(data stored in ACNUC7421 zone)

HOGENOMDNA: CLOB6_2

ID   CLOB6_2; SV 1; empty ; DNA; empty ; PRO; 9953 BP.
XX
AC   NC_012657;
XX
PR   Project: 59173;
XX
DE   Clostridium botulinum Ba4 str. 657 plasmid pCLJ2, complete sequence.
XX
OS   Clostridium botulinum Ba4 str. 657
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Clostridiaceae;
OC   Clostridium.
XX
RN   [1]
RP   1-9953
RX   PUBMED; 18060065.
RA   Smith,T.J., Hill,K.K., Foley,B.T., Detter,J.C., Munk,A.C., Bruce,D.C.,
RA   Doggett,N.A., Smith,L.A., Marks,J.D., Xie,G. and Brettin,T.S.;
RT   "Analysis of the neurotoxin complex genes in Clostridium botulinum A1-A4
RT   and B1 strains: BoNT/A3, /Ba4 and /B1 clusters are located within
RT   plasmids";
RL   PLoS ONE 2 (12), E1271 (2007)
XX
RN   [2]
RP   1-9953
RA   Shrivastava,S., Brown,J.L., Bruce,D., Detter,C., Munk,C., Smith,L.A.,
RA   Smith,T.J., Sutton,G. and Brettin,T.S.;
RT   "Genome sequence of Clostridium botulinum Ba4 strain 657 Plasmid pCLJ2";
RL   Unpublished
XX
RN   [3]
RP   1-9953
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (03-MAY-2009) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [4]
RP   1-9953
RA   Shrivastava,S., Brown,J.L., Bruce,D., Detter,C., Munk,C., Smith,L.A.,
RA   Smith,T.J., Sutton,G. and Brettin,T.S.;
RT   "Direct Submission";
RL   Submitted (15-MAY-2008) Los Alamos National Laboratory, Los Alamos, NM,
RL   USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP001082.
CC   The authors wish to acknowledge the Intelligence Technology
CC   Innovation Center for funding the sequencing and the NIH/NIAID for
CC   funding the annotation at the Pathema Bioinformatics Resource
CC   Center.
CC   For more information about this strain contact Theresa Smith,
CC   Integrated Toxicology, United States Army Medical Institute of
CC   Infectious Diseases, theresa.smith@amedd.army.mil.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..9953
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:515621"
FT                   /note="bivalent Ba strain"
FT                   /strain="657"
FT                   /plasmid="pCLJ2"
FT                   /organism="Clostridium botulinum Ba4 str. 657"
FT   gene            complement(2038..2157)
FT                   /db_xref="GeneID:7847858"
FT                   /locus_tag="CLJ_A0001"
FT   CDS_pept        complement(2038..2157)
FT                   /locus_tag="CLJ_A0001"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="GI:229599880"
FT                   /db_xref="GeneID:7847858"
FT                   /translation="MCCAFFSVGLLYRGNDFVSLVDRPGVVYGVDWGSQLHIP"
FT                   /protein_id="YP_002860867.1"
FT   gene            complement(2192..2377)
FT                   /db_xref="GeneID:7847856"
FT                   /locus_tag="CLJ_A0002"
FT   CDS_pept        complement(2192..2377)
FT                   /locus_tag="CLJ_A0002"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="response regulator receiver protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:229599877"
