(data stored in ACNUC7421 zone)

HOGENOMDNA: CLOBL_2

ID   CLOBL_2; SV 1; empty ; DNA; empty ; PRO; 17531 BP.
XX
AC   NC_009700;
XX
PR   Project: 58929;
XX
DE   Clostridium botulinum F str. Langeland plasmid pCLI, complete sequence.
XX
OS   Clostridium botulinum F str. Langeland
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Clostridiaceae;
OC   Clostridium.
XX
RN   [1]
RP   1-17531
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (26-JUL-2007) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [2]
RP   1-17531
RA   Brinkac,L.M., Daugherty,S., Dodson,R.J., Madupu,R., Brown,J.L., Bruce,D.,
RA   Detter,C., Munk,C., Smith,L.A., Smith,T.J., White,O. and Brettin,T.S.;
RT   "Direct Submission";
RL   Submitted (15-JUN-2007) Los Alamos National Laboratory, Los Alamos, NM,
RL   USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence was derived from CP000729.
CC   The authors wish to acknowledge the Intelligence Technology
CC   Innovation Center for funding the sequencing and the NIH/NIAID for
CC   funding the annotation at the Pathema Bioinformatics Resource
CC   Center. For more information about this strain contact Theresa
CC   Smith, Integrated Toxicology, United States Army Medical Institute
CC   of Infectious Diseases, theresa.smith@amedd.army.mil.
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..17531
FT                   /strain="Langeland"
FT                   /mol_type="genomic DNA"
FT                   /organism="Clostridium botulinum F str. Langeland"
FT                   /plasmid="pCLI"
FT                   /db_xref="taxon:441772"
FT   gene            64..240
FT                   /db_xref="GeneID:5405669"
FT                   /locus_tag="CLI_A0001"
FT   CDS_pept        64..240
FT                   /locus_tag="CLI_A0001"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="GI:153941553"
FT                   /db_xref="GeneID:5405669"
FT                   /translation="MQDLNLQSLEKINAGDVTWRDVAVAGGGLLGGTFGGALGAAGGGL
FT                   AGGALYDALTKKH"
FT                   /protein_id="YP_001393005.1"
FT   gene            268..468
FT                   /db_xref="GeneID:5405676"
FT                   /locus_tag="CLI_A0002"
FT   CDS_pept        268..468
FT                   /locus_tag="CLI_A0002"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="GI:153941557"
FT                   /db_xref="GeneID:5405676"
FT                   /translation="MKDLNLQNLEQINAGGVGGAIAGAVIGAAVGAVGGVVLGHGSSEG
FT                   AVGGWIGGAGVGAKIGMMSPI"
FT                   /protein_id="YP_001393006.1"
FT   gene            528..896
FT                   /db_xref="GeneID:5405680"
FT                   /locus_tag="CLI_A0003"
FT   CDS_pept        528..896
FT                   /locus_tag="CLI_A0003"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="GI:153941554"
FT                   /db_xref="GeneID:5405680"
FT                   /translation="MFKNKLIYDSLTSSLFVFIFYLLAHLATDVPTKLSPTLILIFLFL
FT                   IELLVNLFVKKINYKISKSIYVLIYGCISFGLSMFLILFDFINIPIFIAFILLILSGAV
FT                   FALSFYTFRSKYCHKRNS"
FT                   /protein_id="YP_001393007.1"
FT   gene            complement(1172..1348)
FT                   /db_xref="GeneID:5405677"
FT                   /locus_tag="CLI_A0004"
FT   CDS_pept        complement(1172..1348)
FT                   /locus_tag="CLI_A0004"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="GI:153941563"
FT                   /db_xref="GeneID:5405677"
FT                   /translation="MCIKQHDYKDCGATCFANIYKQYDLRYPILKTREVAGTDKESTSI
FT                   VGVIKVEKEVLRI"
FT                   /protein_id="YP_001393008.1"
FT   misc_feature    complement(<1184..1345)
FT                   /note="Peptidase family C39 mostly contains
FT                   bacteriocin-processing endopeptidases from bacteria. The
FT                   cysteine peptidases in family C39 cleave the
FT                   'double-glycine' leader peptides from the precursors of
FT                   various bacteriocins (mostly non-lantibiotic). The...;
FT                   Region: Peptidase_C39_like; cl00296"
FT                   /db_xref="CDD:163763"
FT                   /locus_tag="CLI_A0004"
FT   misc_feature    complement(order(1316..1318,1334..1336))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:30269"
FT                   /locus_tag="CLI_A0004"
FT   gene            1537..1701
FT                   /db_xref="GeneID:5405686"
FT                   /locus_tag="CLI_A0005"
FT   CDS_pept        1537..1701
FT                   /locus_tag="CLI_A0005"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="GI:153941569"
FT                   /db_xref="GeneID:5405686"
FT                   /translation="MENVEKMDLSELEEINGGISCANCARACVTAGAVAYGAGYASGEF
FT                   WYNITHPFN"
FT                   /protein_id="YP_001393009.1"
FT   gene            1721..1897
FT                   /db_xref="GeneID:5405691"
FT                   /locus_tag="CLI_A0006"
FT   CDS_pept        1721..1897
FT                   /locus_tag="CLI_A0006"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="GI:153941552"
FT                   /db_xref="GeneID:5405691"
FT                   /translation="MENLNLLNIDEKDLLAINGGRPSGMGDMSGAHCAALWLGSVVVGY
FT                   TTGFYNGYRNAGR"
FT                   /protein_id="YP_001393010.1"
FT   gene            complement(1965..2381)
FT                   /db_xref="GeneID:5405675"
FT                   /locus_tag="CLI_A0007"
FT   CDS_pept        complement(1965..2381)
FT                   /locus_tag="CLI_A0007"
FT                   /gene_family="HOG000277115" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="GI:153941566"
FT                   /db_xref="GeneID:5405675"
FT                   /translation="MKNNKLIDIFEEETYIENDERIHKIYNKIYKEKYTIIFLALLAFY
FT                   LYELIILQKNDTPLIFVIILDNIYTDIKLAMNKAYIKTNLQYVETCGELLLLLRYFKYK
FT                   FLMNINFMIIIIISFVIGYLYIKLMLYINNKSKI"
FT                   /protein_id="YP_001393011.1"
FT   gene            complement(2384..2578)
FT                   /db_xref="GeneID:5405689"
FT                   /locus_tag="CLI_A0008"
FT   CDS_pept        complement(2384..2578)
FT                   /locus_tag="CLI_A0008"
FT                   /gene_family="HOG000225389" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="GI:153941561"
FT                   /db_xref="GeneID:5405689"
FT                   /translation="MGNRKMKIARVECDLSQQQLAEKVGITRQTISMIEAGKYNPSLKL
FT                   CIGICKVLNKTLNDLFWED"
FT                   /protein_id="YP_001393012.1"
FT   misc_feature    complement(2399..2569)
FT                   /note="Helix-turn-helix XRE-family like proteins.
