(data stored in ACNUC7421 zone)

HOGENOMDNA: CLOB6_1

ID   CLOB6_1; SV 1; empty ; DNA; empty ; PRO; 270022 BP.
XX
AC   NC_012654;
XX
PR   Project: 59173;
XX
DE   Clostridium botulinum Ba4 str. 657 plasmid pCLJ, complete sequence.
XX
OS   Clostridium botulinum Ba4 str. 657
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Clostridiaceae;
OC   Clostridium.
XX
RN   [1]
RP   1-270022
RX   PUBMED; 18060065.
RA   Smith,T.J., Hill,K.K., Foley,B.T., Detter,J.C., Munk,C.A., Bruce,D.C.,
RA   Doggett,N.A., Smith,L.A., Marks,J.D., Xie,G. and Brettin,T.S.;
RT   "Analysis of the neurotoxin complex genes in Clostridium botulinum A1-A4
RT   and B1 strains: BoNT/A3, /Ba4 and /B1 clusters are located within
RT   plasmids";
RL   PLoS ONE 2 (12), E1271 (2007)
XX
RN   [2]
RP   1-270022
RA   Shrivastava,S., Brown,J.L., Bruce,D., Detter,C., Munk,C., Smith,L.A.,
RA   Smith,T.J., Sutton,G. and Brettin,T.S.;
RT   "Genome sequence of Clostridium botulinum Ba4 strain 657 Plasmid pCLJ";
RL   Unpublished
XX
RN   [3]
RP   1-270022
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (03-MAY-2009) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [4]
RP   1-270022
RA   Shrivastava,S., Brown,J.L., Bruce,D., Detter,C., Munk,C., Smith,L.A.,
RA   Smith,T.J., Sutton,G. and Brettin,T.S.;
RT   "Direct Submission";
RL   Submitted (15-MAY-2008) Los Alamos National Laboratory, Los Alamos, NM,
RL   USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP001081.
CC   The authors wish to acknowledge the Intelligence Technology
CC   Innovation Center for funding the sequencing and the NIH/NIAID for
CC   funding the annotation at the Pathema Bioinformatics Resource
CC   Center.
CC   For more information about this strain contact Theresa Smith,
CC   Integrated Toxicology, United States Army Medical Institute of
CC   Infectious Diseases, theresa.smith@amedd.army.mil.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..270022
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:515621"
FT                   /note="bivalent Ba strain"
FT                   /strain="657"
FT                   /plasmid="pCLJ"
FT                   /organism="Clostridium botulinum Ba4 str. 657"
FT   gene            complement(99..410)
FT                   /db_xref="GeneID:7816121"
FT                   /locus_tag="CLJ_0001"
FT   CDS_pept        complement(99..410)
FT                   /locus_tag="CLJ_0001"
FT                   /gene_family="HOG000051473" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="GI:229587272"
FT                   /db_xref="GeneID:7816121"
FT                   /translation="MPDIYINFIIKCLDCTIKYAKKISNVLIIVFNELYLFNKKIIITQ
FT                   TVKIVKLFKISFNYTTVLKKEKYDKLKAKEKINLDLNRNVQPGEELIKYIKKKGKMER"
FT                   /protein_id="YP_002860310.1"
FT   gene            complement(828..1448)
FT                   /db_xref="GeneID:7816178"
FT                   /locus_tag="CLJ_0002"
FT   CDS_pept        complement(828..1448)
FT                   /locus_tag="CLJ_0002"
FT                   /gene_family="HOG000017398" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thermonuclease"
FT                   /EC_number="3.1.31.1"
FT                   /note="identified by match to protein family HMM PF00565"
FT                   /db_xref="GI:229587273"
FT                   /db_xref="GeneID:7816178"
FT                   /translation="MGIKKFIPIILITVLLTGCQNINEATKLSQDVVRDNVSIINNIKG
FT                   NNYPGKNNLSLKKATVYRVIDGDTIILNTGERVRFIGVNCPEDTTKHEDFGREATLYTR
FT                   SMLEDKTVYLEKDISNTDKYGRLLRYVWLEIPESNSDQEINSKMFNSMLLSNGFGQQST
FT                   FPPNVKYVDTFTNCEREARSAKKGLWKINSNGTTNGDIRYKKY"
FT                   /transl_table="11"
FT                   /protein_id="YP_002860311.1"
FT   misc_feature    complement(879..1274)
FT                   /note="Staphylococcal nuclease homologues; Region: SNc;
FT                   smart00318"
FT                   /db_xref="CDD:128613"
FT                   /locus_tag="CLJ_0002"
FT   misc_feature    complement(879..1262)
FT                   /note="Staphylococcal nuclease homologues. SNase homologues
FT                   are found in bacteria, archaea, and eukaryotes. They
FT                   contain no disufide bonds; Region: SNc; cd00175"
FT                   /db_xref="CDD:29137"
FT                   /locus_tag="CLJ_0002"
FT   misc_feature    complement(order(1071..1073,1077..1082,1188..1190,
FT                   1197..1199,1215..1217,1245..1247))
FT                   /note="Catalytic site; other site"
FT                   /db_xref="CDD:29137"
FT                   /locus_tag="CLJ_0002"
FT   gene            complement(1622..1924)
FT                   /db_xref="GeneID:7816150"
FT                   /locus_tag="CLJ_0003"
FT   CDS_pept        complement(1622..1924)
FT                   /locus_tag="CLJ_0003"
FT                   /gene_family="HOG000050828" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="HepA/SNF2"
FT                   /transl_table="11"
FT                   /db_xref="GI:229587274"
FT                   /db_xref="GeneID:7816150"
FT                   /translation="MINIIEDKSILINKANDCEPKREIILKDDFSKKRKQYYNIVKLKE
FT                   NCKSIFVKGEYVIEIIDDSNYIKYIWINGDSVEKLLNQKNDQYRLLIDNILGNKL"
FT                   /protein_id="YP_002860312.1"
FT   gene            complement(3107..6997)
FT                   /db_xref="GeneID:7816290"
FT                   /locus_tag="CLJ_0004"