(data stored in SCRATCH zone)

HOGENOMDNA: CLOC7_1

ID   CLOC7_1; SV 1; empty ; DNA; empty ; PRO; 5262222 BP.
XX
AC   NC_014393;
XX
PR   Project: 51503;
XX
DE   Clostridium cellulovorans 743B chromosome, complete genome.
XX
OS   Clostridium cellulovorans 743B
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Clostridiaceae;
OC   Clostridium.
XX
RN   [1]
RP   1-5262222
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Bruce,D., Goodwin,L.,
RA   Pitluck,S., Chertkov,O., Detter,J.C., Han,C., Tapia,R., Land,M.,
RA   Hauser,L., Chang,Y.-J., Jeffries,C., Kyrpides,N., Ivanova,N.,
RA   Mikhailova,N., Hemme,C.L. and Woyke,T.;
RT   "Complete sequence of Clostridium cellulovorans 743B";
RL   Unpublished
XX
RN   [2]
RP   1-5262222
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (11-AUG-2010) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-5262222
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Bruce,D., Goodwin,L.,
RA   Pitluck,S., Chertkov,O., Detter,J.C., Han,C., Tapia,R., Land,M.,
RA   Hauser,L., Chang,Y.-J., Jeffries,C., Kyrpides,N., Ivanova,N.,
RA   Mikhailova,N., Hemme,C.L. and Woyke,T.;
RT   "Direct Submission";
RL   Submitted (04-AUG-2010) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B310, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence is identical to CP002160.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4085037
CC   Source DNA and organism available from Christopher L. Hemme
CC   (hemmecl@ou.edu)
CC   Contacts: Christopher L. Hemme (hemmecl@ou.edu)
CC   Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..5262222
FT                   /strain="743B"
FT                   /mol_type="genomic DNA"
FT                   /organism="Clostridium cellulovorans 743B"
FT                   /db_xref="taxon:573061"
FT   gene            99..1454
FT                   /db_xref="GeneID:9611270"
FT                   /locus_tag="Clocel_0001"
FT   CDS_pept        99..1454
FT                   /locus_tag="Clocel_0001"
FT                   /gene_family="HOG000235658" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /codon_start="1"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   cno:NT01CX_0867 chromosomal replication initiation protein;
FT                   SMART: Chromosomal replication initiator DnaA domain; AAA
FT                   ATPase"
FT                   /db_xref="GI:302872923"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003688"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="GeneID:9611270"
FT                   /translation="MNVHLSDIWDKTLTIIKGELTEVSFNTWIKSITPEYIDDTTITFG
FT                   VPNDFTRGILESRYKDLVINAINMVTSKKYNVEFKIISEDVITSDDSEPKIQKQHIIAT
FT                   VSPDEMNSVLNPKYTFNSFVIGNSNRFAHAACLAVAESPAKAYNPLFIYGGVGLGKTHL
FT                   MHAIGHYILKNNSKAKVAYVSSEKFTNELINSIKDDKNEEFRNKYRNVDLLLIDDIQFI
FT                   AGKERTQEEFFHTFNALYDANKQIILSSDRPPKEIPTLEDRLRSRFEWGLIADIQPPDF
FT                   ETRIAILKKKADVEKLNVPNEVLTYIATTIKSNIRELEGALIRIVAFSSLTNKEISVDL
FT                   AQEALKDIISNRATKQITIELIQEIVASYYNLKIEDFKSARRTKNIAYPRQIAMFLCRK
FT                   LTDNSLPKIGEEFGGRDHTTVIHAYEKINEAYKSDESLKNIIEILTKRINQN"
FT                   /protein_id="YP_003841556.1"
FT   misc_feature    111..1448
FT                   /note="chromosomal replication initiation protein;
FT                   Reviewed; Region: dnaA; PRK00149"
FT                   /db_xref="CDD:166824"
FT                   /locus_tag="Clocel_0001"
FT   misc_feature    123..>560
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Clocel_0001"
FT   misc_feature    483..914
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Clocel_0001"
FT   misc_feature    558..581
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Clocel_0001"
FT   misc_feature    order(561..584,747..749,849..851)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Clocel_0001"
FT   misc_feature    735..752
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Clocel_0001"
FT   misc_feature    885..887
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Clocel_0001"
FT   misc_feature    1173..1442
FT                   /note="C-terminal domain of bacterial DnaA proteins. The
FT                   DNA-binding C-terminal domain of DnaA contains a
FT                   helix-turn-helix motif that specifically interacts with the
FT                   DnaA box, a 9-mer motif that occurs repetitively in the
FT                   replication origin oriC. Multiple...; Region: Bac_DnaA_C;
FT                   cd06571"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="Clocel_0001"
FT   misc_feature    order(1242..1244,1266..1271,1290..1292,1308..1316,
FT                   1341..1355,1362..1364,1371..1376)
FT                   /note="DnaA box-binding interface; other site"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="Clocel_0001"
FT   gene            1715..2818
FT                   /db_xref="GeneID:9606810"
FT                   /locus_tag="Clocel_0002"
FT   CDS_pept        1715..2818
FT                   /locus_tag="Clocel_0002"
FT                   /gene_family="HOG000071792" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /codon_start="1"
FT                   /EC_number="2.7.7.7"
FT                   /transl_table="11"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: cno:NT01CX_0866 DNA
FT                   polymerase III subunit beta; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="GI:302872924"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003887"
FT                   /db_xref="GO:0008408"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="GeneID:9606810"
FT                   /translation="MNFTCDKTNLQEAISIAQKAVTGKSTMPILQGLLLNARGNKLTIN
FT                   SSDIDLGIETKCNANIKEEGSIVVDSKLFGDIIRKLPNSEIQIKSISEGTIEITCQRSR
FT                   FTLVHMKADEFPQLPYIDEDEIISIPQKLIKNMIRSTIFAIAIDETRPILTGILFEIKN
FT                   RTLNLVALDGFRLALKKETIDTEQEFSAVIPGKTLHEVVKILEDEGDVDITFTTNHILF
FT                   NLGETKVVSRLLEGEFIKYQAIIPEEHELSISVNRASLLNSIERASLVSKDASSNLIKF
FT                   NISEDNIVITSNSQLGDVREEVSIKLLKGNELQIAFNSKYLIDALKIMEEETITLQFTS
FT                   AVSPCIIKNIENDNVIYLVLPVRISNS"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /protein_id="YP_003841557.1"
FT   misc_feature    1715..2806
FT                   /note="DNA polymerase III subunit beta; Validated; Region:
FT                   PRK05643"
FT                   /db_xref="CDD:168148"
FT                   /locus_tag="Clocel_0002"
FT   misc_feature    1715..2803
FT                   /note="Beta clamp domain.  The beta subunit (processivity
FT                   factor) of DNA polymerase III holoenzyme, refered to as the
FT                   beta clamp, forms a ring shaped dimer that encircles dsDNA
FT                   (sliding clamp) in bacteria.  The beta-clamp is
FT                   structurally similar to the...; Region: beta_clamp;
FT                   cd00140"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Clocel_0002"
FT   misc_feature    order(1784..1786,1928..1930,1949..1951,2300..2302)
FT                   /note="putative DNA binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Clocel_0002"
FT   misc_feature    order(1931..1933,1940..1942,2018..2020,2024..2026,
FT                   2519..2521,2612..2617)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Clocel_0002"
FT   misc_feature    order(2225..2227,2231..2242,2666..2668,2792..2803)
FT                   /note="beta-clamp/clamp loader binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Clocel_0002"
FT   misc_feature    order(2225..2227,2231..2236,2444..2446,2552..2554,
FT                   2591..2596,2675..2677,2792..2803)
FT                   /note="beta-clamp/translesion DNA polymerase binding
FT                   surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Clocel_0002"
FT   gene            2995..3252
FT                   /db_xref="GeneID:9606811"
FT                   /locus_tag="Clocel_0003"
FT   CDS_pept        2995..3252
FT                   /locus_tag="Clocel_0003"
FT                   /gene_family="HOG000074028" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02988"
FT                   /codon_start="1"
FT                   /product="S4 domain-containing protein YaaA"
FT                   /transl_table="11"
FT                   /note="KEGG: cno:NT01CX_0865 S4 domain-containing protein;
FT                   TIGRFAM: S4 domain protein YaaA; PFAM: RNA-binding S4
FT                   domain protein"
FT                   /db_xref="GI:302872925"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="GeneID:9606811"
FT                   /translation="MIKIVNKESQHKYAEDIMSEIVIETEFIKLDSFMKLAAIVSSGSE
FT                   AKMIIKSQEVTVNGEIEERRGKKLYKGDVVEFNGESYKVV"
FT                   /protein_id="YP_003841558.1"
FT   misc_feature    3052..3228
FT                   /note="S4/Hsp/ tRNA synthetase RNA-binding domain; The
FT                   domain surface is populated by conserved, charged residues
FT                   that define a likely RNA-binding site;  Found in stress
FT                   proteins, ribosomal proteins and tRNA synthetases; This may
FT                   imply a hitherto unrecognized...; Region: S4; cl09940"
FT                   /db_xref="CDD:175052"
FT                   /locus_tag="Clocel_0003"
FT   gene            3443..4537
FT                   /db_xref="GeneID:9606812"
FT                   /locus_tag="Clocel_0004"
FT   CDS_pept        3443..4537
FT                   /locus_tag="Clocel_0004"
FT                   /gene_family="HOG000269559" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /codon_start="1"
FT                   /product="DNA replication and repair protein RecF"
FT                   /transl_table="11"
FT                   /note="KEGG: cno:NT01CX_0864 recombination protein F;
FT                   TIGRFAM: DNA replication and repair protein RecF; PFAM: SMC
FT                   domain protein"
FT                   /db_xref="GI:302872926"
FT                   /db_xref="GO:0003697"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="GeneID:9606812"
FT                   /translation="MFIENLKLRNFRNYKELNIDLYSGVNVFTGDNAQGKTNVLEAIYY
FT                   CSLGKSHRTNKDKELILWDALSGQLEVTVNKTRLNKKIKIDILKEGKKAISINSIKLKK
FT                   ISELIGICNVVMFSPEDLKIVKDSPSYRRKFLDIELCKLNSKYYFNLVQYNKVLNERNV
FT                   VLKSNNGNNLDIIEVYDMQLAKFGSHIVKDRVDYINKLNRYGQEIHKDITVSKEKISFS
FT                   YITDAKNLNGIEVELINLLKKNRQRDFIKKSTTVGPHRDDFSIEINDIDTRSYGSQGQQ
FT                   RTSILTIKFASLKIIKELIGEYPILLLDDVLSELDTNRQKYILNSIKDVQTVITCTGMN
FT                   EINNYLNDDYKLFIVNEGCIEEKI"
FT                   /protein_id="YP_003841559.1"
FT   misc_feature    3449..>4009
FT                   /note="RecF is a recombinational DNA repair ATPase that
FT                   maintains replication in the presence of DNA damage.  When
FT                   replication is prematurely disrupted by DNA damage, several
FT                   recF pathway gene products play critical roles processing
FT                   the arrested replication...; Region: ABC_RecF; cd03242"
FT                   /db_xref="CDD:73001"
FT                   /locus_tag="Clocel_0004"
FT   misc_feature    3530..3553