FT                   Prokaryotic DNA binding proteins belonging to the
FT                   xenobiotic response element family of transcriptional
FT                   regulators; Region: HTH_XRE; cd00093"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="CLI_A0008"
FT   misc_feature    complement(order(2471..2473,2546..2548,2558..2560))
FT                   /note="non-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="CLI_A0008"
FT   misc_feature    complement(order(2474..2476,2549..2551))
FT                   /note="salt bridge; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="CLI_A0008"
FT   misc_feature    complement(order(2468..2473,2483..2485,2492..2494,
FT                   2525..2530))
FT                   /note="sequence-specific DNA binding site; other site"
FT                   /db_xref="CDD:28977"
FT                   /locus_tag="CLI_A0008"
FT   gene            2904..3479
FT                   /db_xref="GeneID:5405684"
FT                   /locus_tag="CLI_A0009"
FT   CDS_pept        2904..3479
FT                   /locus_tag="CLI_A0009"
FT                   /gene_family="HOG000290933" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="phage integrase"
FT                   /transl_table="11"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="GI:153941565"
FT                   /db_xref="GeneID:5405684"
FT                   /translation="MNNVEPIRDKTKIQDVKLYLKGKNLRSYTMFIVGINVALRITDLL
FT                   SLKWGDVLKENKKTFKDIEIYEGKTKKHRKIKLNKSAGKALKELMESLPYINMNDFIFK
FT                   SREGENKAITRQQALNILKEAAKSVGVEENIGTHSLRKTWGYHAWKAGFNPAIIMETLN
FT                   HSNLAMTKRYLGIRQDDVNELYTKLNID"
FT                   /protein_id="YP_001393013.1"
FT   misc_feature    2907..3473
FT                   /note="DNA breaking-rejoining enzymes, C-terminal catalytic
FT                   domain. The DNA breaking-rejoining enzyme superfamily
FT                   includes type IB topoisomerases and tyrosine recombinases
FT                   that share the same fold in their catalytic domain
FT                   containing six conserved active site...; Region: DNA_BRE_C;
FT                   cl00213"
FT                   /db_xref="CDD:174037"
FT                   /locus_tag="CLI_A0009"
FT   misc_feature    order(3021..3026,3108..3110,3309..3317,3420..3422)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="CLI_A0009"
FT   misc_feature    order(3021..3023,3108..3110,3315..3317,3324..3326,
FT                   3393..3395,3420..3422)
FT                   /note="Int/Topo IB signature motif; other site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="CLI_A0009"
FT   misc_feature    order(3021..3023,3315..3317,3324..3326,3393..3395,
FT                   3420..3422)
FT                   /note="active site"
FT                   /db_xref="CDD:29495"
FT                   /locus_tag="CLI_A0009"
FT   gene            3911..4087
FT                   /db_xref="GeneID:5405688"
FT                   /locus_tag="CLI_A0010"
FT   CDS_pept        3911..4087
FT                   /locus_tag="CLI_A0010"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="GI:153941556"
FT                   /db_xref="GeneID:5405688"
FT                   /translation="MLNYPYTIQWLKWATGIAIPVRREVIHMYEIFIVVFTALSFLVAL
FT                   INLIIILIDKIKR"
FT                   /protein_id="YP_001393014.1"
FT   gene            4527..5339
FT                   /db_xref="GeneID:5405679"
FT                   /locus_tag="CLI_A0011"
FT   CDS_pept        4527..5339
FT                   /locus_tag="CLI_A0011"
FT                   /gene_family="HOG000002027" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="caax amino protease family protein"
FT                   /transl_table="11"
FT                   /note="identified by match to protein family HMM PF02517"
FT                   /db_xref="GI:153941558"
FT                   /db_xref="GeneID:5405679"
FT                   /translation="MKKYLKMIRNIVFFSGLNIVINFIVGFIYSIMNFAIYKTKSLESF
FT                   QQSMMENVYIITALSSAITFIIYLLVLKNKNENLWQRCNFKKITLSHIYYSILIAISLS
FT                   VFTCPIISLISEKFESYKQVSDSISAAYGSILSMLCIVILIPIFEEILFRGLIFNELKK
FT                   NTNIILAVILQSLIFALFHGNILQGMYAFILGIILCILYLKTGSIWSNILCHIIYNLFG
FT                   SLLMPLALSYTKNYTFVYIGAGLIATAILLISMFKKQTNSINSSNIKG"
FT                   /protein_id="YP_001393015.1"
FT   misc_feature    4932..5204
FT                   /note="CAAX amino terminal protease family; Region: Abi;
FT                   cl00558"
FT                   /db_xref="CDD:163875"
FT                   /locus_tag="CLI_A0011"
FT   gene            complement(5606..6619)
FT                   /db_xref="GeneID:5405681"
FT                   /locus_tag="CLI_A0012"
FT   CDS_pept        complement(5606..6619)
FT                   /locus_tag="CLI_A0012"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="RepB family protein"
FT                   /transl_table="11"
FT                   /note="identified by match to protein family HMM PF01051"
FT                   /db_xref="GI:153941548"
FT                   /db_xref="GeneID:5405681"
FT                   /translation="MKNHIESAKNNWIYQSNKLIEASYTLTVIEQKLIRLLASMIKKDD
FT                   TDFKEYKFKTKDLIKILNTSDSRFYRDIDNITDLLMQRIIKIKDISNGEFEKYHWVDVA
FT                   KYKKGVLILKINKDLKPFYLSLDWYTKYQFKNIMQFKSTYSFRMYELLKQYEKIGHRII
FT                   TINEIRSMLDIKKNKYPKYANLKQKVIKVSINEINTNTDLFIDYEEVKESRKITSIKFY
FT                   IKSKVQDKARNEIVVSLEDKESDYINEVKSILDEEITNLQAKQIYDSAKGNIDLIKEKY
FT                   SIAKESNNIKSIVAFMVSALKEDYKGPISKVDRFNNFEQRNYDFEQLESQLLGWGK"
FT                   /protein_id="YP_001393016.1"
FT   misc_feature    complement(5951..6595)
FT                   /note="Initiator Replication protein; Region: Rep_3;
FT                   cl03080"
FT                   /db_xref="CDD:174750"
FT                   /locus_tag="CLI_A0012"
FT   misc_feature    complement(5615..6577)
FT                   /note="Protein involved in initiation of plasmid
FT                   replication [DNA replication, recombination, and repair];
FT                   Region: COG5527"
FT                   /db_xref="CDD:35086"
FT                   /locus_tag="CLI_A0012"
FT   gene            complement(6817..6936)
FT                   /db_xref="GeneID:5405671"
FT                   /locus_tag="CLI_A0013"
FT   CDS_pept        complement(6817..6936)
FT                   /locus_tag="CLI_A0013"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="GI:153941550"