FT                   /db_xref="GeneID:7847856"
FT                   /translation="MNNIKRTPRNEAGLTPRQQEKANKEKLIKELVSKGLNKSQVANEL
FT                   GVNRSTITRSYGYLFI"
FT                   /protein_id="YP_002860868.1"
FT   misc_feature    complement(2216..2338)
FT                   /note="Helix-turn-helix domain of Hin and related proteins,
FT                   a family of DNA-binding domains unique to bacteria and
FT                   represented by the Hin protein of Salmonella. The basic HTH
FT                   domain is a simple fold comprised of three core helices
FT                   that form a right-handed...; Region: HTH_Hin_like; cd00569"
FT                   /db_xref="CDD:119388"
FT                   /locus_tag="CLJ_A0002"
FT   misc_feature    complement(order(2216..2221,2225..2230))
FT                   /note="DNA-binding interface; DNA binding site"
FT                   /db_xref="CDD:119388"
FT                   /locus_tag="CLJ_A0002"
FT   gene            complement(4152..4724)
FT                   /db_xref="GeneID:7847853"
FT                   /locus_tag="CLJ_A0003"
FT   CDS_pept        complement(4152..4724)
FT                   /locus_tag="CLJ_A0003"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:229599878"
FT                   /db_xref="GeneID:7847853"
FT                   /translation="MVHSLNIEFDKLSIKEQVEFINRELQKDKKISVTKLCKKYGINKS
FT                   TVISRFTTKGYKYNAELRVYTKDIVIQNNNKSINNIKHEQIEVSKKNNLMELQDIKELK
FT                   ELLEMKEQLKEIIQEYNKNKNIIDVPEEPELKVDKDKFEGELKGRLIKVYNNINNDWIK
FT                   FCKKNNQFKMQDLYSLALLEFMEKYKR"
FT                   /protein_id="YP_002860869.1"
FT   gene            complement(5110..5802)
FT                   /db_xref="GeneID:7847854"
FT                   /locus_tag="CLJ_A0004"
FT   CDS_pept        complement(5110..5802)
FT                   /locus_tag="CLJ_A0004"
FT                   /gene_family="HOG000107671" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative resolvase"
FT                   /transl_table="11"
FT                   /note="identified by match to protein family HMM PF00239"
FT                   /db_xref="GI:229599882"
FT                   /db_xref="GeneID:7847854"
FT                   /translation="MNKIYGYCRISTNKQSIERQQRNILALYPSAIIINEVFTGTKIYE
FT                   RKEFNKLLKQIKKGDMIVFDSVSRMSRNSEEGFKLYEELFNKGIELIFIKEQHINTSTY
FT                   KKALTNNIALTGTNVDFILEGVNKYLLALAKEQIKIAFNQSEKEVTDLQQRTREGIETA
FT                   RLNGKQIGQKEGIKLTTKKSITAKKDIIKYSKDFQGTLRDTEVIKLLGIARNTYYKYKK
FT                   EIIEREGK"
FT                   /protein_id="YP_002860870.1"
FT   misc_feature    complement(5116..5796)
FT                   /note="Site-specific recombinases, DNA invertase Pin
FT                   homologs [DNA replication, recombination, and repair];
FT                   Region: PinR; COG1961"
FT                   /db_xref="CDD:32144"