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73001"
FT                   /locus_tag="Clocel_0004"
FT   misc_feature    order(3539..3544,3548..3556,3746..3748)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73001"
FT                   /locus_tag="Clocel_0004"
FT   misc_feature    3737..3748
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73001"
FT                   /locus_tag="Clocel_0004"
FT   misc_feature    <4175..4525
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Clocel_0004"
FT   misc_feature    4268..4297
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Clocel_0004"
FT   misc_feature    4355..4372
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Clocel_0004"
FT   misc_feature    4379..4390
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Clocel_0004"
FT   misc_feature    4442..4462
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Clocel_0004"
FT   gene            4556..4819
FT                   /db_xref="GeneID:9606813"
FT                   /locus_tag="Clocel_0005"
FT   CDS_pept        4556..4819
FT                   /locus_tag="Clocel_0005"
FT                   /gene_family="HOG000060930" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:CLI_0005"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cbf:CLI_0005 hypothetical protein"
FT                   /db_xref="GI:302872927"
FT                   /db_xref="GeneID:9606813"
FT                   /translation="MFLHLGENVVVPVRDVIGIFDIDTTMYGADTVQFLRLAEEDGFIE
FT                   KITNDKPKSFIVAEVNKKSKIFLSPISSATLCKRTQSIYEEY"
FT                   /protein_id="YP_003841560.1"
FT   gene            4849..6759
FT                   /db_xref="GeneID:9606814"
FT                   /locus_tag="Clocel_0006"
FT   CDS_pept        4849..6759
FT                   /locus_tag="Clocel_0006"
FT                   /gene_family="HOG000075156" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /codon_start="1"
FT                   /EC_number="5.99.1.3"
FT                   /transl_table="11"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: cno:NT01CX_0862 DNA gyrase subunit B; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM
FT                   domain-containing protein; DNA gyrase subunit B domain
FT                   protein"
FT                   /db_xref="GI:302872928"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003918"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR000565"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="GeneID:9606814"
FT                   /translation="MTDKKQSYDASQIQVLEGLEAVRKRPGMYIGSTSSRGLHHLVYEI
FT                   VDNSIDEALAGFCKNIDVIIHEDNSISVKDDGRGMPVGMHAKMNRPAVEVIMTILHAGG
FT                   KFGGGGYKVSGGLHGVGASVVNALSETCIVTVSIDGKIHRQEFHRGNVATELEVIGETE
FT                   EHGTEVFFTPDHEIFETLEFDYDTLVQRLRELAFLNKGINISIEDRRNDKSDSFHYDGG
FT                   IKSFVSYLNRNKEALFPEPIYIEGIQNDILVEIALQYNDTYQENIFSFANNIDTAEGGT
FT                   HLAGFKNAMTRVINDYARKFGFLKENDKNLSGEDVREGLTAIISVKIPEPEFEGQTKTK
FT                   LGNSEVRGIVDSILGGSVSTFLEENPSVGKIIVDKALTASRAREAAKKARELTRRKSIL
FT                   ESTSLPGKLADCSSKDPSECEIYIVEGDSAGGSAKQGRNRRFQAILPLRGKIMNVEKQR
FT                   LDKILGSDTIRSMITAFGAGIGKDFDLDKLRYHRIIIMTDADVDGAHIRTLLLTFFYRY
FT                   MRDMIEKGHVYIAQPPLYKVSRNKKEWYAYNDDELKDILKDIGGKDNSTVIQRYKGLGE
FT                   MDAQQLWDTTMDPEHRLLLKVDMGEAMMADEIFTILMGEKVEPRREFIQENAKNVVNLD
FT                   V"
FT                   /product="DNA gyrase, B subunit"
FT                   /protein_id="YP_003841561.1"
FT   misc_feature    4870..6756
FT                   /note="DNA gyrase, B subunit; Region: gyrB; TIGR01059"
FT                   /db_xref="CDD:162180"
FT                   /locus_tag="Clocel_0006"
FT   misc_feature    4951..5280
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cl00075"
FT                   /db_xref="CDD:173995"
FT                   /locus_tag="Clocel_0006"
FT   misc_feature    5509..5979
FT                   /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
FT                   a ribosomal S5 domain 2-like fold, of the type found in
FT                   proteins of the type IIA family of DNA topoisomerases
FT                   similar to the B subunits of E. coli DNA gyrase and E. coli
FT                   Topoisomerase IV which are...; Region:
FT                   TopoII_Trans_DNA_gyrase; cd00822"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Clocel_0006"
FT   misc_feature    5662..5664
FT                   /note="anchoring element; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Clocel_0006"
FT   misc_feature    order(5836..5838,5845..5850,5854..5856)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Clocel_0006"
FT   misc_feature    order(5854..5856,5860..5862)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Clocel_0006"
FT   misc_feature    6103..6444
FT                   /note="TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM)
FT                   nucleotidyl transferase/hydrolase domain of the type found
FT                   in proteins of the type IIA family of DNA topoisomerases
FT                   similar to the Escherichia coli GyrB subunit. TopoIIA
FT                   enzymes cut both strands of...; Region:
FT                   TOPRIM_TopoIIA_GyrB; cd03366"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Clocel_0006"
FT   misc_feature    order(6121..6126,6133..6135,6340..6342,6346..6348,
FT                   6352..6354)
FT                   /note="active site"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Clocel_0006"
FT   misc_feature    order(6121..6123,6340..6342)
FT                   /note="putative metal-binding site; other site"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Clocel_0006"
FT   misc_feature    6550..6723
FT                   /note="DNA gyrase B subunit, carboxyl terminus; Region:
FT                   DNA_gyraseB_C; pfam00986"
FT                   /db_xref="CDD:144542"
FT                   /locus_tag="Clocel_0006"
FT   gene            6781..9294
FT                   /db_xref="GeneID:9606815"
FT                   /locus_tag="Clocel_0007"
FT   CDS_pept        6781..9294
FT                   /locus_tag="Clocel_0007"
FT                   /gene_family="HOG000076279" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /codon_start="1"
FT                   /EC_number="5.99.1.3"
FT                   /transl_table="11"
FT                   /note="SMART: DNA gyrase/topoisomerase IV subunit A;
FT                   TIGRFAM: DNA gyrase, A subunit; KEGG: cac:CAC0007 DNA
FT                   gyrase subunit A; PFAM: DNA gyrase/topoisomerase IV subunit
FT                   A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="GI:302872929"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003918"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="GeneID:9606815"
FT                   /translation="MNNNEGKTLPVDISNEMKKCYIDYAMSVIVGRALPDVRDGLKPVH
FT                   RRILYSMYELGITPDKPHRKCARIVGDVLGKYHPHGDSSVYDALVRLAQDFSMRYTLVD
FT                   GHGNFGSVDGDGAAAMRYTEARMDKMANEMVRDINKNTVDFIPNYDGDEQEPTVIPSRF
FT                   PNLLVNGSSGIAVGMATNIPPHNLTEVIDGVNLLIENPEATVLDLMTKIKGPDFPTAGI
FT                   IMGKSGIREAYETGRGKVVVRANATIEEDGGRHKIIVTEIPYQVNKAKLIENIADLVKD
FT                   KKIVGISDLRDESDRDGMRIVIELKRDANPNVILNQLYKHTKLQDSFGIIMLALVDNQP
FT                   KVLNLKEVLVHYLNFQKEVITRRTQFELEKAEARAHILEGLKIALDNIDEVISIIRSSK
FT                   STNEAKERLQERFALSEKQSTAIVEMRLRSLTGLERQKIEDELSELMALINKLKEILAN
FT                   EALILNIIRDELNEIKGRFGDERRTAIEASQNDINIEDLIQEHKVVVTLTRAGYIKRIA
FT                   ESTYSAQKRGGKGIQAATTKEDDIVENIFVTSTHDHILFFSNFGRVYTLKGYEIPEAGR
FT                   TAKGTNVINLLLLRPEEKIQAVITLSEFEKSQYLVFGTKKGIIKKTTLEDFSNIRKNGL
FT                   NAVGLREDDELISVRLSSGEDQIIMVTQNGYSIRFKEEDVRPMGRTATGVKGISLRDED
FT                   NVVSMEIVDESMDILVVSENGYGKRTPIGEYKCQNRGGMGIITYKVSEKTGKVVAATMV
FT                   NDEHEIMIINSADIVIRINSKEISTTGRSAMGVTLMRNNDETKVLAIAKVISDDEEIED
FT                   LQEHNEIQSLEQEAEVQEDTNNSEE"
FT                   /product="DNA gyrase, A subunit"
FT                   /protein_id="YP_003841562.1"
FT   misc_feature    6781..9234
FT                   /note="DNA gyrase subunit A; Validated; Region: PRK05560"
FT                   /db_xref="CDD:168095"
FT                   /locus_tag="Clocel_0007"
FT   misc_feature    6868..8199
FT                   /note="DNA Topoisomerase, subtype IIA; domain A'; bacterial
FT                   DNA topoisomerase IV (C subunit, ParC), bacterial DNA
FT                   gyrases (A subunit, GyrA),mammalian DNA toposiomerases II.
FT                   DNA topoisomerases are essential enzymes that regulate the
FT                   conformational changes in...; Region: TOP4c; cd00187"
FT                   /db_xref="CDD:29149"
FT                   /locus_tag="Clocel_0007"
FT   misc_feature    order(6868..6951,6964..7113,7117..7173,7177..7248,
FT                   7255..7257)
FT                   /note="CAP-like domain; other site"
FT                   /db_xref="CDD:29149"
FT                   /locus_tag="Clocel_0007"
FT   misc_feature    7144..7146
FT                   /note="active site"
FT                   /db_xref="CDD:29149"
FT                   /locus_tag="Clocel_0007"
FT   misc_feature    order(7936..7944,7951..7962,7993..7998,8038..8088)
FT                   /note="primary dimer interface; other site"
FT                   /db_xref="CDD:29149"
FT                   /locus_tag="Clocel_0007"
FT   misc_feature    8281..8430
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Clocel_0007"
FT   misc_feature    8431..8589
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Clocel_0007"
FT   misc_feature    8743..8892
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Clocel_0007"
FT   misc_feature    8899..9045
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Clocel_0007"
FT   misc_feature    9046..9189
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Clocel_0007"
FT   gene            9730..11232
FT                   /db_xref="GeneID:9606816"
FT                   /locus_tag="Clocel_R0001"
FT   rRNA            9730..11232
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT                   /db_xref="GeneID:9606816"
FT                   /locus_tag="Clocel_R0001"
FT                   /product="16S ribosomal RNA"
FT   gene            11633..14535
FT                   /db_xref="GeneID:9606817"
FT                   /locus_tag="Clocel_R0002"
FT   rRNA            11633..14535
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT                   /db_xref="GeneID:9606817"
FT                   /locus_tag="Clocel_R0002"
FT                   /product="23S ribosomal RNA"
FT   gene            14605..14721
FT                   /db_xref="GeneID:9606818"
FT                   /locus_tag="Clocel_R0003"
FT   rRNA            14605..14721
FT                   /note="5S ribosomal RNA as predicted by Rfam (RF00001),
FT                   score 88.83"
FT                   /db_xref="GeneID:9606818"
FT                   /locus_tag="Clocel_R0003"
FT                   /product="5S ribosomal RNA"
FT   gene            14725..14801
FT                   /note="tRNA-Met1"
FT                   /db_xref="GeneID:9606819"
