"
FT                   /locus_tag="CENSYa_0628"
FT   CDS_pept        complement(576545..577414)
FT                   /locus_tag="CENSYa_0628"
FT                   /gene_family="HOG000106876" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="site-specific DNA methylase"
FT                   /EC_number="2.1.1.72"
FT                   /note="COG0338"
FT                   /db_xref="GI:118575822"
FT                   /db_xref="GeneID:6370