FT                   /locus_tag="CLJ_A0004"
FT   misc_feature    complement(<5494..5793)
FT                   /note="Serine Recombinase (SR) family, Resolvase and
FT                   Invertase subfamily, catalytic domain; members contain a
FT                   C-terminal DNA binding domain. Serine recombinases catalyze
FT                   site-specific recombination of DNA molecules by a
FT                   concerted, four-strand cleavage and...; Region: SR_ResInv;
FT                   cd03768"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CLJ_A0004"
FT   misc_feature    complement(order(5587..5589,5596..5601,5770..5772,
FT                   5776..5778))
FT                   /note="catalytic residues; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CLJ_A0004"
FT   misc_feature    complement(5770..5772)
FT                   /note="catalytic nucleophile; other site"
FT                   /db_xref="CDD:58117"
FT                   /locus_tag="CLJ_A0004"
FT   gene            7220..8173
FT                   /db_xref="GeneID:7847857"
FT                   /locus_tag="CLJ_A0005"
FT   CDS_pept        7220..8173
FT                   /locus_tag="CLJ_A0005"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="alpha-hemolysin"
FT                   /transl_table="11"
FT                   /note="identified by match to protein family HMM PF07968"
FT                   /db_xref="GI:229599879"
FT                   /db_xref="GeneID:7847857"
FT                   /translation="MEKQSLSYGNDNVQTSIIGGDNESVQLSTSNGKSIASTTKDGVKT
FT                   YTSSKIISSNGFKISLEGTFIDDPKDDKLTLLLSTDGSFMPSGMEKTGDYWSGQMIWPS
FT                   TFQLRMGLSENKFKKTAILKVAPINSIETIDVSETMGYSVGGSIEVTGSSTGGSGGSSG
FT                   NANYSVSKTISYKQPDYQTILKTNDSLDVLWNITYNRNKEGYDRDSWNTLYGNQLFMRS
FT                   RNSNTGIENLTLNNDLSSLITGGFSPKGIIAIKTGREHISGTSNTDLLTVKLTRIMDKY
FT                   DLIWATSHWKGINTKDYTNKFLSSSIWIDWTNYRLS"
FT                   /protein_id="YP_002860871.1"
FT   misc_feature    7304..8167
FT                   /note="Leukocidin/Hemolysin toxin family; Region:
FT                   Leukocidin; cl08468"
FT                   /db_xref="CDD:164116"
FT                   /locus_tag="CLJ_A0005"
FT   gene            complement(8721..9359)
FT                   /db_xref="GeneID:7847855"
FT                   /locus_tag="CLJ_A0006"
FT   CDS_pept        complement(8721..9359)
FT                   /locus_tag="CLJ_A0006"
FT                   /gene_family="HOG000057972" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="integrase/recombinase XerD"
FT                   /transl_table="11"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="GI:229599881"
FT                   /db_xref="GeneID:7847855"
FT                   /translation="MKAKSINRKLTSINQLFKSININYGVKCKRMKEQKQTFLDDVLTR
FT                   DEIEKMLNKCGTNIRDKAIIMTLYKTGLRVSELLQLRIRDIRKKSIEIEGKGGKYRYII
FT                   VPKELKEIWLQYLKVRKPVETDKLFVGTNGEMHRHNINRIIKKYAVQARITKGKAHPHA