FT                   /locus_tag="Clocel_R0004"
FT   tRNA            14725..14801
FT                   /db_xref="GeneID:9606819"
FT                   /locus_tag="Clocel_R0004"
FT                   /product="tRNA-Met"
FT   gene            14803..14878
FT                   /note="tRNA-Ala1"
FT                   /db_xref="GeneID:9606820"
FT                   /locus_tag="Clocel_R0005"
FT   tRNA            14803..14878
FT                   /db_xref="GeneID:9606820"
FT                   /locus_tag="Clocel_R0005"
FT                   /product="tRNA-Ala"
FT   gene            15174..15683
FT                   /db_xref="GeneID:9606821"
FT                   /locus_tag="Clocel_0008"
FT   CDS_pept        15174..15683
FT                   /locus_tag="Clocel_0008"
FT                   /gene_family="HOG000060909" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /codon_start="1"
FT                   /product="metal-dependent phosphohydrolase HD sub domain"
FT                   /transl_table="11"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; KEGG: ctc:CTC00088 hypothetical protein"
FT                   /db_xref="GI:302872930"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="GeneID:9606821"
FT                   /translation="MGIKRVRQFVIQLTDTMREEDYIYVNKYLTSKETIIFRKLSKNDQ
FT                   KHCVRVAKGLENIIIEKCGDNYNKAEIIKYIRLGLLHDIGKSFKKVNVINKSVLVMLNS
FT                   LTKGKLIKFVNIKSIDCYYNHGEKGYEMLKDQCDDKEFLQVIRYHHNRNYNNVAVKLLR
FT                   DIDDKN"
FT                   /protein_id="YP_003841563.1"
FT   misc_feature    15312..>15629
FT                   /note="Metal dependent phosphohydrolases with conserved
FT                   'HD' motif; Region: HDc; cl00076"
FT                   /db_xref="CDD:176575"
FT                   /locus_tag="Clocel_0008"
FT   gene            15828..16331
FT                   /db_xref="GeneID:9606822"
FT                   /locus_tag="Clocel_0009"
FT   CDS_pept        15828..16331
FT                   /locus_tag="Clocel_0009"
FT                   /gene_family="HOG000048647" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02829"
FT                   /codon_start="1"
FT                   /product="3H domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: 3H domain-containing protein; KEGG:
FT                   cbf:CLI_0020 putative transcriptional regulator"
FT                   /db_xref="GI:302872931"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR004173"
FT                   /db_xref="GeneID:9606822"
FT                   /translation="MSPDERRKFILNKLIDDKEVLKGQVLAEFLKVTRQIIVKDIAILK
FT                   AEGHNIISTPKGYMIQQENKDLKKVIAVFHDEKDIETELSIIVKYGGIIEDIRVEHAVY
FT                   GEITAMLMIKTIYEVQSFIQKLKDSKPLSALTGGVHLHLIRYKDEEMLQNILRELKEKN
FT                   LLLE"
FT                   /protein_id="YP_003841564.1"
FT   misc_feature    15837..16292
FT                   /note="Predicted small molecule binding protein (contains
FT                   3H domain) [General function prediction only]; Region:
FT                   COG1827"
FT                   /db_xref="CDD:32012"
FT                   /locus_tag="Clocel_0009"
FT   misc_feature    15843..16004
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Clocel_0009"
FT   misc_feature    16038..16292
FT                   /note="3H domain; Region: 3H; pfam02829"
FT                   /db_xref="CDD:145798"
FT                   /locus_tag="Clocel_0009"
FT   gene            16516..19251
FT                   /db_xref="GeneID:9606823"
FT                   /locus_tag="Clocel_0010"
FT   CDS_pept        16516..19251
FT                   /locus_tag="Clocel_0010"
FT                   /gene_family="HOG000220999" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03699"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function UPF0182; KEGG:
FT                   cbf:CLI_0022 hypothetical protein"
FT                   /db_xref="GI:302872932"
FT                   /db_xref="InterPro:IPR005372"
FT                   /db_xref="GeneID:9606823"
FT                   /translation="MAYKNGVLKKFIVPIVVVFFLLVGFFNSIVNLIVNIQWYEEVKYL
FT                   AIYFTKLKSLAIVTIPLFFVFFILIFLYYKSIRKSFNKSRSAVDTGSNKRNKLVFLVDA
FT                   VISFFLSISIGNGFWYEILQFVNSTNFNDTDPIFNKDISFYIFKLPLLKGIYQVLLTTL
FT                   ILLIIATVIFYIAVTAYDRLNKTVNNNVINLNKSNIKIISMEIAQFAGKQLASLAALVL
FT                   LVTSYGYVLKGYEIVYSSAGVVYGASYTDVTITLNFFRAIAIVSFVAAIVVFMSILRKK
FT                   IKPIAVSVIAIFVLTAIQPLVSTATESIIVKSNQRNLEKKYIGYNIDYTRKAFDINDIK
FT                   YEEYDVNRNLTAEDINNNRGIIDNIKINSYKPALEFYNQVQSMKYYYDYNDIDIDRYTV
FT                   DGKFTQVFLGTRELNPASLTQGTNTWEGKHLLYTHGYGVAMSKVNSITESGKPNFIIKD
FT                   IPMENKSGIKIENPRIYFGEADSNYVIVNTKSGEVDYPEGGENKLNKYDGNGGIKLSFA
FT                   KKLLYAAYFGSEKILLSNEITADSKIMFNRTITDRINKIAPFLTYDRDPYMVISEGKLY
FT                   WIIDGYTTSNRYPMSQPYNNINYIRNSVKVVIDAYNGDTNFYISDEKDPLIQTYKKIYP
FT                   TLFKDLNTLSKDIISHFKYPEDIFDLQSEVLGKYHVTDPDVFFDGSDLWQVSKDDTDVS
FT                   NNANEAKNTDYQTLKLPKSNKSEMVVINYFNIRNKNNMSSMLVGRMDGENYGDLVAYRF
FT                   PSNESIYSPALFQKQFKQDAVISKELSLLNTQGSNVNYGDTVIVPMENSLLYIMPLYIR
FT                   ATGENSIPEVKKIVLSNGEKTVMGDNMEVALGLLFGDIKNTEKTDGTEGKNDSNTGNLT
FT                   LAKQAKDIYNKMIEAQKSGDWSAYGNYQKQLGEIIEQINK"
FT                   /protein_id="YP_003841565.1"
FT   misc_feature    16597..18861
FT                   /note="Uncharacterized protein family (UPF0182); Region:
FT                   UPF0182; pfam03699"
FT                   /db_xref="CDD:146370"
FT                   /locus_tag="Clocel_0010"
FT   misc_feature    16600..19248
FT                   /note="Uncharacterized conserved protein [Function
FT                   unknown]; Region: COG1615; cl09133"
FT                   /db_xref="CDD:175016"
FT                   /locus_tag="Clocel_0010"
FT   gene            19279..20676
FT                   /db_xref="GeneID:9606824"
FT                   /locus_tag="Clocel_0011"
FT   CDS_pept        19279..20676
FT                   /locus_tag="Clocel_0011"
FT                   /gene_family="HOG000060323" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /codon_start="1"
FT                   /product="FAD dependent oxidoreductase"
FT                   /transl_table="11"
FT                   /note="PFAM: FAD dependent oxidoreductase; BFD domain
FT                   protein [2Fe-2S]-binding domain protein; KEGG: ckr:CKR_0011
FT                   hypothetical protein"
FT                   /db_xref="GI:302872933"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="GeneID:9606824"
FT                   /translation="MDYDVLILGGGIFGCAIAYELSKYSLNIAVIEKEYDIATDIEIIN
FT                   STIVFDGTIAKNDIMSTLEQRGNVLIKELAEKFNLSYQPKDMLYLAYCDKEAQKLQKTY
FT                   EDAVDRGIENIELINSKKVAEVEPNLKKEVINGILSRNTGIIEPYDLALALAEVAFDNG
FT                   VNFRFNEKVLSIETIAKGSIITTTKNKFKCKMVINTIPQKNYDIEDNLIDEEYKAVRRK
FT                   INYFLMENEGDKKLSNIMLSISENNQISVAVPNPNSTVGAIIHDDIISMREAKDIIKKQ
FT                   VKGIRNNYISAYYSDTYYSDTIIINDSYVDKGYIKISGKNYSEVTMTPAIAKIISETIR
FT                   ENIKCTLKKDYTDKRRDIFKFRDLSNEERQELIDVDKKYGNIVCYCNKVSEGEIVDAIR
FT                   RPLGARTVEGVKRRTGAMQGSCKGATCLHKIVNILARELNRDVLEIVKDTKDSNIIVGR
FT                   MKEFDGI"
FT                   /protein_id="YP_003841566.1"
FT   misc_feature    19279..20460
FT                   /note="Predicted dehydrogenase [General function prediction
FT                   only]; Region: COG0579"
FT                   /db_xref="CDD:30924"
FT                   /locus_tag="Clocel_0011"
FT   misc_feature    19279..>19872
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="Clocel_0011"
FT   misc_feature    20422..20592
FT                   /note="BFD-like [2Fe-2S] binding domain; Region: Fer2_BFD;
FT                   cl01093"
FT                   /db_xref="CDD:174522"
FT                   /locus_tag="Clocel_0011"
FT   gene            20689..20910
FT                   /db_xref="GeneID:9606825"
FT                   /locus_tag="Clocel_0012"
FT   CDS_pept        20689..20910
FT                   /locus_tag="Clocel_0012"
FT                   /gene_family="HOG000060887" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07892"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF1667; KEGG:
FT                   cac:CAC0013 hypothetical protein"
FT                   /db_xref="GI:302872934"
FT                   /db_xref="InterPro:IPR012460"
FT                   /db_xref="GeneID:9606825"
FT                   /translation="MKEIFTTIVRIKGGNAKVCPVKSTEPVEKELFIELSKAISRVYIG
FT                   LPVKRGDIICKNILNTGVDIIATKNILE"
FT                   /protein_id="YP_003841567.1"
FT   misc_feature    20692..20895
FT                   /note="Protein of unknown function (DUF1667); Region:
FT                   DUF1667; cl01591"
FT                   /db_xref="CDD:154491"
FT                   /locus_tag="Clocel_0012"
FT   gene            21223..22503
FT                   /db_xref="GeneID:9606826"
FT                   /locus_tag="Clocel_0013"
FT   CDS_pept        21223..22503
FT                   /locus_tag="Clocel_0013"
FT                   /gene_family="HOG000035938" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /codon_start="1"
FT                   /EC_number="6.1.1.11"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: seryl-tRNA synthetase; KEGG: cbl:CLK_3156
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl-tRNA synthetase, class IIa-like"
FT                   /db_xref="GI:302872935"
FT                   /db_xref="GO:0000166"
FT                   /db_xref="GO:0004828"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR018156"
FT                   /db_xref="GeneID:9606826"
FT                   /translation="MLDLKRIRSNKDEIKAALSNRGEDFDLTVIDKVVELDESRRAILV
FT                   EVENKKNQRNTESALVPKLKKAGEDASEVLQRMKSLSDEIKELDDKVRAIDEEIEYIML
FT                   RIPNIPNPLVPDGATDEDNLEIKRWGEPRKFENEPKAHWDLGVDLKILDFERAGKVTGS
FT                   RFTFYRGLGARLERALISYFLDTHVDINGYTEIMPPLMANRNSMKGTGQLPKFEEDAFT
FT                   IQNNGYFLIPTAEVPVTNYYRDEILVGEELPIKHVAYSACFRSEAGSAGRDTRGLVRQH
FT                   QFNKVELVKFTKQEQSYEELDKLVKDAESILEGLGLPYRKVRICKGDLGFTAALKYDLE
FT                   VWMPSYNKYVEISSCSNFEDFQARRANIKYREDAKAKPQFVHTLNGSGLAVGRTFAAIL
FT                   ENYQNEDGSVTIPEVLRKYMGGVEVIK"
FT                   /product="seryl-tRNA synthetase"
FT                   /protein_id="YP_003841568.1"
FT   misc_feature    21223..22500
FT                   /note="seryl-tRNA synthetase; Provisional; Region:
FT                   PRK05431"
FT                   /db_xref="CDD:168043"
FT                   /locus_tag="Clocel_0013"
FT   misc_feature    21223..21552
FT                   /note="Seryl-tRNA synthetase N-terminal domain; Region:
FT                   Seryl_tRNA_N; pfam02403"
FT                   /db_xref="CDD:145510"
FT                   /locus_tag="Clocel_0013"
FT   misc_feature    21586..22479
FT                   /note="Seryl-tRNA synthetase (SerRS) class II core
FT                   catalytic domain. SerRS is responsible for the attachment
FT                   of serine to the 3' OH group of ribose of the appropriate
FT                   tRNA. This domain It is primarily responsible for