FT                   /db_xref="GeneID:5405671"
FT                   /translation="MFYNYSFNSFTQGSRLAISMLKNFKDNLLIVKDNLLIVK"
FT                   /protein_id="YP_001393017.1"
FT   gene            7202..7732
FT                   /db_xref="GeneID:5405673"
FT                   /locus_tag="CLI_A0014"
FT   CDS_pept        7202..7732
FT                   /locus_tag="CLI_A0014"
FT                   /gene_family="HOG000277107" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="sigma-70 family RNA polymerase sigma factor"
FT                   /transl_table="11"
FT                   /note="identified by match to protein family HMM TIGR02937"
FT                   /db_xref="GI:153941551"
FT                   /db_xref="GeneID:5405673"
FT                   /translation="MYQLVKGYKAGEEALLKDIIDKFVPIILKEAAKYKIKCYDYEDLV
FT                   QHGYLSVIKAVNMYKGDGDSFKYYCIKAIKQNYRALLKGEIKHHREIPEEKDIYFYKFT
FT                   LEDEILAYEKTKELYRALDNLNKYERAIIESFYLKNKTMESIAKENKKSYNNIRYEKDK
FT                   IIKKLQKKLINHI"
FT                   /protein_id="YP_001393018.1"
FT   misc_feature    7247..7675
FT                   /note="RNA polymerase sigma factor, sigma-70 family;
FT                   Region: sigma70-ECF; TIGR02937"
FT                   /db_xref="CDD:163078"
FT                   /locus_tag="CLI_A0014"
FT   gene            complement(8465..9109)
FT                   /db_xref="GeneID:5405674"
FT                   /locus_tag="CLI_A0015"
FT   CDS_pept        complement(8465..9109)
FT                   /locus_tag="CLI_A0015"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative phosphoglycerate mutase family protein"
FT                   /transl_table="11"
FT                   /note="identified by match to protein family HMM PF00300"
FT                   /db_xref="GI:153941560"
FT                   /db_xref="GeneID:5405674"
FT                   /translation="MAQFYLIMPGQTDYKTCYKKDLAPLSIKGISQALSMALDSRLKRA
FT                   DIIVSSSHTKATQTASIISQKTNINMIVDMDLEEYNTFDNLLELIDDFNYHNDNYSIEE
FT                   IIRWEELKSLRTSVKSENRNIGIKTEMGLEESTFEEFLELTEDYNYPSEETEQWEEFNS
FT                   LRNKVKNVADKYAHYNKVIIVCNEIVIRMLTHTEKIVPGEIIECCYEIEKN"
FT                   /protein_id="YP_001393019.1"
FT   misc_feature    complement(<8531..9109)
FT                   /note="Histidine phosphatase domain found in a functionally
FT                   diverse set of proteins, mostly phosphatases; contains a
FT                   His residue which is phosphorylated during the reaction;
FT                   Region: HP; cl11399"
FT                   /db_xref="CDD:175238"
FT                   /locus_tag="CLI_A0015"
FT   gene            9455..9676
FT                   /db_xref="GeneID:5405683"
FT                   /locus_tag="CLI_A0016"
FT   CDS_pept        9455..9676
FT                   /locus_tag="CLI_A0016"
FT                   /gene_family="HOG000099464" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="identified by similarity to GB:AAK76916.1"
FT                   /db_xref="GI:153941559"
FT                   /db_xref="GeneID:5405683"
FT                   /translation="MAVSKNMLEKNLVLEYQDGLDEKGKAIMKGATYKNVKLTADPEAL
FT                   MMVVDAINPLMPEGISEARVVENYVLLK"
FT                   /protein_id="YP_001393020.1"
FT   misc_feature    9467..9607
FT                   /note="Protein of unknown function (DUF1659); Region:
FT                   DUF1659; pfam07872"
FT                   /db_xref="CDD:149118"
FT                   /locus_tag="CLI_A0016"
FT   gene            9696..9923
FT                   /db_xref="GeneID:5405682"
FT                   /locus_tag="CLI_A0017"
FT   CDS_pept        9696..9923
FT                   /locus_tag="CLI_A0017"
FT                   /gene_family="HOG000060671" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:153941549"
FT                   /db_xref="GeneID:5405682"
FT                   /translation="MNITKYLNLVFKTTEDSTSTIKIPKVKEDVTEEEIKNCGKSIVDQ
FT                   NIFQTKNGDLSALKVARIITTETEEIKIEK"
FT                   /protein_id="YP_001393021.1"
FT   misc_feature    9708..9881
FT                   /note="Protein of unknown function (DUF2922); Region:
FT                   DUF2922; pfam11148"
FT                   /db_xref="CDD:151591"
FT                   /locus_tag="CLI_A0017"
FT   gene            complement(9995..10222)
FT                   /db_xref="GeneID:5405672"
FT                   /locus_tag="CLI_A0018"
FT   CDS_pept        complement(9995..10222)
FT                   /locus_tag="CLI_A0018"
FT                   /gene_family="HOG000002028" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:153941568"
FT                   /db_xref="GeneID:5405672"
FT                   /translation="MTLPKITQDNVHIFIPLKASKVSQRFAKNHGISQKQALLEFYNSK
FT                   TYATLEEEDTKLWYEGINYLYDELESEKNM"
FT                   /protein_id="YP_001393022.1"
FT   gene            complement(10224..10709)
FT                   /db_xref="GeneID:5405690"
FT                   /locus_tag="CLI_A0019"
FT   CDS_pept        complement(10224..10709)
FT                   /locus_tag="CLI_A0019"
FT                   /gene_family="HOG000060483" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="identified by similarity to GB:CAH05747.1"
FT                   /db_xref="GI:153941570"
FT                   /db_xref="GeneID:5405690"
FT                   /translation="MILYHGSNVIVEDPKIIKATRTLDFGYGFYTTTSYDQALKWAKIK
FT                   SRRENVEKGIIGIYEIEDTIFQEDRLNIKVFNGASKSWLKFVLDNRMNEGYTHNYDIVK
FT                   GSVADDRVYACLNAFENKFMDFDTAIKELRTYKLNDQISFHTKESLKYLNFIKYEEV"
FT                   /protein_id="YP_001393023.1"
FT   gene            complement(10706..10930)
FT                   /db_xref="GeneID:5405692"
FT                   /locus_tag="CLI_A0020"
FT   CDS_pept        complement(10706..10930)
FT                   /locus_tag="CLI_A0020"
FT                   /gene_family="HOG000285503" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:153941547"
FT                   /db_xref="GeneID:5405692"
FT                   /translation="MNLTRDEKVFEFISFCIENFKVKFKMKGKEVANLFYESGVTDFLI
FT                   ESYDLLHTQGNDYILSEIEIFLKNRGYKL"
FT                   /protein_id="YP_001393024.1"
FT   gene            complement(11158..12549)
FT                   /db_xref="GeneID:5405670"
FT                   /locus_tag="CLI_A0021"
FT   CDS_pept        complement(11158..12549)
FT                   /locus_tag="CLI_A0021"