FT                   LRHSFCKALAIQNVGIEVIADLAGHEDLNTTRIYTRQTQKELREKIELI"
FT                   /protein_id="YP_002860872.1"
FT   misc_feature    complement(8763..9326)
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:174037"
FT                   /locus_tag="CLJ_A0006"
FT   misc_feature    complement(8748..9236)
FT                   /note="Phage integrase family; Region: Phage_integrase;
FT                   pfam00589"
FT                   /db_xref="CDD:144254"
FT                   /locus_tag="CLJ_A0006"
FT   misc_feature    complement(order(8769..8771,8874..8882,9072..9074,
FT                   9135..9140))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="CLJ_A0006"
FT   misc_feature    complement(order(8769..8771,8796..8798,8865..8867,
FT                   8874..8876,9072..9074,9138..9140))
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="CLJ_A0006"
FT   misc_feature    complement(order(8769..8771,8796..8798,8865..8867,
FT                   8874..8876,9138..9140))
FT                   /note="active site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="CLJ_A0006"
SQ   Sequence 9953 BP; 3467 A; 1403 C; 993 G; 4090 T; 0 other;
     TTTACCACTA CATATTAACA ATTATATTAA CATAACTCTA TAGCTAAGTT AACCTTATAA        60
     TTTTTTATGA TTTTATGATG ATTTCTTTAA AATGCTTTTA TATTCTTTAA AATTCTATAT       120
     TGAATAAAAA ACAATTGCAT TTTCTCATTT GAACGCATTT CCAAATACCC TAAAATTTAC       180
     ATTAGTAACA TCAACTAAAA AAACATTACT CTAAAAGTTT GTTTGACAAA ACAATAACAA       240
     ATTGTGTGAA AAAAATATAA GTAAACAATA AAATTTTAGA AGTTCCTAAT ATAACAGAGC       300
     ATACTATTTC ATAAAACAGA CTAATGTTCG TAATTTATAA TTGTTCTAAT ATATCTAATA       360
     CTTCTTTAGT ATTAATAATG TCTAAATATG CTCCATATTT ATTTTCATTA ATAGATATAG       420
     ATTTGTTAAT GTCATGTTGC CAAGCTTTTA GCATTGATAC CATAGTAAAT ATATCTTTTT       480
     GTTCTTGTGA TAAAGAATCC ATACTATAGC TACCATAGTC TAACTTTTCA ATACATTTCA       540
     TAGCTTTATC TATGTTAAGA CCTAAATTAC AACATTCTTC ATATTTACTC ACTTTAGAAT       600
     CCTCCTAATT AATCTAACTA AAATATAAAT TTTAAAACTA AATAAGCATT TTATTAAATA       660
     TAGTTAATTT CATTATACAT AAAGATAATA CATATATATA GCTTTAAATA AGCATAAGAA       720
     CCTATATAAC AGTTTTAAAA TAATTGTTTG ATGATTTTAT TAAATATATT ATTTATAGCT       780
     TAAAAAGCTT CGTAAGCTAT AAATAATATA TTTAAAAAAT TAGGAGCGGG GAAAAAACTA       840
     GCTTTAAAGT AAAATCTCTT TTACAACACT TTTTGTATCT AACAAAAACT ATTCACTATA       900
     TATATTTAAT AGATTTATCT TTTAATAGAT TTATCTTTTA ATAGATTAAT ATTTTGTTTG       960
     GGAAATAAAT CCGATAGGGT ACGGATTTAT TTCCGACTTA TTAATTTAAG TATCCTATTA      1020
     AGTAAAATTG TAATACTAAT CTAATTGTAC TTATAAAAAT AATAAAAAAA GAGCATAAGG      1080
     GAAATATGAT ACTACTTACT AAATAGTAAG TAGTAAGTTA GCTGTGCCAA CTATATTTCT      1140
     ATCTAAAAAA ATCTTAAAAA AGTGATATCA TTTTAAGATT TTTTTAACTC TGTTTTGGCT      1200
     CTATTTGAAC TCTGTTTTAA CTCCATATGA GTTCTATTTG TCTCCATTTT TACTCTAAAT      1260
     TAACTCTATT TCAACTCTAC ACTTATAACC CTATTATCAA TATAAATAAT AAATATTTTA      1320