FT                   ATP-dependent formation of the enzyme...; Region:
FT                   SerRS_core; cd00770"
FT                   /db_xref="CDD:29815"
FT                   /locus_tag="Clocel_0013"
FT   misc_feature    order(21688..21705,21712..21732,21742..21744,21748..21750,
FT                   21754..21756,21763..21765,21802..21813,21817..21825,
FT                   21829..21831,21883..21888,21892..21894,21904..21906,
FT                   21931..21933,21943..21945,21955..21957,22003..22005,
FT                   22066..22068,22474..22479)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29815"
FT                   /locus_tag="Clocel_0013"
FT   misc_feature    order(21709..21711,21919..21921,21925..21927,22012..22014,
FT                   22018..22020,22036..22038,22045..22047,22054..22056,
FT                   22060..22062,22069..22071,22075..22077,22081..22083,
FT                   22273..22284,22375..22377,22381..22383,22399..22401)
FT                   /note="active site"
FT                   /db_xref="CDD:29815"
FT                   /locus_tag="Clocel_0013"
FT   misc_feature    21802..21825
FT                   /note="motif 1; other site"
FT                   /db_xref="CDD:29815"
FT                   /locus_tag="Clocel_0013"
FT   misc_feature    22009..22020
FT                   /note="motif 2; other site"
FT                   /db_xref="CDD:29815"
FT                   /locus_tag="Clocel_0013"
FT   misc_feature    order(22384..22392,22399..22401)
FT                   /note="motif 3; other site"
FT                   /db_xref="CDD:29815"
FT                   /locus_tag="Clocel_0013"
FT   gene            22746..23243
FT                   /db_xref="GeneID:9606827"
FT                   /locus_tag="Clocel_0014"
FT   CDS_pept        22746..23243
FT                   /locus_tag="Clocel_0014"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:CLM_3324"
FT                   /codon_start="1"
FT                   /product="TPR domain-containing protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cby:CLM_3324 TPR domain protein"
FT                   /db_xref="GI:302872936"
FT                   /db_xref="GeneID:9606827"
FT                   /translation="MKNHLTEKDKNILITFTLIIAFSIISIMIYSISMIDDRRYLSLQS
FT                   KANNEMIAKNYDDAIVTFTEMLEYDRDKEIINKNIEELKALRKIEVNNINVNGGERSVK
FT                   CAVDARYVKDVVVIEKPSKVEKKEDDNNEKSYSSFKDKLQDGINSLKEGYDNLINGLLG
FT                   RN"
FT                   /protein_id="YP_003841569.1"
FT   gene            23320..23410
FT                   /note="tRNA-Ser1"
FT                   /db_xref="GeneID:9606828"
FT                   /locus_tag="Clocel_R0006"
FT   tRNA            23320..23410
FT                   /db_xref="GeneID:9606828"
FT                   /locus_tag="Clocel_R0006"
FT                   /product="tRNA-Ser"
FT   gene            23755..23845
FT                   /note="tRNA-Ser2"
FT                   /db_xref="GeneID:9606829"
FT                   /locus_tag="Clocel_R0007"
FT   tRNA            23755..23845
FT                   /db_xref="GeneID:9606829"
FT                   /locus_tag="Clocel_R0007"
FT                   /product="tRNA-Ser"
FT   gene            23886..23976
FT                   /note="tRNA-Ser3"
FT                   /db_xref="GeneID:9606830"
FT                   /locus_tag="Clocel_R0008"
FT   tRNA            23886..23976
FT                   /db_xref="GeneID:9606830"
FT                   /locus_tag="Clocel_R0008"
FT                   /product="tRNA-Ser"
FT   gene            24072..24148
FT                   /note="tRNA-Arg1"
FT                   /db_xref="GeneID:9606831"
FT                   /locus_tag="Clocel_R0009"
FT   tRNA            24072..24148
FT                   /db_xref="GeneID:9606831"
FT                   /locus_tag="Clocel_R0009"
FT                   /product="tRNA-Arg"
FT   gene            complement(24327..24701)
FT                   /db_xref="GeneID:9606832"
FT                   /locus_tag="Clocel_0015"
FT   CDS_pept        complement(24327..24701)
FT                   /locus_tag="Clocel_0015"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:lin0130"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: lin:lin0130 hypothetical protein"
FT                   /db_xref="GI:302872937"
FT                   /db_xref="GeneID:9606832"
FT                   /translation="MRKFFKFIITSIFIIIAIDILSRTATLNWSYLKVNDELYVLCTYN
FT                   IQNLDETDKFTKIGTIESKTNIFIKPIFNYSSNSFRKGSEVYKTDDNQIAVKQNNKFYV
FT                   LSSTQSEGWGNGIMVNPYLD"
FT                   /protein_id="YP_003841570.1"
FT   gene            24891..27977
FT                   /db_xref="GeneID:9606833"
FT                   /locus_tag="Clocel_0016"
FT   CDS_pept        24891..27977
FT                   /locus_tag="Clocel_0016"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /codon_start="1"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /transl_table="11"
FT                   /note="KEGG: dhd:Dhaf_0411 signal transduction histidine
FT                   kinase, LytS; PFAM: ATP-binding region ATPase domain
FT                   protein; response regulator receiver; histidine kinase
FT                   internal region; Diverse 7TM receptor transmembrane region;
FT                   glycoside hydrolase family 2 sugar binding; histidine
FT                   kinase A domain protein; SMART: response regulator
FT                   receiver; histidine kinase A domain protein; ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="GI:302872938"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="GeneID:9606833"
FT                   /translation="MHKNEKQWYRYAFIILSVTIFLLLVYRLTTSAEIRHGINAVNGQI
FT                   DLSNVELDKNNYVDLDGEWEFYWKKQLSYLQQDQFKQKPDAVLKLPSVWRRNIVNGERL
FT                   TSFGYATYRLKVKVKNKDQLLTLKLPAIHTSYSVYINDKLIGSGGIAGQDKATSKADLK
FT                   TVISTFAPPGEEFYIIIHVSNFSGSLSGIWDSIQLGNQESINSLWSDYIKKDLFLFGSS
FT                   LIMAIYHLSIFFMRGKKKPSLYFAILCIIVNIRISVLDSYFIYKIIPSASYGLVNFLNF
FT                   FTIFWGPVIYAFFIFELFPFKKAKVIKNAISYIAILETLIALIMPVHVYTVGTIVYDAI
FT                   DVVTLGICTFISIRAVFKKQEGAVIILTSSIIVVFSMIYDTVFELKLVGGHTEVTPIAF
FT                   FIFIFLQAFTLARNFSKDYNDVIVMTTQLEDMLNKEKTLTEKLTKLDKLKDEFLANTSH
FT                   ELRTPLNGIINMTEAVLSGAEGYVNDMQRRNLSLVVSSGKRLNNLVNDILDMSRLKYKD
FT                   IRLNRKTYDAKKLIFSVVNIFEYIKPNKQVRIELSIEEKLPFILVDEDRFNQILFNIIG
FT                   NAMKFTHKGKIAVSTERIDNFVEIRIEDTGIGISEDKLDQIWNAFEQIDASITRKYGGM
FT                   GLGLSITKNLVELHGGSINVESQINKGTIFRFTVPISEEEIEENSSKSNLEDKKYNYAL
FT                   SVPERIHGDSGKILVVDDEIINLHSIANILKHENYDITCVADGESAIEILKRDKSFSLV
FT                   ILDIMMPDMTGYQVCKAIRETDNLFEMPILMLTASNQPKTVIQAFKEGANDFLYKPFEV
FT                   DELLARTKTLTELKKSVIKAFDMEMAFLQAQIKPHFLFNVINTIVALCDDNPEEASELL
FT                   IEFSSYLRSSFDFRNLEQAIALEKEIEYVNSYLKLEKARFGEKLTIEFDIDDSIKAKIP
FT                   PLVIQPLVENAVKHGVMKKSEGGTVRLSIKETNGEINVSVKDDGVGISKDILQGILKND
FT                   SKRRSVGVKNIDKRLKRISGRGLQINSNEGEGTEIQFSI"
FT                   /protein_id="YP_003841571.1"
FT   misc_feature    25053..25484
FT                   /note="Glycosyl hydrolases family 2, sugar binding domain;
FT                   Region: Glyco_hydro_2_N; pfam02837"
FT                   /db_xref="CDD:145805"
FT                   /locus_tag="Clocel_0016"
FT   misc_feature    25533..26030
FT                   /note="7TM diverse intracellular signalling; Region:
FT                   7TMR-DISM_7TM; pfam07695"
FT                   /db_xref="CDD:148994"
FT                   /locus_tag="Clocel_0016"
FT   misc_feature    26244..26426
FT                   /note="Histidine Kinase A (dimerization/phosphoacceptor)
FT                   domain; Histidine Kinase A dimers are formed through
FT                   parallel association of 2 domains creating 4-helix bundles;
FT                   usually these domains contain a conserved His residue and
FT                   are activated via trans-...; Region: HisKA; cd00082"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Clocel_0016"
FT   misc_feature    order(26244..26246,26256..26258,26268..26270,26277..26279,
FT                   26289..26291,26298..26300,26355..26357,26367..26369,
FT                   26376..26378,26388..26390,26397..26399,26409..26411)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Clocel_0016"
FT   misc_feature    26262..26264
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:119399"
FT                   /locus_tag="Clocel_0016"
FT   misc_feature    26595..26897
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Clocel_0016"
FT   misc_feature    order(26607..26609,26619..26621,26628..26630,26694..26696,
FT                   26700..26702,26706..26708,26712..26717,26796..26807,
FT                   26853..26855,26859..26861,26874..26879,26883..26885)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Clocel_0016"
FT   misc_feature    26619..26621
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Clocel_0016"
FT   misc_feature    order(26706..26708,26712..26714,26796..26798,26802..26804)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Clocel_0016"
FT   misc_feature    27012..27356
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Clocel_0016"
FT   misc_feature    order(27021..27026,27156..27158,27180..27182,27246..27248,
FT                   27303..27305,27312..27317)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Clocel_0016"
FT   misc_feature    27156..27158
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Clocel_0016"
FT   misc_feature    order(27165..27170,27174..27182)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Clocel_0016"
FT   misc_feature    27312..27320
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Clocel_0016"
FT   misc_feature    27396..27647
FT                   /note="Histidine kinase; Region: His_kinase; pfam06580"
FT                   /db_xref="CDD:148281"
FT                   /locus_tag="Clocel_0016"
FT   misc_feature    27687..27974
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Clocel_0016"
FT   misc_feature    order(27696..27698,27708..27710,27717..27719,27798..27800,
FT                   27804..27806,27810..27812,27816..27821,27870..27881,
FT                   27930..27932,27936..27938,27951..27956,27960..27962)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Clocel_0016"
FT   misc_feature    27708..27710
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Clocel_0016"
FT   misc_feature    order(27810..27812,27816..27818,27870..27872,27876..27878)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Clocel_0016"
FT   gene            28468..29481
FT                   /db_xref="GeneID:9606834"
FT                   /locus_tag="Clocel_0017"
FT   CDS_pept        28468..29481
FT                   /locus_tag="Clocel_0017"
FT                   /gene_family="HOG000163770" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Cpin_2864"
FT                   /codon_start="1"
FT                   /product="phytanoyl-CoA dioxygenase (PhyH) family"
FT                   /transl_table="11"
FT                   /note="KEGG: cpi:Cpin_2864 phytanoyl-CoA dioxygenase (PhyH)
FT                   family"
FT                   /db_xref="GI:302872939"