FT                   /gene_family="HOG000002029" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="replication protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:153941562"
FT                   /db_xref="GeneID:5405670"
FT                   /translation="MQSVKQLSIDDYTYNVLRNLPTIEVSLKALIKNVSKAQNQIELLH
FT                   EKDDGFITIAVKKQNKWMQYHYSKDELKDNIGKILSIEGINVYLSANSFYKPFRRIENI
FT                   RKLNSLYIDLDYYSLKNFKNLTTDQIIWQLECDYFREKVPEANFIILTGRGIAIYWLIE
FT                   PVPYKALPLWNAVQKHFLKELKDIGADEKSIDSSRVMRLAGSINQKSGKNADILVYSED
FT                   RYILREIQEEYLPELTPYVKNPYYKSKGRNPKIVNFFTLYSLHYARLRDIVTLQKIREG
FT                   YCKNKEGSLVKSGQREFMCFLYRYWSCCYEANKEKALENTIDFNKEFKVPLEYKEVERA
FT                   TRSAEKAYEAWFKDSPSGTYKRGGYNYKNETLIEKLNITDEEMKTLETIIGKKEVKRRD
FT                   NQKNKIRQKAKRRNEKGLTKRQQEKLNKENKIKELLSKGFGVREISRKLDINVSAVSRV
FT                   KNNKY"
FT                   /protein_id="YP_001393025.1"
FT   gene            complement(12781..13545)
FT                   /db_xref="GeneID:5405685"
FT                   /locus_tag="CLI_A0022"
FT   CDS_pept        complement(12781..13545)
FT                   /locus_tag="CLI_A0022"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="identified by Glimmer3; putative"
FT                   /db_xref="GI:153941555"
FT                   /db_xref="GeneID:5405685"
FT                   /translation="MQLEELIYIAKTINEKGLKGNKRDNFLRYKYNMSARTWQKKIKDT
FT                   PIKYNNATKKYDINIESNSKVTQNKHQDGLEGEIKIQHKETLKESKSNYDETLSSYQSN
FT                   SKEKLKSNTKETINKLDGNSKVTLNGLDNKESEFIEIKGIEEVLPKAPKVTTPLVLEEF
FT                   QNMKSDIEMIKDQINLLFEKYTEDEIRKENIIEVPKIDLENYELQGEIGSRSFKTYKYV
FT                   LDKFKDFCKKRNESQKDLIAIALLEFIQKYNR"
FT                   /protein_id="YP_001393026.1"
FT   gene            complement(13718..15148)
FT                   /db_xref="GeneID:5405678"
FT                   /locus_tag="CLI_A0023"
FT   CDS_pept        complement(13718..15148)
FT                   /locus_tag="CLI_A0023"
FT                   /gene_family="HOG000002030" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="putative bacteriocin ABC transporter,
FT                   bacteriocin-binding protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:153941564"
FT                   /db_xref="GeneID:5405678"
FT                   /translation="MKPVIQNIDEMKDSREILESKPHPFTTIFIYILLLIFFSAFIWCW
FT                   FAEKEIVVDVQGVVRPNENIHKVSNLLGSKVSSVNFKNGDKVEKGKVLYTLEHKELDVQ
FT                   KSSLDKSKKDLEKEISNLEKLKKSILDNKNYFTDSKDEKEYYNKYLNYEKSKKNPDNNK
FT                   KVVDSQIDNLNSKINNLNSLKKSAQNNTNDLNSGTSYYSQFKDYKINVEGYEKNIKALE
FT                   DSYNSLKNKKAEEVLINDAKAKLESSRLELTKYKNQFTLNIENVIEECNDKIKDLNNQI
FT                   SSNDDAKEINEEKIKSSSLVEIDNSIKLNKEKLEEITTNLKVVDMNIDKCTIKAPIDGI
FT                   VDISTPIKTGDLVGEGQEVLNILPSESKYKIDLMILNKDIANIKRGTNIKYDFQSLPYK
FT                   EYGYLDGRLENISVDSKVDPKSGVSFYTGEASIDSKPLYSHKGEKAQIKSGMVCTAKII
FT                   TRKEKMLYYLLEKINLKD"
FT                   /protein_id="YP_001393027.1"
FT   misc_feature    complement(<14858..15022)
FT                   /note="type I secretion membrane fusion protein, HlyD
FT                   family; Region: type_I_hlyD; TIGR01843"
FT                   /db_xref="CDD:130902"
FT                   /locus_tag="CLI_A0023"
FT   misc_feature    complement(13733..>14491)
FT                   /note="type I secretion membrane fusion protein, HlyD
FT                   family; Region: type_I_hlyD; TIGR01843"
FT                   /db_xref="CDD:130902"
FT                   /locus_tag="CLI_A0023"
FT   gene            complement(15148..17370)
FT                   /db_xref="GeneID:5405687"
FT                   /locus_tag="CLI_A0024"
FT   CDS_pept        complement(15148..17370)
FT                   /locus_tag="CLI_A0024"
FT                   /gene_family="HOG000097319" [ FAMILY / ALN / TREE ]
FT                   /codon_start="1"
FT                   /product="ABC transporter CbaT"
FT                   /transl_table="11"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF00664; match to protein
FT                   family HMM PF03412; match to protein family HMM TIGR01193"
FT                   /db_xref="GI:153941567"
FT                   /db_xref="GeneID:5405687"
FT                   /translation="MRQFFNRYVCIKQHDHKDCGAACLATICKQYGLKYPISKIREVAG
FT                   TDKEGTSALGVIKAAEELGFTAKGVKASKPEDLFTEIPLPCIAHVVIDKTMLHYVVIHK
FT                   ITEKEIIIADPGRGIIKYNPQEFFEIWTGILLIMTPTVKFEKGNKEKGLFQRFFKLIKP
FT                   QKKLLVNIFLSSIIFTILGIIGAFYFKFILDDIIPNNLNKSLHMISIGIIVLTLFKVLL
FT                   GAFRTQLLIYLGQNMDIPLMLGYYEHVINLPMNFFGTREVGEIISRFNDASKIRDAISG
FT                   ATLTMMIDSLMVIIGGIFLYTSNSLLFGITVIPIVLYIIIVWAFNKPLEEVNRSVMEDN
FT                   AKLTSYLVESLNGVETIKAFNAEGEVNLETEKRFIFLIKSVFKNGFINNLHGSIKGSVK
FT                   SVFGVVILWVGTHQVLKGSMSIGQLISFNALLAYFLDPIENIINLQPQLQTAVVAGERL
FT                   GEILDLEIEKSMDEEKKIKPQSLLGNIEFKDVDFRYGTRKLILKDISMNIKPGEKIALV
FT                   GESGSGKTTLAKLLMNFYQCEKGEILINTYNIKDINIETLRDKIAYISQETFLFNGTIK
FT                   ENLSLGNPYITYEEIIEACKRAQIHDFINSLPLRYNTLVEENGSNFSGGQKQRLSIARA
FT                   ILKKPEILIMDEATSSLDSITERAIENTMNEFSEGITTIIIAHRLSTIRRCNTIYVLDK
FT                   GEIIEKGSHDELINIKGRYYNLWKDQLPFDDVNLEVAASKDKGGIK"
FT                   /protein_id="YP_001393028.1"
FT   misc_feature    complement(15211..17352)
FT                   /note="ABC-type bacteriocin/lantibiotic exporters, contain
FT                   an N-terminal double-glycine peptidase domain [Defense
FT                   mechanisms]; Region: SunT; COG2274"
FT                   /db_xref="CDD:32455"
FT                   /locus_tag="CLI_A0024"
FT   misc_feature    complement(16948..17349)
FT                   /note="A sub-family of peptidase family C39. Peptidase
FT                   family C39 mostly contains bacteriocin-processing
FT                   endopeptidases from bacteria. The cysteine peptidases in
FT                   family C39 cleave the 'double-glycine' leader peptides from
FT                   the precursors of various...; Region: Peptidase_C39B;
FT                   cd02418"
FT                   /db_xref="CDD:30271"
FT                   /locus_tag="CLI_A0024"
FT   misc_feature    complement(order(17029..17031,17077..17079,17314..17316,
FT                   17332..17334))
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:30271"
FT                   /locus_tag="CLI_A0024"
FT   misc_feature    complement(16057..16860)