     ATGTACTAAA CCTAGTTATA TCAGTATCGC ACCATCCGTT AATCAAGAAT AAAGAAACTT      1380
     CTTTCGGAGC TAGGTGGCTT TTTAGCACCT TTTTATAATA TAAAAAATCA AAAATGTTTG      1440
     GCGGATTCTA TAAGTATTAA TATAGCCATT AGAAAAATAC AAAATTAATA TCTAAAGCAT      1500
     TATAAAGTTT CAGACATAAA CTAAATAGAA TATAAGAGAT AGTTTAATTT AATCTAATTT      1560
     ATTTGAAATC CATCTCAAGC TTATTTAAAA CGTCTGTAAT CCATTTTCAT AATCTCACTT      1620
     TTGAATACAA GTATTGACAC CTGCTTATAT ATTGATTACA CGCTATTTGT TTTATAGTTT      1680
     CAATACTTTT AAGTTTTGAC ACCGTTCACG GATAGGCATT AAGGTTATAC CCCTTTATAT      1740
     ACAAAGGATT GAGGATGGCA CTTGAGTTCG TATCTTATTA TATTTTTAAT GTTTTCATCT      1800
     ATTGTTAGGC TTTATTATCA ATGTAAAACC TAATCTAAGC CTTATTTATC AATGGTTTTA      1860
     TGATATTTTT TTATATCTTT ATAAATCCGC CATAACATAT AGTATTGCGG ATTTATTTTT      1920
     TTGGTGCATA TAATGTAAGA ATTTTTTATT TTATTAAAAA TCCGCAACAT CGACTTTTTT      1980
     GCGGATTTTC CTAAAAGGAC ACTATATATT TATATTGTTA TTTTTATATA GTTCTTTTTA      2040
     GGGTATGTGG AGCTGACTAC CCCAGTCAAC CCCATAGACC ACCCCTGGTC TGTCTACTAG      2100
     ACTAACGAAA TCATTTCCTC TATAGAGTAA TCCAACACTA AAAAAAGCAC AACACATAAT      2160
     TATAAAGAGC ATTTCATGCA ACACATTATA ATTATATAAA TAAATAACCA TAACTTCGTG      2220
     TTATTGTACT TCTGTTTACT CCTAATTCGT TAGCTACTTG ACTTTTATTT AACCCTTTAC      2280
     TTACTAACTC TTTAATTAAT TTTTCTTTAT TAGCTTTTTC CTGCTGTCTT GGTGTTAATC      2340
     CCGCTTCATT CCTTGGAGTT CTTTTTATAT TATTCATTCT ATACTTTAGT ATAGCTTAAC      2400
     ACTAGCTTTC ACACCTCCTC AATTCCTAAG TACTAATTTC TTCAATCTCC AATGTACTCA      2460
     AATTATTTAA ATTTACAACT TGACTTTCAA TCTATATTAA TTTACCTTAG GGGTTTGAAC      2520
     AGGAAACGGC TACTCCCTCC CTCCTAATTT CCAAAATTAA TAAACTTTGA AAATTAAAAG      2580
     AGTGAGATAC TTATTTTTTA CCTCTGTGGA ATCACAGGTA TCCGTATCAC ACCGTCACAG      2640
     CCTTACAACT GCAACCAACT ATTCAAAGAC TTTTGTCTTA ACTCGCTCAT TAGTGGCATT      2700
     ATCAAGATTT TAGTTGCTCC CTCAACTCTT TTAAGAGTTC CAAAAGTATA CTTATGTATT      2760
     CATATACTTA CTACGTTATC CTTGTTAATG AGTTTTTTGC CCTCTTCCAT TGTACCAACC      2820
     AACAACTTCA CCGAGGGCTA CTATCCTTTC AGCTTTATAG CTTAATAGGG TTGTGCATCC      2880
     CAAGTTCATG GGGAATTATT TTAACGTGAT TTTTTCTCAA CACGTGTTTG CCTTGATAAC      2940
     GGTCTTTTCC ATCATTTTTT TTTAAACTTG TCCAAATTTT AATTATTTAT TTATAACAAA      3000
     AATTTATTAA AATTATTTTT ATCTCTAACA TGTAGCGGTA GTTAACGTTC TATACAATAT      3060
     CAAATACACA ACGTCTTAAT ATTTCTAACA CTAAAAAAGC ACCTCTTAAG GTTCTACCCT      3120
     TAAAAAGTGC TTGAAATATC TCTATAATTA ATATATAATC TATTCTATAT TGAATAGTAA      3180
     TTATAAAGTT CTCTAACTTT TGCTTTGGTA GTGCGAATAC CTTAGTAACT GGCTTATATT      3240
     AGTGGGTGCG AACCATTAAT ATGAGAGTTG AGGACTTTTT ATTTGGTTTT AAAAAGCTTG      3300
     TTTATATTTT ACCTTTTTTT TTACCACATT TCAACATTTT TTATTTTTAA TTAAAACTTT      3360
     ATGATATTAT ATTACCACAT AATCTGACTT CAACGAATCT AATTTATGAA ATATGTAAAT      3420
     AAAATATTTA TATATTTTAA TTTATTTTTC TAAAATCAAT GTATCCTTCA TCAAATTGAA      3480