FT                   /db_xref="GeneID:9606834"
FT                   /translation="MDNYREKLKKITETLLKDEDDYGEIKKATDDLYDVFVAVSDLKED
FT                   DASCREDVYLSKGKAIGTVWAAMCIKEFMRTKRFIKGVFLAIKEAQKKFKDTQIHILYA
FT                   GTGPFATLILPLTTMFSSEEIKVTLLEINSESIKNLKTVISVLGAASYIEEIVQCDATT
FT                   YKVNKDKNVHMIVTETMQRALKKEPQVSITLNLVPQMIEGGILVPQNVTVSAALIDPKR
FT                   DLDRIMGIEGADEDFCYMLGKVFELTKDTTVVENKEGYKFPEIEIQIPMNIERRFRSLN
FT                   LLTDIQVFGEEKLTYLQCSLNLPQKLMYIEWEIDNLEKFIFEYIVNETPGFMFRKI"
FT                   /protein_id="YP_003841572.1"
FT   misc_feature    28723..>29130
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:176836"
FT                   /locus_tag="Clocel_0017"
FT   gene            29659..30171
FT                   /db_xref="GeneID:9606835"
FT                   /locus_tag="Clocel_0018"
FT   CDS_pept        29659..30171
FT                   /locus_tag="Clocel_0018"
FT                   /gene_family="HOG000163769" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /codon_start="1"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   gur:Gura_0749 GCN5-related N-acetyltransferase"
FT                   /db_xref="GI:302872940"
FT                   /db_xref="GO:0008080"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="GeneID:9606835"
FT                   /translation="MKSSIYNYDEGNISLCPVESYHSEFLFRLFIESRSDLSLISGLDE
FT                   EQKLNIIYQQFIMEQQQLEVMYPKADFNVVMLNNEPIGRFYVYYGERKVRVLEIALLEK
FT                   YRRIGIGSKLLITVIEEAGRLGKNLNLQVAWFNAGAYTFYEKLGFKVIDDSYVYKTMEY
FT                   AKGYNRM"
FT                   /protein_id="YP_003841573.1"
FT   misc_feature    29887..30108
FT                   /note="N-Acyltransferase superfamily: Various enyzmes that
FT                   characteristicly catalyze the transfer of an acyl group to
FT                   a substrate; Region: NAT_SF; cl00443"
FT                   /db_xref="CDD:176420"
FT                   /locus_tag="Clocel_0018"
FT   gene            30233..30832
FT                   /db_xref="GeneID:9606836"
FT                   /locus_tag="Clocel_0019"
FT   CDS_pept        30233..30832
FT                   /locus_tag="Clocel_0019"
FT                   /gene_family="HOG000285621" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07484"
FT                   /codon_start="1"
FT                   /product="Tail Collar domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Tail Collar domain protein; KEGG:
FT                   mno:Mnod_4880 tail collar domain protein"
FT                   /db_xref="GI:302872941"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="GeneID:9606836"
FT                   /translation="MDPILAQIILWPGNFVPRGWLACEGQELPINQYTALYSLLGTTYG
FT                   GNGSTTFKLPDLRGRVPVGSGICGGINFQQGNSGGNFNVTLTQQQMPAHTHSTTVTQGA
FT                   VTVNGGIPFNGGEGTTNTPSASSKLAVGITAGGDIPNIYNTSEATGSVTGSFTGQVTGT
FT                   TVTVGSAGGNQGVNVMQPFLALRYIIATEGIYPSRD"
FT                   /protein_id="YP_003841574.1"
FT   misc_feature    30233..30826
FT                   /note="Microcystin-dependent protein [Function unknown];
FT                   Region: MdpB; COG4675"
FT                   /db_xref="CDD:34292"
FT                   /locus_tag="Clocel_0019"
FT   misc_feature    30251..30418
FT                   /note="Phage Tail Collar Domain; Region: Collar; pfam07484"
FT                   /db_xref="CDD:148855"
FT                   /locus_tag="Clocel_0019"
FT   gene            30853..37971
FT                   /db_xref="GeneID:9606837"
FT                   /locus_tag="Clocel_0020"
FT   CDS_pept        30853..37971
FT                   /locus_tag="Clocel_0020"
FT                   /gene_family="HOG000165018" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:SMART:SM00060"
FT                   /codon_start="1"
FT                   /product="Fibronectin type III domain-containing protein"
FT                   /transl_table="11"
FT                   /note="SMART: Fibronectin type III domain protein; KEGG:
FT                   pjd:Pjdr2_1410 S-layer domain protein"
FT                   /db_xref="GI:302872942"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="GeneID:9606837"
FT                   /translation="MVLFKSKNNRCKRIVAILLIFTMLNSIIYGWNFGMLEVHAVGLVN
FT                   GGNNGVITFGTLSTLELKSSTSVAGGQINVIDNLGSGFDIYSENGSSTKLMIRNMTGAG
FT                   SFTTYNATPPAAFVQVIGTAQNASNPTPIQYVDFRANTGIFDLDSLKVTSGDNNFSSYN
FT                   FNVEPLDSSYMPTGQIKTVSNVATYVFSTLDLSGDSNFDGIYGFRITVSQGCQICVDDI
FT                   AVTNPRMPVPPNISPTLNPFMPILPAITEDDTANNGQIINSFIGTSINDADTGAQKGIA
FT                   IISMDNQNGAWEYSSDGVSWNPISSVNLTNALLLREEDKVRFVPDGKNGTILPAKLTYK
FT                   AWDQTVGTTGTRFDASTSGGSSAFSINFDIVTVNVASINDAPVITPPGNNFTQISEVDT
FT                   NNVGNTVADIIGTSITDVDTSATKGIAIIHATNGNGSWQYSTDNGSNWFDVGVVDDESN
FT                   SLLLGNTDKVRFVPNGIKGTTASIFYRAWDKTSGNAGDKVSTISNGGTSAFSFDFSKSN
FT                   ITVSDVNYAPTLTSVATLNGLDKTNTITYADLVAAADEADSDGDTVSFRIEGVNTGNLL
FT                   KNGLPVATGVTTIGPGESLSWTVANNTSGLINAFTVKVFDGTATSSTAVQVKVNVQDTT
FT                   PPVIPGANCPNDGTYLVGNTLNFGVFSNEVLFVTEGATGKPYLEILLGKGTANARTVRA
FT                   EYVSGSGTNTLNFAYTIVSGDSSGQYETELNPMIQLNNCTIMDTSGNNVVSSFSNYDLS
FT                   RVIVDTFAPVWRTGYPKVDTITSNSIKVVMQSIDETGTAYYVCLPNNSGEPSVAQVKAG
FT                   QDATGSPLVSSLSGSSPVNITSDTFFTVSSLAVAADYDIYVVVEDAFGNIVTTNKRIDA
FT                   KTKTIPIADFSISSKTANTASLTWTSAIGTSGIVVEQALVGTVNWIPAVTGPLALNAST
FT                   AKVIGLAANTAYKFRLIVTGGVNEGISNVVTVSTDELPLVISVAGPSNSTYKVGDILDF
FT                   KVTYDKNVTILGGTPSLKLAIGSNAREATYKSGSGSSVLSFRYTIQAGDLDTNGITFAS
FT                   SNISLNGATIRSTANEDANLSLNGVVNLSGVLVDGVSPMVTSLSLPINTTYKTADAIYV
FT                   TANFDESVFILPGPTGVPYIELTIGTKKVKAQYYSGSGSQTIKFAYTVASGEVDSDGID
FT                   IATIINPNTGSIKDNIGNEAVYAYTNVNSSGLFVDAVAPTLTNSVISSDKKTIILSFSK
FT                   NLVSAVADFGSVVNLSTDGGLIYKPVSSLANINGLDINGKDIVITFDTPLTGSKNKVAI
FT                   GANSIKDVLGNLQTNVIETGNLGLAKPIAVKVPTVGVYKAGSQLNFTVVFDENVIVDTS
FT                   LGTPTLQLTVGSTSREAVYFSGNGSNEITFAYTVEAGDNDNDGIKIASTAIELNGGTIK
FT                   NSSNDNADLILNNIQDSSVVKIDTKSPTITSLTLPLNKTYKVGEAIQIIVNFDELILQM
FT                   APTTITIKVGDKSIAVPCITPPPGPVNAMVFIYNVTAGDIDEDGISLGNIIYYIGTVKD
FT                   MAGNDAILSYSSVDTSGILVDAVAPKFVGVELNPDKKIVTLSFDEDIVDVTGSLLEDSV
FT                   YLSTNGGTTYSQFSSLANKGSISINGKDLIVDFITPLDGSKNKIKVVENSIKDVFQNIK
FT                   TDVTETSNLGTTISIAMDEPFTEQNLNGRVLTINIDGETFKDASLDKANFIINNAPKGV
FT                   TVKAVTYTDSTHGLITLSYDGSDMDSFITNVGVTVLGSELTKGKDIKTNGIVIKVMDDP
FT                   EAISIKNLSPIKEREEDKQVITVNITGGQFNDGLNKDNWTVTNLPAGVTVGSVTKVNAN
FT                   TAEIVLVGNSTDDYDSDINNVTVSCGTSEYNDSTGGSSLIADTGVTFTAKTIGVVTTNS
FT                   IASIGKTSATLSGDVISSGDGTIKEKGFIYRISTEATGAKKVVSNENTLGQFIASLTGL
FT                   KANTTYYVKAYVENEEGISYGSEMSFTTMPYSTNAKLKNLESSSGTLTPKFDTDTKNYT
FT                   AVVDYTVDSIIITPTLAEEKVVMPSTMSFASILKDTNIATATIKVNGVLVNSGQPSQSI
FT                   SLKEGDNTITTIVTAEDGVTTETYTLVVTKKPAPTVVKGKVVDSDGKVVDTIEVKVTTE
FT                   LDGTLTAGLKAKEILFINTASGNNSVLEDLLKLSIDTNSDSKGSILQDGTVKFSSLEKG
FT                   KNYEYKVICSIGKFKMELGIIRIKVDNNGNVELTSTLIDPYGVITDAKSGKVIDGVNVV
FT                   VFYADTQRNKDAGIVPNTEVSLPIISGFAPNDNKNPQISDSFGSYAFMVYPNTDYYIVA
FT                   TKDGYEKYTSPIISVEKEIVKWDFKMNPLENNTTFVTNPDTSMPATGSAIDKKVLVEVG
FT                   IVLILVGIVSVFTSVRISRKKKSNNK"
FT                   /protein_id="YP_003841575.1"
FT   gene            complement(38143..38301)
FT                   /db_xref="GeneID:9606838"
FT                   /locus_tag="Clocel_0021"
FT                   /pseudo
FT   gene            38696..44623
FT                   /db_xref="GeneID:9606839"
FT                   /locus_tag="Clocel_0022"
FT   CDS_pept        38696..44623
FT                   /locus_tag="Clocel_0022"
FT                   /gene_family="HOG000165018" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Pjdr2_1410"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pjd:Pjdr2_1410 S-layer domain protein"
FT                   /db_xref="GI:302872943"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="GeneID:9606839"
FT                   /translation="MRRRKRKRILAEFLALTLLINMFFTGVTQEIAYAASGTITFNTTD
FT                   GTSMGSLLLDGQWNSTDISGIDLKFFNANNASDATNEVLAGGFIYSVDYSGIVAMDAST
FT                   GTQYQYTVIKAGNGSKFSLNAIYLNDWVGGMGATIECYDGNMFLGSDNINADGGILFHT
FT                   SSVSNPSKYQAITEIRISNSSDVTYGNPVAINNISIGDPIIPNAAPILNPISPTMPNIT
FT                   EDSTISGGQVISSFIGTSITDSDVGAKKGIAIISTDNQNGAWQYSVDGIFWNGISSVSN
FT                   TSALLLRVEDKVRFVPNGKNGSSSPAKITYKAWDQTYGTDGSRADCSLSGGSSAFSVNS
FT                   DTVSLNITNVNDAPVLTTGHNFTSISESDINNPGNSVADIAGTSITDVDINSAKGIAIN
FT                   SSNNGNGVWQYSIDGGSNWTNIDVVNSANSLLLRDIDRVRFVPNGMKGTTASITYRAWD
FT                   TTTGTYGIKQSSAAYGGSTAFSSATNSASISVSNINYPPTLTSVNDLNGVDKTNTITYA
FT                   DLSAAADEVDSDGDTISFRIEALNTGTLRKNGNLSVTAGVTTIGPGESLSWTVPNNTNG
FT                   LLNAFTIKAYDGTVASNTAVQVKVNVQDTTKPVINLVDRPSDGAYVVGNTLVFSIHSTE
FT                   NLYLTQNGVGVPYLDVKLGVNIVRAYYVSGAGTSTLTFVYNVVDGDYSGLNETIITPKV
FT                   QVNDYFIKDIAGNNLVVDFAACDLSQVKVDTLAPTWAASYPKTNIITSSSIEVAMKTAD
FT                   ELGTAYYVCLPSGSMEPTLAQVVAGQDAVGNLLQSNLKGYTAINKISDTFFNVDSLAPV
FT                   TDYDIYIVAVDSLGNAKKTVTSAKTKSIPITDLSPSSKTANTVTLTWTSAIGASGIIIE
FT                   QSLVSLEDWVPATTGPLALSADTAKIIGLVANTDYKFRVVVIGGVNEGISNAVTVATDE
FT                   LPLVTSVTGPSNGTYKEGDILNFIVTYDKNVTILGGTPSLNLIIGSNTREATYKSGSGS
FT                   GVLSFSYTIQAGDLDTDGITLASNNISLNSSVIRNNYDEDASLVLNGVANFSGVLIDGV
FT                   APTVTTVSLPASTTYKAGDQIYVIANFDKCVFIMPGSSGIPYIELTVGAKKIRAYYYSG
FT                   SGSQNIKFACTVASGNFDGDGIDIGTTIASNTGVIKDYAGNEAVYTYSSVDSSGLLVDA
FT                   VAPIFKGAVISTDKKSITLTFDEDITSKVADLGSQISLSSDGGANWIMFNSLANKDAMT
FT                   ISEKDLILTFNSPLIGSKNKISILQNTIKDLFENIKTSNTETGNLGSSIEAKEDAALVE
FT                   DKLDGRVINLAITGDNFKNNDLDKTNFILNNVPKGVTIKTVGYIDSTHCLVILSYDGSD
FT                   FDADINNLSITVDTSELVGSPSIVTNNMIVTAINDDEKISIKNSSTIKEGAEDQTIITV
FT                   TLTGGQFADTLNESNWTVSNLPLGVNKGVVTRVDSHTVEITLVGNTTEDYDNDITNVSV
FT                   TCTSSEYTDSTSGNSLVANTGVVLSAKTAAIVITNPVTELGKTSVRLNGNITSSGNAII
FT                   KEKGFLYIEQKDPVEVKKVVSTEDSIGEYSTTLSNLIPNTVYEARAYVENEEGIWYGDV
FT                   ISFTTMPYSTNAKLKNIETNSGTLSPIFNSETKAYTAIVEYDVDNITVVPTVEDTGLAA
FT                   IKVNDISVDSGKPSQDISLKTDKNTITILVTAEDGITTDTYTLDVYKKLQPILVEGKII
FT                   DKDGNNVDKAKVTVRPELDGTYTVEVKSNEALLIKTASGTKTTIKDYSKLKFISTSGPE
FT                   GSISGDGNIKFSSLEKGKTYEYNAICKVGNSEIVIGKIKVQISDSGNVEVISDLIDPYG
FT                   TITDATSGKVIDGVSVVLFYSDTARNRVAGIEPNTEVLLPIIDGFAPNDNKNPQISDSF
FT                   GSYAFMVYPNTDYYIVATKDGYEKYISPTISIEKEIKKWDFKMNPIVPSKPTKPSTPVS
FT                   TDKETVIPATGSPIDTKVLVIVGIVFVVAGFAISKKKKSNKK"
FT                   /protein_id="YP_003841576.1"
FT   misc_feature    41216..41479
FT                   /note="Fibronectin type 3 domain; One of three types of
FT                   internal repeats found in the plasma protein fibronectin.
