(data stored in ACNUC7421 zone)

HOGENOMDNA: CLOB6_1.PE2

CLOB6_1.PE2          Location/Qualifiers
FT   CDS_pept        complement(828..1448)
FT                   /locus_tag="CLJ_0002"
FT                   /gene_family="HOG000017398" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="thermonuclease"
FT                   /EC_number="3.1.31.1"
FT                   /note="identified by match to protein family HMM PF00565"
FT                   /db_xref="GI:229587273"
FT                   /db_xref="GeneID:7816178"
FT                   /translation="MGIKKFIPIILITVLLTGCQNINEATKLSQDVVRDNVSIINNIKG
FT                   NNYPGKNNLSLKKATVYRVIDGDTIILNTGERVRFIGVNCPEDTTKHEDFGREATLYTR
FT                   SMLEDKTVYLEKDISNTDKYGRLLRYVWLEIPESNSDQEINSKMFNSMLLSNGFGQQST
FT                   FPPNVKYVDTFTNCEREARSAKKGLWKINSNGTTNGDIRYKKY"
FT                   /transl_table="11"
FT                   /protein_id="YP_002860311.1"
     atggggatca aaaaatttat tcctattatt ttaataactg ttttgcttac aggctgtcaa        60
     aatattaatg aagctactaa attaagccaa gatgttgtga gggataatgt ttccataata       120
     aataatatta aaggtaataa ttatcctgga aaaaataatc taagtttaaa aaaagcaact       180
     gtatatagag ttatagatgg agacactata attttaaata ctggggaaag ggttagattc       240
     attggggtta actgtcctga agacactact aagcatgagg actttggaag agaagctact       300
     ttatatacaa gatctatgtt agaagataaa actgtatatt tagaaaaaga cataagtaat       360
     actgataaat atggcagatt gctaagatat gtttggctag agatacctga aagcaatagt       420
     gatcaagaaa taaattctaa aatgtttaat tctatgttat tatcaaatgg atttggtcaa       480
     caaagtacat tccctccaaa tgtaaaatac gttgatacat ttacaaattg tgaaagagaa       540
     gctagaagtg ctaaaaaagg cttatggaag attaatagta atggaaccac taatggagat       600
     attagatata agaaatattg a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page