     AATAAAAACT ATCATTTCTT TCAATATTTA AAAAAGCTAC TTCTTTTTTA TCTAAAAATA      3540
     ATTTTAAAGT TATTTCCTCC ATTGACCTAT CCAACAAAAT TTTAAAATCA TCAAAATAAA      3600
     TATTTGCTAA ACTAACTCCT ATCCATGCAT ACTCATATGT AGATTTTTGT AATAATTCTT      3660
     TCATTTCTAA AAACATACCT TTTAATTTAA AAAAATCTTC TTGAAAGTTC TCTTTTGTCA      3720
     ATGTAACTAT CATAACAATT ATACCCCCTT ATTAACCTTA CAAGGTTATT ATATAACTTT      3780
     ATATAGTTAA AAGTCAATGC GTTTTATATA AATATGTTAT AATATATAGT AATTATTCGC      3840
     TTTGGAGGGT TAATATAATG ATAAAATGTA ATCTAAGAAT GTTTATGGCT AAAGATAAAA      3900
     TAGATACAGT AACCGAACTT ATGTATAAGA GTGGTCTAAG TAGAAATGCA ATAAATAGAA      3960
     TATACAAAGA AAATGCTATT GAAAAAGCAG ATTTAGAAAC ACTTATAACT TTATGTGATA      4020
     CTTTCAAATG TAAATTATCA GATTTAATTG AATATGATCC AAACAAATAA GCACTTTAAA      4080
     ATTAAAGTGC TTTATTATGT TTTAAATAAT ATTATTAGTT GCTACTTCTT CAATATTTTC      4140
     ATGACTAAAC TCTATCTTTT ATATTTTTCC ATAAATTCTA ATAAAGCAAG AGAATATAGG      4200
     TCTTGCATTT TAAACTGATT ATTTTTCTTA CAAAATTTAA TCCAATCGTT ATTAATATTA      4260
     TTATAGACCT TTATTAATCT GCCCTTTAAT TCTCCCTCAA ATTTATCCTT ATCAACTTTT      4320
     AATTCTGGCT CTTCTGGCAC ATCTATTATA TTTTTATTTT TGTTATATTC TTGTATAATC      4380
     TCTTTTAATT GTTCTTTCAT CTCTAATAAT TCTTTTAACT CTTTAATATC TTGTAATTCC      4440
     ATTAAATTAT TTTTTTTAGA TACTTCAATT TGTTCATGTT TTATATTATT TATACTTTTA      4500
     TTATTATTTT GTATAACTAT ATCTTTTGTA TAAACTCTTA ATTCTGCATT ATATTTATAA      4560
     CCTTTTGTTG TAAACCTACT TATAACTGTG CTTTTATTTA TGCCATATTT TTTACATAAT      4620
     TTTGTAACAC TTATTTTTTT ATCTTTTTGT AATTCTCTAT TAATAAATTC CACCTGTTCT      4680
     TTTATGCTTA ACTTATCAAA CTCTATATTC AAGCTATGCA CCACCTTATA CAATATAATA      4740
     AGTTATATAT AACTTATATA TAACTTATAG TTTTATAATA GTTTAATTTA TATAAAAAAT      4800
     ATAGTTATAT ATAAGTTATT ATTATATAAA TTCTATACAT CTGTATAATT TCCTTTTATT      4860
     TACTATTTTA ATATATCCAT ATTATATAAA AAATAACTAT GTTATGTAAC TAGAAGTATT      4920
     ATACTTGATA CTCCATATAA TAAATGTAAT TTCATCCCTT CTCCATCTCC AATATTTATA      4980
     TAGATAATTT AATAATACAC GCATTATTCT AGCTTTTAAA AAAGTTAAGC GTAAGTTTTT      5040
     ACTTCTTAAT TTTAAATTCT CTTAGAATAG CTTAAAATGA GTTTTAAAAG CATAAAAAAA      5100
     AGAAGGTATT TATTTACCCT CTCTTTCGAT TATTTCTTTT TTATATTTGT AGTATGTATT      5160
     TCTTGCAATT CCTAAAAGTT TTATTACTTC TGTATCTCTT AAAGTACCTT GAAAATCTTT      5220
     TGAATATTTT ATTATATCTT TTTTAGCCGT AATACTTTTT TTAGTTGTAA GTTTAATACC      5280
     TTCTTTTTGT CCTATTTGCT TACCGTTTAA TCTAGCTGTT TCTATTCCTT CTCGTGTACG      5340
     TTGTTGCAAA TCCGTAACTT CCTTCTCTGA CTGATTAAAT GCTATTTTAA TTTGCTCTTT      5400
     TGCAAGTGCT AATAAATATT TATTTACACC TTCTAAAATA AAATCTACAT TAGTTCCAGT      5460
     TAATGCTATA TTATTTGTAA GTGCTTTTTT ATATGTTGAT GTGTTTATGT GTTGCTCTTT      5520
     AATAAATATT AACTCTATAC CCTTATTAAA TAATTCTTCA TATAGCTTAA ATCCTTCTTC      5580
     ACTATTCCTA CTCATACGAC TTACACTATC AAATACAATC ATATCACCTT TTTTAATTTG      5640