FT                   Its tenth fibronectin type III repeat contains an RGD cell
FT                   recognition sequence in a flexible loop between 2 strands.
FT                   Approximately 2% of all...; Region: FN3; cd00063"
FT                   /db_xref="CDD:28945"
FT                   /locus_tag="Clocel_0022"
FT   misc_feature    order(41399..41401,41444..41446)
FT                   /note="Interdomain contacts; other site"
FT                   /db_xref="CDD:28945"
FT                   /locus_tag="Clocel_0022"
FT   misc_feature    order(41447..41452,41453..41458)
FT                   /note="Cytokine receptor motif; other site"
FT                   /db_xref="CDD:28945"
FT                   /locus_tag="Clocel_0022"
FT   gene            complement(44716..46443)
FT                   /db_xref="GeneID:9606840"
FT                   /locus_tag="Clocel_0023"
FT                   /pseudo
FT   gene            46913..47644
FT                   /db_xref="GeneID:9606841"
FT                   /locus_tag="Clocel_0024"
FT   CDS_pept        46913..47644
FT                   /locus_tag="Clocel_0024"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04854"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF624; KEGG:
FT                   bcl:ABC0559 hypothetical protein"
FT                   /db_xref="GI:302872944"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="GeneID:9606841"
FT                   /translation="MRSKASREEQKQFGDNIFTTIMNYVYWFLAGSGLFIISNILFIAC
FT                   MFFVLTTAALGYQIDIISALILLLSAISLGPSITALMGTMGKLVREQDVKIFSEYIRSY
FT                   KLNFKQSISLWAIQLLVIGILVIDYKIFISTSYGRFLIPAVFIIIFLLVNMYIYMFSLM
FT                   SRFFYKSRDLIKISFFYTISKVKNTAINSVIVIVATILIFQYSNIVLFFIPAVMIYGIM
FT                   FNQKSLFESIENKIDEKKSTF"
FT                   /protein_id="YP_003841577.1"
FT   misc_feature    47135..47629
FT                   /note="Protein of unknown function, DUF624; Region: DUF624;
FT                   cl02369"
FT                   /db_xref="CDD:154877"
FT                   /locus_tag="Clocel_0024"
FT   gene            complement(47757..49247)
FT                   /db_xref="GeneID:9606842"
FT                   /locus_tag="Clocel_0025"
FT   CDS_pept        complement(47757..49247)
FT                   /locus_tag="Clocel_0025"
FT                   /gene_family="HOG000050303" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /codon_start="1"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /transl_table="11"
FT                   /note="KEGG: cce:Ccel_0493 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   SMART: chemotaxis sensory transducer"
FT                   /db_xref="GI:302872945"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="GeneID:9606842"
FT                   /translation="MKNETQKGHNVKKAHLVNISVIVFLSILLMMISIVGVGLSFATPI
FT                   IIETISVWIIIGVIYHIKIKDNIKALIFSIIPLIISTLQFIVGKSNPIGNHYLIALSIA
FT                   MIALYFNDKLILIHQVITNVLFIYLFIGYRSNLLPISSGNIWVFWYLILCLNSILTILY
FT                   FLTKWGKETVNEAIKKEKISQDLSAKLNASLKEIKSGTNLLNKTVVDFERSISSSRESI
FT                   SNMNTAMHEMASGINEQAEDLNSINEEMNLAADNLLKNEKISTTVNVEVSKTTEQVTEG
FT                   SSKVKEMNAQMDIIYQAVNTSFNTVSDLETKILEINQYLDSINQIAEQTNLLALNAAIE
FT                   AARAGENGKGFAVVAEEVRKLAEQSSTTVKDINLIINTINEQTKLVVDKVKLGDTAVET
FT                   GKKLISEVSENFSVIEKKFVTANRLFGEGANVSSETSKNFMSTLQKINSIATISEQHAA
FT                   TVQELSATAESTNSDIIKINASVNEIKTLSESLEKMTN"
FT                   /protein_id="YP_003841578.1"
FT   misc_feature    complement(47793..48569)
FT                   /note="Methyl-accepting chemotaxis-like domains (chemotaxis
FT                   sensory transducer); Region: MA; smart00283"
FT                   /db_xref="CDD:128579"
FT                   /locus_tag="Clocel_0025"
FT   misc_feature    complement(47793..48392)
FT                   /note="Taxis toward Aspartate and Related amino acids and
FT                   Homologs (TarH). The Tar chemoreceptor of Escherichia coli
FT                   mediates attractant responses to aspartate, maltose, and
FT                   phenol, repellent responses to Ni2+ and Co2+, and
FT                   thermoresponses.  These...; Region: TarH; cl00144"
FT                   /db_xref="CDD:153541"
FT                   /locus_tag="Clocel_0025"
FT   gene            complement(49594..51084)
FT                   /db_xref="GeneID:9606843"
FT                   /locus_tag="Clocel_0026"
FT   CDS_pept        complement(49594..51084)
FT                   /locus_tag="Clocel_0026"
FT                   /gene_family="HOG000050303" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /codon_start="1"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /transl_table="11"
FT                   /note="KEGG: cce:Ccel_0493 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   SMART: chemotaxis sensory transducer"
FT                   /db_xref="GI:302872946"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="GeneID:9606843"
FT                   /translation="MKHEISTGHSIKKAHLVNISIIIVLSLLLLTISIVGVGITFAIPV
FT                   LLQVIAAWIVVATVYFLKINDNIKAVIFSVLPLIISALQFMKGASNPIGNHYLIALSIA
FT                   MIALYFNNKLIVIHQIVTNVLFLYLYIAHRPKLLPHSSGDIWVLLYLIICINSILVLLY
FT                   FLTKWGKGTVNEAINKEKISEELSGKLNTSLEEIKNGSNLLNKTVIDFDRNIASSKEAI
FT                   STMNTAMHEMANGINEQAENLNSVNEEMNIAAENVLKTEKISASVNLESAKMTEQVTEG
FT                   SSKIKEMNTQMDIIYQAVNTSFNTVSDLETRIIEINQYLNSINEIAEQTNLLALNAAIE
FT                   SARAGEHGKGFAVVAEEVRKLAEQSSTTVKDINTIINTINEQTKLVVDKVKLGDNAVAS
FT                   GKKLISEVSKNFSVIEKRFINSNKLLEEGANISSETSKVFMKTLEKINSIAIISEEQAA
FT                   TVEQLSATTENTNGDIIKIINSVNEIKTLSESLEKMTS"
FT                   /protein_id="YP_003841579.1"
FT   misc_feature    complement(49630..50406)
FT                   /note="Methyl-accepting chemotaxis-like domains (chemotaxis
FT                   sensory transducer); Region: MA; smart00283"
FT                   /db_xref="CDD:128579"
FT                   /locus_tag="Clocel_0026"
FT   misc_feature    complement(49618..50229)
FT                   /note="Taxis toward Aspartate and Related amino acids and
FT                   Homologs (TarH). The Tar chemoreceptor of Escherichia coli
FT                   mediates attractant responses to aspartate, maltose, and
FT                   phenol, repellent responses to Ni2+ and Co2+, and
FT                   thermoresponses.  These...; Region: TarH; cl00144"
FT                   /db_xref="CDD:153541"
FT                   /locus_tag="Clocel_0026"
FT   gene            complement(51391..52884)
FT                   /db_xref="GeneID:9606844"
FT                   /locus_tag="Clocel_0027"
FT   CDS_pept        complement(51391..52884)
FT                   /locus_tag="Clocel_0027"
FT                   /gene_family="HOG000050303" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /codon_start="1"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /transl_table="11"
FT                   /note="KEGG: cce:Ccel_0493 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   SMART: chemotaxis sensory transducer"
FT                   /db_xref="GI:302872947"
FT                   /db_xref="GO:0004871"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="GeneID:9606844"
FT                   /translation="MNTETSISYNIKTVHLVNITVIVILSLLLFGLAYVGLGLSYALFV
FT                   LAQNSVIWAIVAAIYFSKINDNIKAMIFSLIPLLTGAAAFLKATSTPLGNHYFIFLSIA
FT                   MIALYFNNKLIAIHQVLTNLTYILLYIISGPRLLIDPNGTIWSFIYILVCANGVLALLY
FT                   FLTKWGKALVTEAVRKEKVAGELSLKLNASLEEIKKGSTLLNNTIIDFDKNISSSKEAI
FT                   SNMNIAMQEMASGVSEQAENLSSINEKMNIATENVLKTEKISSNVSTESSKMSEQVIEG
FT                   SSKIKEMNTQMDIIYQAVNTSFNTVSDLETRIIEINQYLNSINEIAEQTNLLALNAAIE
FT                   SARAGEHGKGFAVVAEEVRKLAEQSSTTVKDINTIINTINEQTKLVVDKVKLGDTAVES
FT                   GKKLIAEVNDNFTVIADNFIKTNRLLDEGAKVSSETSKEFMAMLEKVNSIAAISEQQAA
FT                   TIEELSATAENTNADIIMISDSVNEIKNLSNSLDMMSIK"
FT                   /protein_id="YP_003841580.1"
FT   misc_feature    complement(51430..52203)
FT                   /note="Methyl-accepting chemotaxis-like domains (chemotaxis
FT                   sensory transducer); Region: MA; smart00283"
FT                   /db_xref="CDD:128579"
FT                   /locus_tag="Clocel_0027"
FT   misc_feature    complement(51481..52029)
FT                   /note="Taxis toward Aspartate and Related amino acids and
FT                   Homologs (TarH). The Tar chemoreceptor of Escherichia coli
FT                   mediates attractant responses to aspartate, maltose, and
FT                   phenol, repellent responses to Ni2+ and Co2+, and
FT                   thermoresponses.  These...; Region: TarH; cl00144"
FT                   /db_xref="CDD:153541"
FT                   /locus_tag="Clocel_0027"
FT   gene            53384..55000
FT                   /db_xref="GeneID:9606845"
FT                   /locus_tag="Clocel_0028"
FT   CDS_pept        53384..55000
FT                   /locus_tag="Clocel_0028"
FT                   /gene_family="HOG000003672" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00704"
FT                   /codon_start="1"
FT                   /product="Na/Pi-cotransporter II-related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cbk:CLL_A0275 Na/Pi-cotransporter family
FT                   protein/PhoU family protein; TIGRFAM: Na/Pi-cotransporter
FT                   II-related protein; PFAM: Na+/Picotransporter; PhoU family
FT                   protein"
FT                   /db_xref="GI:302872948"
FT                   /db_xref="InterPro:IPR003841"
FT                   /db_xref="InterPro:IPR004633"
FT                   /db_xref="InterPro:IPR008170"
FT                   /db_xref="GeneID:9606845"
FT                   /translation="MDIEKLIIQLIGGVGLFLYGMRLMGDGLENSAGDRLKDILEKVTK
FT                   RPIIAVGVGAIITAIIQSSSATIIMVVGFVNVGLISLMQATWIIMGANIGTTITTQLFT
FT                   FRLEYIAPILVGIGAIAVLFTKGRKRRGIEHVVLGFGMLFMGMGLMTNALRPIAHTSEF
FT                   NNIILAVGDKWIIGIFIGFCLTAVVQSSAATTGILIALAGTDQISINIAIPILFGCNIG
FT                   TCVTTLISSIGTSKKARKAAFIHLIYNVMGTIIFIPLMGTLAKIVVNINPDNVGRQIAN
FT                   AHLIFNIVNTVILLPLTKYLIMIVEKLIPGEDELKIIGPKFIDDRLLETPVIAAGQVIK
FT                   ETIRMANTARMNLEIAMEAFINKDEKLVKSVYENEKIINNLEEEITRFLVLLSKCDLSD
FT                   KESAIVSSTFHIVNDIERIGDHAENIVELASKRILKNIQYSEESLGELKNIYNYTLTAL
FT                   KVAIESYAIGDFRKAESVNDLEVRIDESFRIYSKNHIRRLNNDRCTAYAGVVFMDLLSN
FT                   FERIGDHSVNIAGIVIENASV"
FT                   /protein_id="YP_003841581.1"
FT   misc_feature    53384..54988
