(data stored in ACNUC7421 zone)

HOGENOMDNA: CLOB6_1.PE1

CLOB6_1.PE1          Location/Qualifiers
FT   CDS_pept        complement(99..410)
FT                   /locus_tag="CLJ_0001"
FT                   /gene_family="HOG000051473" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="GI:229587272"
FT                   /db_xref="GeneID:7816121"
FT                   /translation="MPDIYINFIIKCLDCTIKYAKKISNVLIIVFNELYLFNKKIIITQ
FT                   TVKIVKLFKISFNYTTVLKKEKYDKLKAKEKINLDLNRNVQPGEELIKYIKKKGKMER"
FT                   /protein_id="YP_002860310.1"
     atgccagata tatacattaa tttcattatt aaatgtttag attgtacaat taaatatgca        60
     aagaaaatta gcaatgtgct aattattgta ttcaatgaat tgtatttatt taataaaaaa       120
     attataataa cacaaacagt aaaaatagta aaattattta aaatatcatt caattataca       180
     acagtattaa agaaagaaaa atacgataag ttaaaggcta aagaaaagat taacttagat       240
     ttaaatagaa atgtacaacc aggggaagaa cttattaaat atatcaagaa gaaagggaaa       300
     atggaaagat ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page