FT                   /note="ABC transporter transmembrane region; Region:
FT                   ABC_membrane; cl00549"
FT                   /db_xref="CDD:174279"
FT                   /locus_tag="CLI_A0024"
FT   misc_feature    complement(15211..15918)
FT                   /note="MTABC3 (also known as ABCB6) is a mitochondrial
FT                   ATP-binding cassette protein involved in iron homeostasis
FT                   and one of four ABC transporters expressed in the
FT                   mitochondrial inner membrane, the other three being
FT                   MDL1(ABC7), MDL2, and ATM1.  In fact, the...; Region:
FT                   ABC_MTABC3_MDL1_MDL2; cd03249"
FT                   /db_xref="CDD:73008"
FT                   /locus_tag="CLI_A0024"
FT   misc_feature    complement(15796..15819)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73008"
FT                   /locus_tag="CLI_A0024"
FT   misc_feature    complement(order(15337..15339,15430..15435,15673..15675,
FT                   15793..15801,15805..15810))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73008"
FT                   /locus_tag="CLI_A0024"
FT   misc_feature    complement(15673..15684)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73008"
FT                   /locus_tag="CLI_A0024"
FT   misc_feature    complement(15478..15507)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73008"
FT                   /locus_tag="CLI_A0024"
FT   misc_feature    complement(15430..15447)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73008"
FT                   /locus_tag="CLI_A0024"
FT   misc_feature    complement(15412..15423)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73008"
FT                   /locus_tag="CLI_A0024"
FT   misc_feature    complement(15331..15351)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73008"
FT                   /locus_tag="CLI_A0024"
SQ   Sequence 17531 BP; 5952 A; 2554 C; 2019 G; 7006 T; 0 other;
     GAATAGGTTA AAAATACTTC TTAAGAGTCT ATATTTGTAT TTTATTTGAA GGGGGATATC        60
     ATAATGCAAG ATTTAAATTT ACAAAGTTTG GAAAAAATAA ATGCTGGAGA CGTAACTTGG       120
     AGAGATGTCG CTGTTGCTGG TGGTGGACTT CTAGGCGGAA CATTTGGCGG AGCTTTAGGA       180
     GCTGCTGGTG GTGGACTTGC TGGTGGAGCT CTATATGATG CTCTAACAAA AAAACATTAG       240
     TTTATATATT TAAAGGAGGT TTTCATAATG AAAGATTTAA ACTTACAAAA TTTAGAACAA       300
     ATTAATGCTG GTGGAGTAGG TGGTGCCATT GCTGGTGCTG TAATAGGCGC TGCTGTTGGA       360
     GCTGTTGGTG GTGTTGTATT AGGTCACGGA AGCAGCGAGG GAGCTGTTGG TGGTTGGATT       420
     GGTGGTGCCG GTGTTGGTGC TAAAATTGGT ATGATGTCTC CAATTTAACA ATAATCAAAG       480
     CAGGGATTTA TTTCTCTGCT TTTACTTAAA TAAAGGAGGT ATTTTTTATG TTTAAAAATA       540
     AGCTTATATA TGATAGCTTA ACTTCAAGTC TATTTGTTTT TATATTTTAT CTTCTAGCTC       600
     ACTTAGCAAC AGATGTTCCT ACTAAATTGA GTCCTACCCT AATTTTAATA TTTCTTTTTT       660
     TGATAGAATT ATTAGTTAAT TTATTTGTAA AAAAAATAAA TTATAAAATA TCTAAATCAA       720
     TTTATGTATT AATTTATGGA TGTATTTCAT TTGGACTATC TATGTTTTTA ATACTATTCG       780
     ATTTTATTAA TATTCCTATT TTTATAGCAT TTATACTGCT TATTTTAAGT GGAGCTGTAT       840
     TTGCACTATC TTTTTATACT TTTAGAAGTA AATATTGTCA TAAAAGAAAT TCTTAAATTA       900
     ATACAATAGC TTCAAAAAGC CAGTTCTATA ACTAACCTGG CTTTTTTCAA TTCTTTTAAT       960
     AACGAAAAAT ATGATGCCAT TTACTATTTA GTAACTGGCA AGTTGACTAT GTCAACTATA      1020
     TTTCTATCGA AAAGAATCTA AAAAAAGTAG TATCATTTTA AAATCTTTTT TCACTCTATC      1080
     TATACTATAT TTTATCTATC TTGTAAAATT ATGATATGAA TAAGTTATGC CAATACTTCG      1140
     CCGTATTTTT CTCCTGGTTT TATATTCATA TTCATATCCT TAATACTTCC TTTTCAACCT      1200
     TAATTACTCC AACAATACTT GTACTCTCTT TATCTGTGCC TGCAACCTCT CTTGTTTTTA      1260
     AAATTGGATA TCTTAAGTCA TATTGTTTGT ATATATTTGC AAAACAAGTA GCACCACAAT      1320
     CTTTATAATC ATGCTGTTTT ATACACACAT ATCTATTAAA AAATATCTCA TTTGACACCT      1380
     CAGCTACACA TTTATGTCCA ACATGTGCAT AATATATAAA TACCATACAG TTAAATAATT      1440
     TTTACTTTAT AATCTAAAAA AGTTGAATTA TACCGTTTTT ATTGTTATAA TTATAACATG      1500
     AATTTTTTCA AAAAAATAGA ATAAGGGGGA ATCTTTATGG AAAATGTAGA AAAAATGGAT      1560
     TTAAGCGAAT TAGAAGAAAT AAATGGTGGT ATTAGTTGTG CTAACTGCGC TAGAGCTTGT      1620
     GTTACAGCTG GTGCTGTAGC TTATGGAGCT GGTTATGCAT CTGGCGAATT TTGGTATAAT      1680
     ATAACACATC CATTTAATTA ATTCTTAGGA GGTAAAAAAT ATGGAAAACC TAAATTTATT      1740
     AAATATTGAT GAAAAGGATT TATTAGCTAT AAATGGCGGA AGACCATCTG GTATGGGAGA      1800
     CATGAGTGGT GCTCATTGTG CTGCGCTATG GCTTGGTAGC GTTGTTGTTG GCTATACAAC      1860
     AGGATTTTAT AATGGATATA GAAATGCTGG CAGATAATAA ACATTAGAAT ATAATGAGCT      1920
     TAAAAAATAA TTATTTTTTT AAGCTCATTA TATTTTAGTA AAATCTATAT TTTAGATTTA      1980
     TTATTTATAT ATAACATTAA TTTTATATAT AAATAACCTA TTACGAAGGA AATAATGATA      2040
     ATTATCATGA AATTTATATT CATTAAAAAT TTATATTTAA AATATCTTAA TAATAATAGT      2100
     AATTCACCAC AAGTCTCTAC ATATTGTAAA TTAGTTTTTA TATATGCTTT ATTCATTGCT      2160
     AGTTTAATAT CAGTATAGAT ATTATCTAAA ATAATAACAA ATATTAAAGG TGTATCATTT      2220
     TTTTGTAATA TTATAAGTTC ATATAAATAA AATGCAAGTA GAGCTAAAAA AATAATAGTA      2280
     TATTTTTCTT TATATATTTT ATTATATATT TTATGTATTC TTTCATCATT TTCAATATAA      2340
     GTTTCTTCCT CAAAAATATC TATAAGTTTA TTATTTTTCA TAATTAATCC TCCCAAAATA      2400
     AATCATTTAA TGTCTTATTA AGTACCTTAC ATATTCCTAT ACATAGTTTA AGAGATGGAT      2460
     TATACTTTCC TGCTTCTATC ATACTAATGG TTTGCCTTGT TATCCCTACT TTTTCAGCAA      2520
     GCTGTTGCTG AGAAAGATCA CATTCTACTC TAGCTATTTT CATTTTTCTA TTACCCAATT      2580
     TTTGCCTCCT AAATTATTTT ATTTGATATT TGGTAATCTT ATATATTTAT ATATATATTA      2640
     CTTATAATAA TATATATTTG TCTTTATGTC AATTAAAATT TACATAAAGA CAAATAACAC      2700
     TATTTTTATA CTGCTCTAAT TCAAATATAA GCATTAATTT GCCTTAATAT AGTTTTTGAC      2760
     AAACTCATAA AATAGGCTCT ATCAATTGGT ATAACTAAAT TTGATGGAAT TATAGTGAGT      2820
     AAAATTTTTA TTTTTTCCTT TTCAGTTTGT CATAACTGTT ATTATAATAT TATTATAATA      2880
     AACTTAACTA AGGAGGAAAA TTTATGAATA ACGTAGAGCC TATTAGAGAT AAAACTAAGA      2940
     TTCAAGATGT TAAACTTTAT CTTAAAGGAA AAAACTTAAG ATCCTATACT ATGTTTATTG      3000
     TAGGAATTAA TGTGGCACTC AGAATTACAG ATCTTTTAAG TTTAAAATGG GGAGATGTGC      3060
     TTAAGGAAAA TAAAAAAACT TTTAAAGATA TCGAAATATA TGAGGGCAAA ACAAAGAAAC      3120
     ATAGGAAGAT TAAATTAAAT AAATCTGCAG GTAAGGCTTT AAAAGAGTTA ATGGAAAGTC      3180
     TTCCATATAT TAATATGAAT GATTTTATAT TTAAAAGTCG TGAGGGAGAA AATAAAGCTA      3240
     TAACAAGACA ACAAGCCCTT AATATATTAA AAGAGGCTGC TAAATCCGTT GGAGTTGAGG      3300