FT                   /note="Na+/phosphate symporter [Inorganic ion transport and
FT                   metabolism]; Region: NptA; COG1283"
FT                   /db_xref="CDD:31474"
FT                   /locus_tag="Clocel_0028"
FT   misc_feature    53429..53794
FT                   /note="Na+/Pi-cotransporter; Region: Na_Pi_cotrans;
FT                   pfam02690"
FT                   /db_xref="CDD:145706"
FT                   /locus_tag="Clocel_0028"
FT   misc_feature    53876..>54157
FT                   /note="Na+/Pi-cotransporter; Region: Na_Pi_cotrans;
FT                   pfam02690"
FT                   /db_xref="CDD:145706"
FT                   /locus_tag="Clocel_0028"
FT   misc_feature    54410..54670
FT                   /note="PhoU domain; Region: PhoU; pfam01895"
FT                   /db_xref="CDD:145194"
FT                   /locus_tag="Clocel_0028"
FT   misc_feature    54722..54979
FT                   /note="PhoU domain; Region: PhoU; pfam01895"
FT                   /db_xref="CDD:145194"
FT                   /locus_tag="Clocel_0028"
FT   gene            complement(55164..56021)
FT                   /db_xref="GeneID:9606846"
FT                   /locus_tag="Clocel_0029"
FT   CDS_pept        complement(55164..56021)
FT                   /locus_tag="Clocel_0029"
FT                   /gene_family="HOG000049990" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, AraC family"
FT                   /transl_table="11"
FT                   /note="KEGG: gym:GYMC10_3909 transcriptional regulator,
FT                   AraC family; PFAM: Cupin 2 conserved barrel domain protein;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="GI:302872949"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="GeneID:9606846"
FT                   /translation="MAEMKLSYFTNDEGFPFFIQYGYHSNNLSIHTHTDFSELVIVMNG
FT                   TATHIVDNEKFNIKKGDVFVINSNTCHGYENAKDFRICNIMYRSENLLLADYDIKKNAG
FT                   FHALFVIEPYFTKEHSFKSNLTLKPLDFEKIHILLDSLLSEYMTKTDGWKTSTKALFML
FT                   LVVTLARLYDFGNSSEKVDVINIAKSISYIENHYTEDISIDLLAKISHYSPRHFARIFS
FT                   ETYSTTPLNYIISLRIRRACSLLKETTLPISTIAIQCGFSDSNYFSRIFKKNLYLTPKQ
FT                   YRTS"
FT                   /protein_id="YP_003841582.1"
FT   misc_feature    complement(55782..>55940)
FT                   /note="Cupin domain; Region: Cupin_2; cl09118"
FT                   /db_xref="CDD:175009"
FT                   /locus_tag="Clocel_0029"
FT   misc_feature    complement(55173..55931)
FT                   /note="transcriptional activator RhaS; Provisional; Region:
FT                   PRK13503"
FT                   /db_xref="CDD:172090"
FT                   /locus_tag="Clocel_0029"
FT   misc_feature    complement(55170..55274)
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="Clocel_0029"
FT   gene            56147..57478
FT                   /db_xref="GeneID:9606847"
FT                   /locus_tag="Clocel_0030"
FT   CDS_pept        56147..57478
FT                   /locus_tag="Clocel_0030"
FT                   /gene_family="HOG000027397" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:3.2.1.37"
FT                   /codon_start="1"
FT                   /EC_number="3.2.1.37"
FT                   /transl_table="11"
FT                   /note="KEGG: family 43 glycosyl hydrolase; PFAM: glycoside
FT                   hydrolase family 43"
FT                   /db_xref="GI:302872950"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="GeneID:9606847"
FT                   /translation="MPNPYLPLWEYIPDGEPRVFGERIYVYGSHDNAGSDKFCDFKLKV
FT                   WSAPLDDLNNWTCHGHIFHTRDDRDHKSDTPWTDGDLYAPDVVQKDGKYYLYAYIMGAK
FT                   GCVAVSDRPEGPFELLSKYKYEVVEGEGNDSFNGGWFIDPGVLVDDDGRVYVYCGYESS
FT                   FVAEINPDNMYEIIDGTYQKDIIPIEEPFRFFEACSPRKIEDTYYLIYSPRVGSRLVYA
FT                   TSKSPTGPFEYRGVIVDNGVNYPGGNNHGSICNINNQWYIFYHRMTNGTVMSRRACVEK
FT                   IELLSDGTIPEVEMTSLGFENSLSPYKMTPAEIACVLKGGCFITERNLASRPVTAIISG
FT                   CIIGYKYFDFGEDFSTETMKFSAVVKGTGCKAKIKILLDDYENGEEIGVCEIGADDGVY
FT                   TAIVKNVTGRHALYFLVEDSFGGWFTDMFKGRHLFELESFVFMK"
FT                   /product="Xylan 1,4-beta-xylosidase"
FT                   /protein_id="YP_003841583.1"
FT   misc_feature    56273..57016
FT                   /note="Glycosyl hydrolases family 43; Region:
FT                   Glyco_hydro_43; cl09152"
FT                   /db_xref="CDD:158437"
FT                   /locus_tag="Clocel_0030"
FT   gene            57755..60652
FT                   /db_xref="GeneID:9606848"
FT                   /locus_tag="Clocel_0031"
FT   CDS_pept        57755..60652
FT                   /locus_tag="Clocel_0031"
FT                   /gene_family="HOG000031216" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:3.2.1.21"
FT                   /codon_start="1"
FT                   /EC_number="3.2.1.21"
FT                   /transl_table="11"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   Carbohydrate binding family 6; KEGG: bha:BH1908 glucan
FT                   1,4-beta-glucosidase; SMART: cellulose binding type IV"
FT                   /db_xref="GI:302872951"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR006584"
FT                   /db_xref="GeneID:9606848"
FT                   /translation="MTTERMENNKILYPFRNPNINIEERLDDLISRLTLEEKIHVLPGY
FT                   QAPIERLGIQAYYVGGEGAHGLVRRQGKLTGPTTVFPQPIGLSSTWNPNLMSEIGKVIS
FT                   DEARAYYKKSDKIAGLNIWAPTVDMERDPRWGRTEEAYGEDPYLTGKLSAALTKAERGE
FT                   DPFYLKMVPTLKHFYANNYEKERISCSSSIDPRNKYEYYLKAFKPSIVEGGAQSIMTSY
FT                   NAINGIPGMVNPEIQTILKDQWGLESFTVSDGGAVCQVVDYHKYFVSHAETIASSIKAG
FT                   LDSFTDNPDMVVAAARDAMERGLMTEDDLDKAVRNIFRTRIRLGQLDPEGYDPYDYISD
FT                   EVICSEENSKVALKAAREAMVLLKNENNILPLNKEKLKKVAVIGPLADELLMDWYSGIH
FT                   PYKVTPLEGIKKKLQEVQVTYSDGADIVTLTSLLNNKLIAQYQDNENILYANKTELCDE
FT                   ALFKHIDWGWGSHTLRSKANNKYMSSKRDKEGILAADQEEAFGWFVKELFNFDRDSDNN
FT                   YYLRTWNWENIGVGEDEKLFINTGKPKVEVDKYKFKKSLISSGIEEATSAAKDADVAIV
FT                   VVGNNPVINGKEEVDRKDIILPPSQQELIKAVYETNKNTIVVIVGTYPFAINWEQENIP
FT                   AIMFTASGGQELGTAIADSIFGDYAPAGRLSMTWYKSIEQLPDITDYDIIKGKRTYMYF
FT                   DQEVIYPFGHGLTYPNFEYKDLLIKSKNYTNNDTIEVSCDIINTGNIDSDEVAQLYVSA
FT                   IKSRIVRPIRELKGFERINIKAGEKKTVNFKVKVEDLAIWDVTRNKYCVEAGEYKFEIG
FT                   TSSKDIKLEGNVYIDGEIIPSRDLSLKTRAENYDDYNKVILKNCIKGGTCVSNIDNNSW
FT                   LCYKDVDFSLSYSTFMAQVANDTTKAIIEVRIDSLEGEVIGTLEVPSTGGLQNWIINSC
FT                   EIKNITGIHDVYFTFNVGDRFNGELRISYFQFITG"
FT                   /product="Beta-glucosidase"
FT                   /protein_id="YP_003841584.1"
FT   misc_feature    57893..58603
FT                   /note="Glycosyl hydrolase family 3 N terminal domain;
FT                   Region: Glyco_hydro_3; cl07971"
FT                   /db_xref="CDD:174900"
FT                   /locus_tag="Clocel_0031"
FT   misc_feature    58832..>59029
FT                   /note="Glycosyl hydrolase family 3 C terminal domain;
FT                   Region: Glyco_hydro_3_C; pfam01915"
FT                   /db_xref="CDD:145207"
FT                   /locus_tag="Clocel_0031"
FT   misc_feature    <59513..59878
FT                   /note="Glycosyl hydrolase family 3 C terminal domain;
FT                   Region: Glyco_hydro_3_C; pfam01915"
FT                   /db_xref="CDD:145207"
FT                   /locus_tag="Clocel_0031"
FT   misc_feature    60251..60640
FT                   /note="Carbohydrate binding module (family 6); Region:
FT                   CBM_6; cl02697"
FT                   /db_xref="CDD:155061"
FT                   /locus_tag="Clocel_0031"
FT   gene            60745..63177
FT                   /db_xref="GeneID:9606849"
FT                   /locus_tag="Clocel_0032"
FT   CDS_pept        60745..63177
FT                   /locus_tag="Clocel_0032"
FT                   /gene_family="HOG000218307" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06165"
FT                   /codon_start="1"
FT                   /product="glycosyltransferase 36"
FT                   /transl_table="11"
FT                   /note="PFAM: glycosyltransferase 36; glycosyltransferase 36
FT                   associated; carbohydrate binding; KEGG: cth:Cthe_0275
FT                   cellobiose phosphorylase"
FT                   /db_xref="GI:302872952"
FT                   /db_xref="InterPro:IPR009342"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR010403"
FT                   /db_xref="GeneID:9606849"
FT                   /translation="MKFGFFDDANREYVINTPKTPYPWINYLGSEEFFGIISNTSGGYC
FT                   FYKDAKLRRLTRYRYNNVPIDNGGRYFYVNDGGDVWSHTWKPVKKELSAYECRHGLGYS
FT                   KFTGERNGVKVSQLSFVPLGMNAEVHQIKVKNTSDTDKAVKLFSFIEFCLWDAGADGEN
FT                   FQRNFSTGEVEIQGSVIYHKTEYRERRNHYSFYSVNTEIAGFDTDRDSFIGLYNGFEAP
FT                   DVVMAGESKNSVASGWAPVASHGINVELKAGEEKSYVFVLGYVENKDEEKWESKGVINK
FT                   TKAKEMIEALADDAAVEKALAELKKYWDGLLSNYTLNSDDEKLNRMVNIWNPYQCMITF
FT                   NMSRSASYFESGIGRGMGFRDSNQDLLGFVHQIPERARERIIDIASTQFEDGGCYHQYQ
FT                   PLTKKGNNDIGSGFNDDPLWLILGVTAYIKESGDMGILDEIVPFDNDLNNTATLMGHLK
FT                   VSFDHVINNRGPHGLPLIGRADWNDCLNLNCFSATPGESFQTTENKEGGVAESVLIAGM
FT                   FVFIGKEYVALCKEIGDLEEAARAQKHIDEMTEAVLTHGYDGEWFLRAYDFYGNKIGSN
FT                   ENEEGKIFIESQGFCVMGGIGVENGLAEKAMNSVIERLDTKYGIVLNNPAFTKYHLEMG
FT                   EITSYPEGYKENAGIFCHNNPWIACAETVIGRGDRAFEVYRKIAPAYLEEISDIHKTEP
FT                   YVYSQMVAGKDAVRFGEAKNSWLTGTAAWNFITISQWILGIKPDYQGLRIDPCIPKDWE
FT                   GYSISRKFKGAQYDIVIKNPNKVCKGVASITVDGKAIEGNIVPTFEGGVHSVEVVMG"
FT                   /protein_id="YP_003841585.1"
FT   misc_feature    <60745..63168
FT                   /note="Cellobiose phosphorylase [Carbohydrate transport and
FT                   metabolism]; Region: COG3459"
FT                   /db_xref="CDD:33262"
FT                   /locus_tag="Clocel_0032"
FT   misc_feature    60745..60933
FT                   /note="Putative carbohydrate binding domain; Region: CBM_X;
FT                   pfam06204"
FT                   /db_xref="CDD:148044"
FT                   /locus_tag="Clocel_0032"
FT   misc_feature    60940..61263
FT                   /note="Glycosyltransferase family 36; Region:
FT                   Glyco_transf_36; pfam06165"
FT                   /db_xref="CDD:148020"
FT                   /locus_tag="Clocel_0032"
FT   misc_feature    61288..61554
FT                   /note="Glycosyltransferase 36 associated family; Region:
FT                   GT36_AF; pfam06205"
FT                   /db_xref="CDD:148045"