     CTTTAATAAC TTGTTAAACT CTTTACGCTC ATAAATCTTA GTACCTGTAA ACACTTCATT      5700
     TATTATTATT GCACTTGGAT ATAATGCTAA TATATTTCTT TGCTGACGTT CTATGCTCTG      5760
     CTTATTTGTA CTTATTCTAC AATATCCATA AATCTTATTC ATGTTATCAC CTCATAATAC      5820
     ATTTATAGTA TCAAATCTTA CGACCGTTAC TTTTGATACT ATAAATATAT CATATTTTTT      5880
     ATATTAAGTC AATAGTTTTA ATACTATTTT TGTATACGTT ATTTTTGATA CTATTTTATA      5940
     ATATAAATAT TATTGTTTGA ATCATATTCT ATGTAAACTT TATAATAAAA ATAAATATCT      6000
     TTACTTTAAA CAATACGATT CTTATTTTTT GAAGTAATAA TTATTATAGT AACTTATATT      6060
     TAATAAATAG CTGACCCTTT TAATGGTTCT GGTTTCCTTA TTATAAATTG CATATAAATT      6120
     CAAATATATA TATATTGTGT AAAAATTAAT ATAAAAGTTA GATAAATTGC ATTAAATTAT      6180
     AAAATTACAT AAAAAGTATT AAAATAGTAA GTTAATAATA TGCAATACAC CTATTCTTTT      6240
     ATGTTTAACT TAAAATTAAC ATGTTATTAT ATAAATTATA GGAAATGAGG TGATACATAT      6300
     AAGAAAAAAA TATAGAAAAA AAATCCTTCA AGTACTCATT TAAAACCTAT TTTACAAATT      6360
     CCCCAACCTG TAAAATAAGG CATTGATGAA GGCTTGAAAG CTTTTTCAAA AAAATTACTT      6420
     GTTATATATT ATTTATATAT TATTTATCTA AATAAGGATT CTTTTGCCCT TATTTTTTAT      6480
     AATTTACACA TACTATATAT TTTAATCATA ATGTAACATA TTAAATATAT TCTATCAAAT      6540
     AGTAAATATT TTAATTTAAA GTAAGTTTAT TGGTTAATAT AAAGCTACGT TTATATTAAC      6600
     TTACATTTTA ACATTTGTAT ACTTATAATT GATATAAATA TTCTAAGAAA ACCAATAAAT      6660
     ATAAATATCT CTAGTGACAT AGTATTTATT ATTATTTGCT TAAATATTCT TAGTTAATTG      6720
     AGTGGCTATG TTACTCTTAG AGCTGTAGTA TACAACTCTT TATCCTGCAA TATCTAAAAT      6780
     ATTATTAATT ACTCCATATT TCATTTTATT TTCTAAAAAA TGAATATCTA ATTTATTATA      6840
     AATAAAAAGT CATAGGAAAA ACTATGACTT TATCTTTGCA TTTGAAAGTA AAGACAGGTG      6900
     GTAATCTGTA TCTCCTACCG CTTAATACGT GGTGGCGGCT ACCTGTTCCG CCCTCAATTA      6960
     CTTTCATTAA TATTCTATGT TATTTATATC TTTATTATAT CCAATAAATA ATATTATTAC      7020
     AACTACTATT TATAAACTTT AAATGCATCT TTAAAAAAAA GAAGAAAATA TAGAGTTGGA      7080
     AGACATACTA GAATTACTAT CTGAAGACAT TTCCGAAAGA GTTAAAAATA AAATAAAAGA      7140
     ATTATAATAA TGCATTATTT TAGTTTTTAT ATCATATATA TATTTAATAT ATTAATATTA      7200
     TTTAATAGGA GGATGTTTTA TGGAAAAACA ATCTTTAAGT TACGGTAATG ACAATGTTCA      7260
     AACTTCCATT ATTGGTGGTG ATAATGAAAG TGTACAATTA AGTACTTCTA ATGGTAAAAG      7320
     TATTGCTAGT ACTACTAAAG ATGGTGTTAA AACTTACACC TCAAGTAAAA TCATTTCTAG      7380
     TAATGGGTTT AAAATTTCAC TTGAAGGAAC ATTTATTGAT GATCCAAAAG ATGATAAGTT      7440
     AACACTGTTA TTGTCTACAG ATGGTTCTTT TATGCCATCC GGTATGGAAA AAACAGGAGA      7500
     TTATTGGTCA GGACAAATGA TATGGCCTTC AACATTTCAA TTAAGAATGG GTTTATCAGA      7560
     AAACAAGTTC AAAAAAACAG CTATTCTAAA GGTAGCACCT ATAAATTCAA TAGAAACTAT      7620
     AGATGTATCA GAAACAATGG GATATTCTGT GGGAGGTTCA ATAGAAGTAA CAGGATCAAG      7680
     TACTGGAGGT TCTGGAGGAA GCAGTGGAAA CGCAAATTAT AGTGTTTCAA AAACTATATC      7740
     CTATAAACAA CCAGATTATC AAACTATATT AAAAACAAAT GATAGTTTAG ATGTATTATG      7800
     GAATATAACG TATAATAGAA ATAAAGAAGG TTATGACAGA GATAGCTGGA ATACTTTATA      7860