     AAAATATAGG AACCCATTCT TTAAGAAAAA CTTGGGGGTA TCACGCCTGG AAGGCTGGCT      3360
     TTAATCCTGC AATTATAATG GAGACTTTAA ATCATAGTAA TTTAGCTATG ACTAAAAGAT      3420
     ATTTAGGTAT TAGACAAGAT GATGTAAATG AACTTTATAC TAAGCTCAAT ATTGATTAAT      3480
     TATAGTGGCG GGTGGGTGGA AATAAAATTA ATTTATGGGC AAGCCAAGGA AGGCTTGTTT      3540
     ATAAATACAG ATTAAAAAGA CCTATTAGGA ATACTCTATT TGCTTGTTTA TTTTTCTAAA      3600
     CAAATGATTT GGCGAAGTCA GACTAGCCTT AATGGCTTGT TTTACTTACG CTAAATCTCT      3660
     CCTTGTTTAG AGAAGTAGAC AAGCTCCCTT AAGAGGAATA CATAAAAATA CCCAAGAGGA      3720
     ATGCCTAAGA CCAAAGGTGG ACTTGTCTTG CTGAGTAAGG TCTATGTACA TGCATTCTAA      3780
     TAGAAGCTTG TACATGTACC TTAATTCAGG GAGCATGTCC ACCTCTTAAT ATGCAAACTT      3840
     TTATCTGCAG ATATCATTTA TATTCATATA TTAAAGTATA TGGCCACTTT ATTTACTTAT      3900
     ATTACCAACT ATGCTAAACT ATCCATATAC AATTCAATGG CTTAAGTGGG CAACTGGTAT      3960
     CGCTATCCCT GTTAGAAGGG AGGTGATACA TATGTATGAA ATATTTATAG TAGTTTTTAC      4020
     TGCTCTATCA TTCTTGGTAG CTTTGATAAA TTTAATTATC ATACTTATAG ATAAAATAAA      4080
     AAGGTAGCCC ACCGGTCCAA TTGGTATGGC TACTTTTCTA CAATATTAGC TTTGCCAGTT      4140
     GCCAGAGGCA ACTGAATTGT ATACTACAGG GTGCTGGCAA CACCCTGTTT TTATTATACG      4200
     CATTTATTAG CTTTATTATA ACATATAATT ATCTATTATA TAAGATATAA TCCATTTAAA      4260
     TAAAAAGCTT TTCATTATAG CTTTCATAAA CATCACTAAA TAGATTTTTT GTTTCACTTA      4320
     TATTAATTAT TATAAGTGAA AATGTATTTA TTTATATTAT TTTAATGTAT TTATTTATAT      4380
     TATTTTAAGG AAAATTATTG AATATAATCT AATTTATTGT TATACTCATA CCATAATTTA      4440
     AGTAAACACT TACTTACAAA ATTGTTATTA TATAAAAATT ACTACGATGT AATTAATAAA      4500
     CTACAAAGGA TTTAGGAAGT GATGATATGA AAAAATATTT AAAAATGATT AGGAACATAG      4560
     TTTTTTTTAG CGGTCTAAAT ATTGTTATAA ATTTTATTGT TGGTTTTATA TATAGTATAA      4620
     TGAATTTTGC CATATATAAA ACTAAATCAT TAGAATCTTT TCAACAAAGT ATGATGGAAA      4680
     ATGTTTATAT AATAACTGCT CTCTCTTCTG CAATAACATT TATTATTTAT TTATTAGTGT      4740
     TAAAAAATAA AAATGAAAAC CTATGGCAAA GATGTAATTT TAAAAAAATT ACCCTTTCAC      4800
     ACATATATTA CTCAATACTT ATTGCTATAA GCCTTTCAGT GTTTACTTGC CCAATTATAT      4860
     CTTTAATATC AGAAAAATTT GAAAGCTATA AACAAGTGTC TGATAGTATA TCTGCAGCTT      4920
     ATGGGTCTAT TTTATCTATG TTGTGTATTG TAATATTAAT ACCTATTTTT GAAGAAATAC      4980
     TATTTAGAGG ATTAATATTT AATGAATTAA AGAAAAATAC AAATATAATA CTTGCTGTAA      5040
     TATTACAATC TTTAATTTTT GCTTTATTTC ATGGTAATAT TCTTCAAGGT ATGTACGCAT      5100
     TTATACTGGG AATAATATTA TGCATTTTAT ATCTTAAGAC AGGCTCTATA TGGTCAAATA      5160
     TATTATGTCA TATAATATAT AATTTGTTTG GCTCCTTATT AATGCCACTA GCTTTATCTT      5220
     ATACAAAAAA TTATACATTT GTATATATAG GAGCTGGATT AATAGCTACA GCAATACTTT      5280
     TAATTAGTAT GTTTAAAAAA CAAACTAATT CTATAAATTC ATCTAATATA AAAGGTTAAT      5340
     TTATATATTA AATCAAAAAA GTCACCAGAT ACCACAACTT AAATTTGTCT GTGGTATCTG      5400
     GTGACTTCAT GTATAAATAA AAACCTTTAT ATCAATTAGC TTTCAAAGCT TATAAATTTC      5460
     TTGTAATCTT TAGATAAAAT AAAAATATAT TTTTCATATA ATTAAATTAA CCATGACATA      5520
     GTAATACCAA GCTATGGCTG TCCGTTAAAA TTTTAAAATT TATACTATAG TTACAAAAGT      5580
     GTTACTTTAG CAACTATATA TTTTTTTACT TTCCCCATCC TAATAATTGA CTTTCTAACT      5640
     GTTCAAAATC ATAGTTTCTT TGCTCAAAAT TATTAAATCT ATCTACTTTA GATATAGGTC      5700
     CTTTGTAATC CTCTTTTAAA GCACTTACCA TAAAAGCAAC AATACTTTTA ATATTATTAC      5760
     TTTCTTTTGC TATACTATAT TTTTCTTTTA TTAAATCAAT ATTACCCTTT GCTGAATCAT      5820
     AAATTTGCTT AGCTTGAAGA TTAGTTATTT CTTCATCTAA TATTGATTTT ACTTCATTTA      5880
     TGTAATCTGA TTCTTTATCC TCTAGGCTCA CTACAATTTC ATTTCTAGCC TTATCTTGTA      5940
     CCTTTGATTT TATATAAAAC TTTATAGAAG TTATCTTACG ACTTTCTTTT ACTTCTTCAT      6000
     AGTCAATAAA TAAATCTGTA TTTGTATTAA TTTCATTTAT TGATACCTTA ATAACTTTTT      6060
     GCTTTAAATT AGCATATTTA GGATACTTAT TTTTTTTTAT ATCTAACATG CTTCTTATTT      6120
     CATTAATAGT TATTATTCTA TGTCCTATTT TTTCATATTG TTTTAGTAAT TCATACATTC      6180
     TAAAAGAATA TGTACTTTTA AATTGCATTA TATTTTTAAA TTGATATTTT GTATACCAAT      6240
     CTAAACTTAA ATAAAAAGGC TTTAAATCCT TATTTATCTT TAATATTAAA ACACCTTTTT      6300
     TATACTTAGC TACATCTACC CAATGATATT TTTCAAATTC GCCATTACTT ATATCCTTTA      6360
     TTTTTATAAT TCTTTGCATT AAAAGATCTG TAATATTATC AATATCTCTA TAAAATCTAC      6420
     TATCACTTGT ATTAAGTATT TTTATTAAAT CCTTAGTTTT AAATTTATAT TCTTTAAAAT      6480
     CAGTATCATC TTTTTTTATC ATACTAGCTA AAAGTCTAAT TAATTTTTGT TCTATTACAG      6540
     TTAAAGTATA GGAGGCTTCA ATTAATTTAT TACTTTGATA TATCCAATTA TTTTTTGCAC      6600
     TTTCAATATG ATTCTTCACT TATTATCACC ACCAAATTAA ATATAACCTA TTTTAAATTA      6660
     GTTATCAATA ACTTATAAAA AATAAGTTAT ACTTAGTATA ATTGTTGATA TAACTAGATT      6720
     ACAAGCAATT TTATAACTTC ACTATCAAAA GGTTATCTTT AGCTTTTTTT ACTATCATTA      6780
     AGTTACCTTT CACTATCAAA AGGTTATCTT TAAATCTTAT TTGACTATCA AAAGGTTATC      6840
     TTTCACTATC AAAAGGTTAT CTTTAAAATT TTTAAGCATT GATATAGCTA GTCTAGAGCC      6900
     TTGTGTAAAA CTATTAAAAC TATAGTTATA AAACAATATA AAACTACTAC TGTGTTTTAG      6960
     TAGTAGTTTT TTTACTATAA ACTTCTTAAT TTTAAATTTA TCTTTTACTA TGAAAATCTC      7020
     GCCTTTTAAA TTTGGATCTA TTGAATTACT AGATTACCCC TCTTAACCAT TTACGAATGA      7080
     TTTCAAATTA TAGAAAAAAA ACTAATATAA TATAGTAATA TCAATAGCTG CCTTTCCTTT      7140
     CATTTTCTCT ATATTAGATG TATAATATTG GTAATAATAA CTTTAGGACG GTGATAATTT      7200
     AATGTATCAA CTTGTTAAAG GATATAAAGC AGGAGAAGAA GCTCTTTTAA AGGATATAAT      7260
     AGACAAATTT GTTCCTATTA TATTAAAAGA GGCAGCAAAA TATAAAATAA AATGCTATGA      7320
     CTATGAAGAT CTTGTTCAAC ATGGATATTT ATCAGTTATA AAGGCAGTTA ACATGTATAA      7380
     GGGTGATGGA GATAGCTTTA AATATTATTG TATTAAAGCC ATAAAACAAA ACTACAGGGC      7440
     ACTTTTAAAA GGTGAAATAA AGCACCATAG AGAGATACCA GAGGAAAAAG ATATATACTT      7500
     TTATAAATTT ACTTTAGAAG ATGAAATTTT AGCCTATGAA AAAACAAAGG AACTATATAG      7560
     AGCATTAGAT AATCTCAATA AATATGAAAG AGCCATAATA GAAAGCTTTT ATTTAAAAAA      7620
     TAAAACTATG GAAAGTATTG CTAAAGAAAA CAAGAAAAGC TATAACAATA TAAGATATGA      7680
     AAAGGATAAG ATAATAAAAA AACTGCAAAA GAAATTAATA AATCATATAT AAAAATAAGC      7740
     AGATAATAAT ATAAAGTTAG TTCTCTACTT AAAGGTGGTG GAAATATGTA TGGCAACTTA      7800
     GTAGAACTTA TAAATAATAT ATAACTGTGT TTTATTCTAA TTGGAGAAAA AATTACATTT      7860
     GAAAATAAAA TATGAGCAAA ACCTTTGAGG AAATAGGTCT CAATACCCTA GTTTGGTTTA      7920
     GACTGCTAAA ATCAAAATTA TTTATATTTT TTTATTTTTA ATCCACTGCC TTTATATTTT      7980
     CATCCCAAAA ATATCTCCTT AATGTAGATA TTATATCTAC ATCTAATGAT ATCCATAAAT      8040
     CTTTACTAAG TCTAAAACTT TGTCTCTCCT TTTCAGAAAA GATATATATC GGTGTATTAC      8100
     CCTTATGAGT TTCTAATATA GTCTTTAAAA GCTTATTTAC TGTTCTCACT TTTTCATTAT      8160
     CCTGAACTCT AATATATACC TTGGATGAAT TGAATTTTTC AAGAGGTTGT ATTTCTTCAC      8220
     TTATTATCTT CGGTAATTCA CCTTCTTTTA AGCTTAATCT ATCTCTTATA ACCACTAATA      8280
     AATCTTCATT TATCAATAAA TTAAATTTTT CTAACTTTTT TGGAAAAACT ATAACTAAAA      8340
     TACTTTCACT AAGATCTTCA AGCTTCAAAA AAGCCATAAT GGTATTATTT CTAGTTACTT      8400
     TTATTAATAC TTCTAAGATA ACCATTTATA ATACAATATT TATTATGTGA AAGAGTACAG      8460
     TTCATCAATT TTTTTCTATC TCATAGCAGC ACTCAATTAT TTCACCAGGT ACAATTTTTT      8520
     CAGTATGAGT CAACATTCTT ATAACTATTT CATTACATAC AATAATCACT TTATTGTAAT      8580
     GAGCATATTT ATCTGCAACA TTTTTAACTT TATTTCTTAA TGAATTAAAT TCTTCCCATT      8640
     GTTCAGTTTC TTCACTTGGA TAGTTATAAT CCTCTGTTAA TTCTAAAAAC TCTTCAAATG      8700
     TACTCTCTTC TAAACCCATC TCTGTTTTTA TGCCAATATT TCTATTTTCA GATTTAACGC      8760
     TAGTTCTTAA TGACTTTAAT TCTTCCCATC GTATTATTTC TTCGATTGAG TAGTTGTCAT      8820
     TATGGTAATT AAAATCATCT ATTAATTCTA AAAGATTGTC AAATGTATTA TATTCTTCTA      8880
     AGTCCATATC TACTATCATA TTAATATTTG TCTTTTGTGA GATAATTGAA GCCGTCTGTG      8940
     TAGCCTTTGT ATGTGAAGAA GAAACAATAA TGTCTGCTCT CTTTAATCTT GAATCTAATG      9000
     CCATACTTAA TGCTTGTGAT ATACCTTTAA TTGACAAAGG GGCTAAATCT TTTTTATAAC      9060
     ATGTTTTATA GTCTGTTTGG CCAGGCATAA TTAAATAAAA TTGAGCCATA TAGCATCCTC      9120
     CTTTTAATTA ATAAATAATT ACTCTTTTTC AATAACTTGC AAATAAATTA TACTAAATAT      9180
     ATCTAAATAA TCAAACAGAA AAAATTAAAG CTGTAGAAAT AGCTAAATAT TTAATGAATA      9240
     TACTCTCAGT AGAGATGATA GCAAAGAAAA CTGGCCTATT CATTCAAAAA GTTGAAAAGT      9300
     TAAAAAAAGA TATAAATAAA AGTCGTTGAT CATTAAAAGT TACAATTAAA CTAATAAATA      9360
     ACACTAGATA CAAGAGTATC TAGTACTTTT TTTTACAAAT ATAAAGCTTA ATTCATATAT      9420
     ATAAGTGAAA ATAAAAATAA GGAGGTACAA AGTTATGGCA GTAAGTAAAA ATATGTTAGA      9480
     AAAAAATCTA GTTCTAGAAT ACCAAGATGG CTTAGATGAG AAAGGAAAAG CTATTATGAA      9540
     AGGGGCTACT TATAAAAATG TAAAACTGAC TGCAGATCCA GAAGCTCTTA TGATGGTAGT      9600
     AGATGCAATA AATCCATTAA TGCCAGAAGG TATATCAGAG GCTAGAGTAG TAGAAAATTA      9660
     CGTATTATTA AAATAATAAA ATGGAGGGGT AAAAGATGAA TATAACAAAA TATTTAAATT      9720
     TAGTATTTAA AACTACAGAA GATTCTACTT CAACTATAAA AATTCCAAAG GTTAAAGAAG      9780
     ATGTAACAGA AGAGGAAATA AAAAATTGCG GAAAATCCAT AGTAGATCAG AACATATTCC      9840
     AAACTAAAAA TGGAGATCTT TCAGCACTTA AAGTTGCAAG AATTATAACA ACTGAAACAG      9900
     AAGAAATTAA AATAGAAAAA TAAATAAAAA GCTCTCACAT TATATTGTGG GAGCTTTTTA      9960
     AAGTATTTCA TATTTTATAT ATTATTACTA TTCATTACAT ATTTTTTTCA CTCTCTAATT     10020
     CATCATATAA ATAATTAATA CCTTCATACC ATAATTTTGT ATCTTCTTCT TCTAGAGTTG     10080
     CATAAGTTTT TGAATTATAA AACTCTAATA AAGCTTGCTT TTGAGATATA CCATGATTTT     10140
     TAGCAAATCT TTGTGACACC TTTGAGGCCT TCAACGGAAT AAATATGTGT ACATTGTCTT     10200
     GAGTTATTTT AGGTAGTGTC ATATTATACC TCCTCATATT TTATAAAATT TAAATACTTT     10260
     AAAGATTCTT TCGTATGAAA GGAAATTTGG TCATTTAATT TATAAGTTCT AAGTTCTTTA     10320
     ATAGCTGTAT CAAAATCCAT AAATTTATTT TCAAAAGCAT TTAAACAAGC ATATACCCTA     10380
     TCATCTGCAA CAGATCCTTT TACTATATCG TAATTATGAG TATATCCTTC ATTCATTCTA     10440
     TTATCTAGAA CAAACTTAAG CCAACTTTTA CTGGCACCAT TAAATACTTT AATATTCAAT     10500
     CTATCTTCTT GAAATATAGT ATCCTCTATT TCATATATAC CTATAATACC CTTTTCTACA     10560
     TTTTCTCTTC TACTTTTTAT TTTAGCCCAT TTTAATGCTT GATCATAGCT TGTAGTAGTA     10620
     TAAAAACCAT ACCCAAAATC TAAAGTTCTA GTAGCCTTTA TAATTTTAGG ATCTTCTACT     10680
     ATTACATTAC TTCCATGATA AAGTATCATA GCTTATAACC TCTATTCTTT AAAAATATTT     10740
     CTATTTCAGA TAAAATATAA TCATTACCTT GAGTATGAAG CAAATCATAG CTTTCTATTA     10800
     AAAAATCAGT AACTCCACTT TCATAAAATA AGTTTGCTAC CTCTTTTCCT TTCATTTTAA     10860
     ATTTAACCTT AAAATTTTCT ATACAAAAAG AGATAAATTC AAATACCTTT TCATCCCTAG     10920
     TTAAATTCAT CATTTACACC ACCCTTTTAT AGCATAGTAT TAACTATAAA TAATACTATA     10980
     TCAAAAAATA GAATTAAACT AAATCCTCAT AATATAATAA CAACGTTTCA TGAAACCGTT     11040
     ATATAAATAA ATATCTAGAA CTTTCAGGGT TAGTATAACC TACACTTTTT TTAGTATAAA     11100
     AAGAGTACCA GGGCTAAAGC CCCATAATAT AATACGAACG TTTCAGTAAA CACTCTATTA     11160
     ATACTTATTA TTTTTTACTC TAGATACTGC ACTAACATTA ATATCTAATT TTCTAGATAT     11220
     CTCCCTTACT CCAAATCCTT TACTTAATAA TTCTTTTATT TTATTTTCTT TATTTAATTT     11280
     TTCTTGTTGT CTTTTAGTTA ACCCCTTTTC ATTTCTTCTT TTAGCTTTTT GTCTTATTTT     11340
     ATTTTTCTGA TTATCTCTTC TTTTAACTTC TTTTTTACCT ATTATAGTTT CAAGAGTTTT     11400
     CATTTCTTCA TCTGTTATAT TAAGCTTTTC TATTAAAGTT TCATTTTTAT AATTATAACC     11460
     ACCACGTTTA TATGTACCAC TAGGGCTATC TTTAAACCAA GCCTCATAGG CTTTCTCAGC     11520
     ACTTCTCGTT GCCCTTTCTA CTTCTTTATA CTCTAAAGGT ACTTTAAACT CTTTATTAAA     11580
     GTCTATTGTA TTCTCAAGGG CCTTTTCTTT ATTTGCTTCA TAACAGCAAC TCCAATATCT     11640
     ATATAAAAAG CACATAAATT CTCTCTGGCC AGATTTAACT AAAGAGCCTT CTTTATTTTT     11700
     ACAATAGCCT TCTCTAATTT TTTGAAGAGT TACTATATCT CTAAGCCTTG CATAATGAAG     11760
     ACTATATAAG GTAAAAAAGT TAACTATCTT AGGATTTCTT CCCTTAGATT TGTAATATGG     11820
     ATTTTTAACG TAAGGTGTTA GCTCTGGAAG ATATTCTTCT TGTATTTCCC TTAGTATATA     11880
     TCTATCCTCA CTATAAACTA AAATATCTGC ATTTTTGCCA CTCTTTTGAT TTATAGATCC     11940
     AGCCAACCTC ATAACCCTTG AACTATCTAT AGATTTTTCA TCCGCTCCTA TGTCTTTAAG     12000
     TTCTTTTAAA AAGTGCTTTT GTACTGCATT CCAAAGGGGT AGGGCCTTAT AAGGAACAGG     12060
     CTCAATTAGC CAGTATATAG CTATTCCTCT TCCCGTTAAT ATTATAAAAT TTGCCTCCGG     12120
     AACCTTTTCT CTAAAATAAT CACATTCAAG TTGCCATATT ATTTGATCTG TAGTTAAATT     12180
     TTTAAAATTT TTAAGGGAGT AATAGTCTAA ATCTATATAT AAAGAATTTA ATTTTCTTAT     12240
     ATTTTCAATA CGTCTAAAAG GTTTATAAAA TGAATTTGCA CTTAAATATA CATTTATACC     12300
     TTCTATACTC AATATTTTCC CAATATTATC TTTTAGTTCA TCCTTTGAGT AATGATATTG     12360
     CATCCATTTA TTTTGTTTTT TTACTGCTAT AGTAATGAAT CCATCGTCTT TTTCATGTAA     12420
     AAGCTCTATT TGATTTTGTG CTTTAGAAAC ATTTTTAATT AGTGCCTTCA AAGAAACTTC     12480
     TATTGTTGGT AAGTTTCTAA GTACATTATA TGTATAATCA TCTATACTTA GCTGCTTTAC     12540
     TGACTGCACC TGTTTATCCC CCTTGTATCC CGTTACTTGT CTAATTCTTC ATGTCTTTAG     12600
     CTAAATTATA GCATATTAAA TTAACCTGAA ATAGGTCATA CCATGTATTT ATATGTAAAT     12660
     TCGTCTATTT TTTTGTTTTT ATTTTATACA AATTACATTG TTATTAAAAC TATTTTAGTT     12720
     ATACTGTATA ATTTTAACTA AACAAAAAGG GAGTATATTA TGTACCCCCA TTTTTTAAAT     12780
     TTATCTATTA TATTTTTGTA TAAATTCAAG TAAAGCTATT GCTATAAGAT CCTTTTGAGA     12840