     TGGAAATCAA TTGTTCATGA GAAGCAGAAA TTCTAATACA GGAATTGAAA ATTTAACTTT      7920
     GAATAATGAT TTATCATCAC TAATAACAGG AGGATTTTCA CCTAAAGGAA TAATAGCTAT      7980
     AAAAACAGGA CGAGAGCATA TTAGTGGTAC AAGTAATACA GACCTACTAA CAGTTAAATT      8040
     AACAAGAATT ATGGATAAAT ATGATTTAAT TTGGGCAACT AGTCATTGGA AAGGTATAAA      8100
     TACTAAAGAT TATACAAACA AATTTCTTTC TTCAAGCATT TGGATAGATT GGACAAATTA      8160
     TAGGTTATCT TAATCTTTCA TGTTAGTATT TTTTATTATT TTTAAAAAAT ACTAACGTGA      8220
     AAGATATAAT TAGTCAAAAA AACAATGATT ATAATTACTG TTTTTATAGT CGTTGTTTTT      8280
     TTGTGTTATT GACAGAAAAA TAGATGTTCT TTAAATTTAG TCAAATTATT TTTAGCTATA      8340
     TAGTAAGGCT TAAGAAAAAA TTTATAAAAA CCCCTTGTCA ATTCATTGAG TAAATTTTTA      8400
     TAAATAGTTG CTCAAAACTT TTAAGATTTA AATCAAACGT TTCTATAACT TGTTTAGTTA      8460
     AATGTCCAAC TGTTTTATGC TTTTTCATCT AAATATATTC TCCTTATTAT CTCTTAAATT      8520
     CGTATCTATC TAAATACTTT ATATCATAAA AAAGGTAATT ATTCTTTTCT TCAAACTTAA      8580
     CTTAAATATT TTATATTCTT TCAAGTTCGG ATTTAAATCC CGAACAAAAA TAACTCTACT      8640
     AATATATCCT TTGTATCCTT CTACTAATAC ATAATCTTAT TATTAATTAT CTTATAGCAA      8700
     ATATTTATTT TAGTATATAT CTATATTAAT TCTATCTTTT CCCTTAGTTC CTTTTGTGTT      8760
     TGTCTTGTAT ATATCCTGGT TGTATTTAAA TCTTCATGTC CTGCTAAATC TGCTATAACT      8820
     TCGATTCCTA CATTTTGGAT TGCTAACGCT TTACAAAATG AATGACGTAA AGCATGGGGG      8880
     TGTGCTTTTC CTTTTGTTAT TCTCGCTTGT ACTGCATATT TTTTTATAAT TCTATTTATA      8940
     TTATGCCTAT GCATCTCCCC ATTTGTCCCT ACAAATAGTT TATCTGTTTC TACTGGCTTT      9000
     CTAACTTTTA AATATTGTAG CCATATTTCT TTTAACTCTT TAGGAACTAT TATATATCTG      9060
     TATTTACCCC CTTTTCCTTC TATTTCTATT GACTTTTTCC TTATATCTCG TATTCTTAAT      9120
     TGTAATAATT CCGAAACTCT TAATCCTGTT TTATATAAGG TCATTATTAT TGCTTTATCT      9180
     CTTATATTAG TTCCACATTT ATTTAACATT TTTTCTATTT CATCTCTTGT CAATACATCA      9240
     TCAAGAAACG TTTGCTTTTG CTCTTTCATT CTTTTACATT TAACACCATA ATTAATATTA      9300
     ATAGATTTAA ATAATTGATT AATAGAAGTC AATTTCCTAT TAATTGACTT TGCTTTCAAT      9360
     CCCTCTCTAA ATAAATATTT TTTATATGAT TCTATATCGC TAGATGTTAA TGTATTAATT      9420
     TCTTTTTCTT TAAAATCTAA ATACTTTAAA AACTGTCTTA AATCTATTAA ATAATTTTCT      9480
     ATTGTTTTAA ATCTTTTATC TTTTTCTATG CTAAATATTA TAAAACCTTT TAATATATCT      9540
     TGATGTTCTA AGCATACTTT TTTTAATATT TTTACATATA CTTCTATTTC TTCATTATTA      9600
     ACACCAATAT TTATTAATTT ATTTTTAAAA TCCTTCGTTT TTAATACCTC CTATATTATT      9660
     TTATATACAA ACGTGAATTA CACTTTTATT TATATTATAA ATACATATGT TCTAATATTC      9720
     ATGGTACCTG CATTACATAA AAATCGTATA TTTTATACAC TTTGCGTTTA TAACTAATTT      9780
     TAATAAATTA TAGTTTCTTA CAGCTTCATG TCTTATATTA AATGTTTTAA TAATACTACC      9840
     TATACCCATT GATATTACTA TGTTTAATTT ATATTTATTT TTTAATATAA TTGATGGTAA      9900
     AATATTCATA ATATGTAAAA TCAATAACCG ATTTTTAGTA TATTATAATA TCA             9953
//

If you have problems or comments...

PBIL Back to PBIL home page