     TTCATTTCTT TTTTTGCAAA AGTCTTTAAA TTTATCTAAT ACATACTTAT ATGTTTTAAA     12900
     ACTTCTACTT CCTATTTCCC CTTGCAGCTC ATAATTTTCA AGATCAATTT TAGGAACTTC     12960
     AATAATATTT TCTTTTCTAA TTTCATCTTC CGTATATTTT TCAAATAATA AATTAATCTG     13020
     ATCTTTAATC ATTTCAATAT CACTTTTCAT ATTTTGAAAT TCTTCTAATA CTAAAGGTGT     13080
     AGTTACTTTT GGTGCCTTAG GTAACACCTC TTCAATTCCT TTTATTTCAA TGAATTCACT     13140
     TTCCTTATTA TCTAAACCAT TAAGAGTTAC TTTTGAGTTA CCATCTAGTT TATTAATAGT     13200
     TTCTTTGGTG TTACTTTTGA GTTTCTCCTT TGAGTTACTT TGGTAACTAC TTAGAGTTTC     13260
     ATCATAGTTA CTTTTAGATT CCTTTAGTGT TTCTTTATGC TGTATTTTTA TTTCCCCTTC     13320
     TAACCCATCT TGGTGTTTAT TTTGTGTTAC TTTTGAATTA CTTTCTATAT TAATATCATA     13380
     TTTTTTAGTA GCATTATTAT ATTTTATAGG TGTATCTTTT ATTTTCTTTT GCCAGGTTCT     13440
     AGCTGACATA TTATATTTAT ATCTTAAAAA GTTGTCTCTC TTATTACCTT TAAGTCCCTT     13500
     CTCATTAATG GTCTTTGCTA TATAAATTAA TTCTTCTAAT TGCATTTTCC CACCTCACTA     13560
     TAATAGTTAC TTTATAGTTA CTTTATAGTT ACTATTTCTA TTTATTTATG CTTTTTCCTC     13620
     TAATATAAAA AGTAAGATTA AAAATAGTTT ATTTTTAATC TTACTTTAAT GTATTTCTTA     13680
     TGAATTTTTA TATTTACTAT ATGATCTAAC AAATTTCCTA ATCTTTTAAA TTTATCTTTT     13740
     CTAATAAATA ATAAAGCATT TTTTCTTTTC TTGTTATTAT TTTTGCGGTA CATACCATAC     13800
     CAGATTTTAT TTGCGCCTTT TCTCCCTTAT GGCTATATAA AGGCTTACTA TCTATAGAAG     13860
     CTTCACCGGT ATAAAAGCTT ACTCCACTTT TAGGATCTAC CTTTGAATCT ACACTTATAT     13920
     TTTCTAATCT ACCATCTAAA TATCCATATT CCTTATAAGG TAAGGATTGA AAATCATATT     13980
     TTATATTTGT ACCCCTTTTT ATATTTGCTA TATCTTTATT AAGTATCATA AGATCTATTT     14040
     TATATTTTGA TTCGGATGGT AATATATTTA AAACTTCTTG CCCTTCACCT ACTAAATCCC     14100
     CTGTTTTAAT AGGAGTACTT ATATCAACAA TACCATCTAT AGGCGCTTTT ATAGTACATT     14160
     TATCAATATT CATATCTACA ACCTTTAAAT TAGTTGTTAT TTCTTCAAGC TTTTCTTTAT     14220
     TTAATTTTAT TGAATTATCA ATTTCAACTA AAGAAGAACT TTTTATCTTT TCTTCATTTA     14280
     TTTCTTTTGC ATCATCATTA CTTGATATTT GATTATTTAA ATCTTTTATT TTATCATTAC     14340
     ATTCTTCTAT AACATTTTCT ATATTTAATG TAAATTGATT TTTATATTTT GTAAGTTCTA     14400
     ATCTAGATGA TTCTAACTTA GCTTTTGCAT CATTTATTAA AACTTCTTCT GCCTTTTTGT     14460
     TTTTTAGTGA ATTATAGGAA TCCTCTAAAG CTTTTATATT TTTTTCATAA CCTTCTACAT     14520
     TTATTTTATA ATCCTTAAAT TGACTATAAT AAGAAGTACC AGAATTTAAA TCGTTAGTAT     14580
     TGTTTTGTGC TGACTTTTTT AATGAATTTA AATTGTTTAT CTTAGAATTT AAATTATCTA     14640
     TTTGTGAATC TACCACCTTT TTATTATTGT CAGGGTTTTT TTTGCTCTTT TCATAATTTA     14700
     AATATTTGTT ATAGTACTCT TTTTCATCTT TGCTATCTGT AAAATAATTT TTATTATCTA     14760
     ATATACTTTT CTTTAATTTT TCTAAATTGC TTATTTCTTT TTCTAAGTCC TTTTTACTTT     14820
     TATCTAATGA ACTCTTTTGA ACATCTAATT CTTTATGTTC TAATGTATAT AAAACTTTTC     14880
     CCTTTTCTAC TTTATCACCA TTTTTAAAGT TTACAGAGGA AACTTTGCTT CCTAAAAGAT     14940
     TAGATACCTT ATGAATATTT TCATTAGGTC TAACAACTCC TTGTACATCT ACAACTATTT     15000
     CCTTTTCAGC AAACCAACAC CATATAAAGG CACTGAAAAA TATTAAAAGT AATATATAGA     15060
     TAAAAATAGT TGTAAAGGGG TGAGGTTTAG ATTCTAATAT CTCTCTACTA TCTTTCATTT     15120
     CATCAATATT TTGTATTACT GGCTTCATTA CTTAATCCCT CCCTTATCCT TTGATGCAGC     15180
     AACTTCAAGA TTAACATCAT CAAAGGGAAG TTGATCCTTC CAAAGGTTAT AATACCTACC     15240
     TTTAATATTT ATTAATTCAT CATGAGATCC TTTCTCTATA ATCTCACCTT TATCTAAAAC     15300
     ATATATGGTA TTGCATCTTC TAATAGTACT TAATCTATGG GCTATTATAA TAGTTGTTAT     15360
     ACCTTCACTA AATTCATTCA TAGTATTTTC TATAGCTCGC TCTGTTATGG AATCTAAGCT     15420
     ACTTGTAGCC TCATCCATTA TTAATATTTC AGGTTTTTTA AGTATTGCCC TAGCTATTGA     15480
     TAACCTTTGT TTTTGACCAC CTGAAAAGTT AGACCCATTC TCCTCTACTA ATGTGTTATA     15540
     TCTTAATGGA AGAGAATTTA TAAAGTCATG TATTTGAGCT CTTTTACATG CTTCTATAAT     15600
     CTCTTCATAT GTAATATAGG GATTCCCTAA AGATAAGTTT TCCTTTATAG TTCCATTAAA     15660
     TAAAAAAGTT TCTTGAGATA TATAAGCTAT TTTATCTCTT AAGGTTTCTA TATTTATATC     15720
     CTTTATATTA TATGTATTTA TTAATATTTC ACCTTTTTCA CATTGATAAA AATTCATTAA     15780
     AAGCTTTGCT AAAGTAGTTT TTCCTGAGCC ACTTTCCCCA ACTAGAGCAA TCTTTTCACC     15840
     AGGCTTTATA TTCATACTTA TATCCTTAAG TATGAGCTTT CTAGTTCCAT ATCTAAAATC     15900
     TACATCTTTA AATTCTATAT TTCCTAATAA GGATTGAGGT TTAATCTTCT TCTCTTCATC     15960
     CATACTTTTT TCAATCTCTA AATCAAGTAT TTCTCCAAGT CTTTCTCCGG CTACAACTGC     16020
     AGTTTGAAGT TGTGGTTGAA GATTTATTAT ATTTTCTATA GGATCTAAAA AGTATGCAAG     16080
     TAATGCATTA AAGCTTATAA GCTGTCCTAT AGACATAGAG CCCTTTAAAA CTTGATGTGT     16140
     TCCAACCCAA AGGATAACTA CACCAAATAC AGATTTAACA CTTCCCTTTA TCGAACCGTG     16200
     AAGGTTATTT ATAAAACCAT TTTTAAACAC ACTTTTTATA AGGAATATAA ATCTCTTTTC     16260
     TGTCTCTAAA TTAACTTCAC CTTCAGCATT AAATGCTTTT ATAGTTTCTA CTCCATTTAA     16320
     TGATTCTACA AGATATGAAG TAAGCTTTGC ATTGTCTTCC ATAACACTTC TATTTACTTC     16380
     TTCTAAAGGT TTATTAAAAG CCCAGACAAT AATTATGTAT AATACAATTG GAATCACAGT     16440
     TATACCAAAT AATAAACTAT TTGAAGTATA TAAAAATATT CCGCCTATAA TAACCATAAG     16500
     ACTATCTATC ATCATAGTTA GGGTAGCCCC TGATATAGCA TCTCTTATTT TAGATGCATC     16560
     ATTAAATCTT GATATAATCT CTCCTACCTC ACGAGTTCCA AAGAAATTCA TTGGAAGATT     16620
     TATAACATGC TCGTAATAAC CTAGCATTAA AGGTATGTCC ATATTTTGTC CTAAATAAAT     16680
     TAAGAGCTGT GTTCTAAAGG CACCCAGTAA TACTTTAAAA AGAGTTAAAA CTATTATTCC     16740
     AATAGATATC ATATGAAGAC TTTTGTTTAA ATTATTTGGT ATAATATCAT CTAAAATAAA     16800
     CTTAAAATAA AAAGCTCCTA TTATTCCTAA TATAGTGAAT ATAATAGAGG ATAAAAATAT     16860
     ATTTACTAAA AGCTTTTTTT GAGGTTTTAT AAGTTTAAAA AACCTTTGAA ATAATCCCTT     16920
     TTCCTTATTT CCCTTTTCAA ACTTTACAGT AGGAGTCATA ATAAGAAGTA TTCCTGTCCA     16980
     AATTTCAAAA AACTCCTGAG GATTATACTT GATAATTCCT CTACCAGGAT CTGCAATTAT     17040
     AATTTCCTTC TCTGTTATCT TATGAATAAC TACATAATGT AGCATAGTTT TATCTATAAC     17100
     TACATGGGCT ATACATGGAA GAGGTATTTC AGTAAATAAA TCCTCTGGTT TACTTGCCTT     17160
     AACTCCTTTA GCAGTAAATC CAAGCTCCTC TGCAGCCTTA ATTACTCCAA GAGCGCTGGT     17220
     ACCTTCCTTA TCTGTTCCTG CAACCTCTCT TATTTTTGAA ATTGGATATT TTAAACCATA     17280
     TTGCTTACAT ATAGTTGCAA GACAAGCAGC ACCACAATCT TTATGATCAT GTTGTTTTAT     17340
     ACATACGTAT CTGTTAAAAA ATTGTCTCAT AGTTCACCTC TTTTATATAT TTCAATTGTA     17400
     AATTATATGC TTTTCATGAA CTATTATATA ATAATATGGT TTTATTTTCA TTATCTTACA     17460
     AAAAGAATAT TGATTTCCAT TATTTTTTTT GTTACACTTA TAACATAAAT TGACAACTTA     17520
     AGAAATATAT T                                                          17531
//

If you have problems or comments...

PBIL Back to PBIL home page