FT                   /locus_tag="Clocel_0032"
FT   gene            63430..64080
FT                   /db_xref="GeneID:9606850"
FT                   /locus_tag="Clocel_0033"
FT   CDS_pept        63430..64080
FT                   /locus_tag="Clocel_0033"
FT                   /gene_family="HOG000098770" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /codon_start="1"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /transl_table="11"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; KEGG:
FT                   Ser/Thr and Tyr protein phosphatase"
FT                   /db_xref="GI:302872953"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="GeneID:9606850"
FT                   /translation="MEKFKAALKHSWIFFVYAAVGLIYEVVNRPWGEVRNISTALDANI
FT                   PFIKEFIIPYMSWHLFTVGCGIYLLFKDRRNYYKSMYSVIIGLIICYATYIVFQTTVPR
FT                   PTVVGDDILSQFVRKMYSHDKPMNCFPSIHVYTTVLFTYFILITNRLKKYQIAMMVTWA
FT                   VSIVLSTLFVKQHVILDVVGACALVYACVGLVNWFEARNDVKINNTVENEGQV"
FT                   /protein_id="YP_003841586.1"
FT   misc_feature    63529..64026
FT                   /note="PAP2_like proteins, Aur1_like subfamily. Yeast Aur1p
FT                   or Ipc1p is necessary for the addition of inositol
FT                   phosphate to ceramide, an essential step in yeast
FT                   sphingolipid synthesis, and is the target of several
FT                   antifungal compounds such as aureobasidin; Region:
FT                   PAP2_Aur1_like; cd03386"
FT                   /db_xref="CDD:48091"
FT                   /locus_tag="Clocel_0033"
FT   misc_feature    order(63709..63711,63733..63735,63823..63831,63937..63939,
FT                   63955..63957,63967..63969)
FT                   /note="active site"
FT                   /db_xref="CDD:48091"
FT                   /locus_tag="Clocel_0033"
FT   gene            64359..66710
FT                   /db_xref="GeneID:9606851"
FT                   /locus_tag="Clocel_0034"
FT   CDS_pept        64359..66710
FT                   /locus_tag="Clocel_0034"
FT                   /gene_family="HOG000221907" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01055"
FT                   /codon_start="1"
FT                   /product="glycoside hydrolase family 31"
FT                   /transl_table="11"
FT                   /note="PFAM: glycoside hydrolase family 31; KEGG:
FT                   cbe:Cbei_0772 alpha-xylosidase YicI"
FT                   /db_xref="GI:302872954"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="GeneID:9606851"
FT                   /translation="MKFSNGFWLNREGVASFSPEEVYSTSVKGNVITLNTPTHKINHRG
FT                   DTLQGPNITIKISSPIPDVIRVQSFHYMGIVDRGPKFEINNCTDTKFDIVEDETTIKLT
FT                   SGNLNVKIDKKKWKMEFLNKEERLTYSGWRDLSYVKENFRGIAYDKGALEDTYMREQLN
FT                   LSVGELIYGLGERFTPFVKNGQTVETWNEDGGTSGEQSYKSIPFYISNKGYGVFVNSSD
FT                   KVSFEVGTDKVTKVQFAVPGESLDYFIINGPSMKEVLERYTTLTGKPALPPAWSFGLWL
FT                   TTSFTTNYDEETVTSFVDGMAERDLPLHVFHFDCFWMKDFNWTDLEWDSRVFPDPEGML
FT                   KRLKEKGLRICVWINPYIAQESSMFQEGMDNGYLIKRPNGDVWQWDMWQPGMAIVDFTN
FT                   PAACRWFADKLEALLDMGVDCFKTDFGERIPTEVTYFDGSDPVKMHNYYTYLYNKVVFD
FT                   VLEKKRGKDEAVLFARSATVGGQQFPVHWGGDCSANYESMAESLRGGLSLTMSGFGFWS
FT                   HDIGGFESTSTEDVYKRWAAFGLLSSHSRLHGSSSYRVPWLYGEEAVDVVRHFTKLKAS
FT                   LMPYIFNEAYKTSKTGIPSMRSMVLEFQDDPAIGYLDRQYMFGDSILVAPIFNEQGVAN
FT                   YYLPKGTWTNFFTGEKVDGGSWRKETHDYMSIPLMVRPNSIIAVGSENRKSDYDFAQDV
FT                   TLKVYELEEGKGASATVRSMNSEVALEVSAMLSKGEITIDAKGVGKPWSLVLVGVQNVE
FT                   VVEGGSFVIEGSDTKIFPSSNVGKLVIKLK"
FT                   /protein_id="YP_003841587.1"
FT   misc_feature    64359..66698
FT                   /note="alpha-xylosidase YicI; Provisional; Region:
FT                   PRK10658"
FT                   /db_xref="CDD:170607"
FT                   /locus_tag="Clocel_0034"
FT   misc_feature    65157..66089
FT                   /note="YicI alpha-xylosidase is a glycosyl hydrolase family
FT                   31 (GH31) enzyme that catalyzes the release of an
FT                   alpha-xylosyl residue from the non-reducing end of
FT                   alpha-xyloside substrates such as alpha-xylosyl fluoride
FT                   and isoprimeverose. YicI forms a...; Region:
FT                   GH31_xylosidase_YicI; cd06593"
FT                   /db_xref="CDD:133124"
FT                   /locus_tag="Clocel_0034"
FT   misc_feature    order(65298..65300,65415..65417,65622..65624,65628..65633,
FT                   65778..65780,65817..65819,65826..65828,65925..65927,
FT                   66003..66005)
FT                   /note="active site"
FT                   /db_xref="CDD:133124"
FT                   /locus_tag="Clocel_0034"
FT   misc_feature    order(65316..65321,65436..65441,65463..65465,65502..65504,
FT                   65508..65510)
FT                   /note="homotrimer interface; other site"
FT                   /db_xref="CDD:133124"
FT                   /locus_tag="Clocel_0034"
FT   misc_feature    order(65628..65630,65826..65828)
FT                   /note="catalytic site; other site"
FT                   /db_xref="CDD:133124"
FT                   /locus_tag="Clocel_0034"
FT   misc_feature    order(65832..65834,65841..65843,65856..65858)
FT                   /note="homohexamer (dimer of homotrimers) interface; other
FT                   site"
FT                   /db_xref="CDD:133124"
FT                   /locus_tag="Clocel_0034"
FT   gene            66874..68937
FT                   /db_xref="GeneID:9606852"
FT                   /locus_tag="Clocel_0035"
FT   CDS_pept        66874..68937
FT                   /locus_tag="Clocel_0035"
FT                   /gene_family="HOG000031215" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01915"
FT                   /codon_start="1"
FT                   /product="glycoside hydrolase family 3 domain-containing
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: cpy:Cphy_0220 glycoside hydrolase family 3 protein"
FT                   /db_xref="GI:302872955"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="GeneID:9606852"
FT                   /translation="MDIGNKIKELIEMMTLEEKVAMIHGNGLFKTGGVPRLGIPPLIMS
FT                   DGPMGVRRDFYDDNWIAINNTDDFVTYLPSNTALAATWNINLAYKAGQVLGNEARGRGK
FT                   DVILAPGVNILRSPVCGRNYEYISEDPYLTARMAVAIIKGIQENDVAACVKHFAVNNQE
FT                   TNRLKIDVDVDDRALREIYFPAFDAAINEADPYTLMGAYNKLRGIHASHSDYLLNRVLK
FT                   GEWNYGGVVISDWGAVHDTYEAVYNGLDIEMNVTTNFTEYFMADPLIKEVNEGKIEEKS
FT                   LDDKISRILKLMFKLKMFDDNRYDGEYNTLEHKQRVLEIARESITLLKNEGKLLPLDRK
FT                   KIKRLVVIGENGDRIHSPGGDSAAIKALYEVTPLSGIRMKFGGNTKIEYFKGYSSEEKD
FT                   NDKILFDEAVIAAKGADAVVFVGGINHDFDTEGFDKPDLVLPYGQDDLIKELLKVNKNT
FT                   VVVMICGTPVEMSQWLDMAPAVIHSSYAGMEGGTALAEVLLGNVNPSGKLPVTFPKTLM
FT                   DSPAHKIGEFPGEQTVHYKEGLYVGYRYFDTYKVEPLFCFGHGLSYTTFEYSDMEVSKE
FT                   EKDNDIKVIATFKVKNTGTVAGAEVIQGYVRDTESQLERPEKELKAFAKVFLQPQEIKS
FT                   VELEFDKKSFAYYNNEEAIWVCEEGNFELLIAASSQDIRLKDNVSIYKTIKY"
FT                   /protein_id="YP_003841588.1"
FT   misc_feature    66964..67632
FT                   /note="Glycosyl hydrolase family 3 N terminal domain;
FT                   Region: Glyco_hydro_3; cl07971"
FT                   /db_xref="CDD:174900"
FT                   /locus_tag="Clocel_0035"
FT   misc_feature    67846..68502
FT                   /note="Glycosyl hydrolase family 3 C terminal domain;
FT                   Region: Glyco_hydro_3_C; pfam01915"
FT                   /db_xref="CDD:145207"
FT                   /locus_tag="Clocel_0035"
FT   gene            69146..70903
FT                   /db_xref="GeneID:9606853"
FT                   /locus_tag="Clocel_0036"
FT   CDS_pept        69146..70903
FT                   /locus_tag="Clocel_0036"
FT                   /gene_family="HOG000269784" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /codon_start="1"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /transl_table="11"
FT                   /note="KEGG: cce:Ccel_2453 histidine kinase; PFAM:
FT                   histidine kinase internal region; ATP-binding region ATPase
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase HAMP region domain protein"
FT                   /db_xref="GI:302872956"
FT                   /db_xref="GO:0000155"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="GeneID:9606853"
FT                   /translation="MKSLKIFKKVISNMRIRNRLMAIYVIAGLIPLLLVGTYLTISTRN
FT                   IVRERAVSEAEANSDRIVDRIKEITDLASDVSELLYVDKRLQSLVTTQYNEKDRSLILE
FT                   DYEQYTTITEYMNYYASIDDIILYVKNETVLDWSIVKVTDRIAAQPWYQKTIKNGAKIT
FT                   WQYVYDEYLDKYNLALHRVIKNDNGNEIGVLQIKVTEQPLKNIIQDEPFDTFIILNDEV
FT                   IISNDKRTEDVSIANINYKDNGISYIEYGNEKIVAISRNITSNEINSIKVVSMIPLNKI
FT                   YRQSDLKSATGFAIIFISMAISIIIIFKFSNNFSKRVIVFKGEMHKVVSGDFEIIKTLE
FT                   GDDEIAELYDDLYKMIDSIQLLINQVYVEKIQKEQLASKQKDVEFKMLASQINPHFLYN
FT                   TLETIRMKAYCNEQYEIAEIVKILAKIMRRNLEINDNLVSLESEITMIKNYLKIQKFRF
FT                   GDRITYDINIECNIDDYYVLPLLFQPVVENAFVHGFEHKQGIGEIKIIISKDENRLIFS
FT                   IRDNGVGISPETLENLRASISNINYKGKSIGLNNVNHRIKIYYGDEYGVEIFSGLEVGT
FT                   EVKIYLPIN"
FT                   /protein_id="YP_003841589.1"
FT   misc_feature    70295..70543
FT                   /note="Histidine kinase; Region: His_kinase; pfam06580"
FT                   /db_xref="CDD:148281"
FT                   /locus_tag="Clocel_0036"
FT   misc_feature    70586..70891
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Clocel_0036"
FT   misc_feature    order(70595..70597,70607..70609,70616..70618,70697..70699,
FT                   70703..70705,70709..70711,70715..70720,70781..70792,
FT                   70847..70849,70853..70855,70868..70873,70877..70879)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Clocel_0036"
FT   misc_feature    70607..70609
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Clocel_0036"
FT   misc_feature    order(70709..70711,70715..70717,70781..70783,70787..70789)
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Clocel_0036"
FT   gene            70914..72455
FT                   /db_xref="GeneID:9606854"
FT                   /locus_tag="Clocel_0037"
FT   CDS_pept        70914..72455
FT                   /locus_tag="Clocel_0037"
FT                   /gene_family="HOG000269786" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /codon_start="1"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /transl_table="11"
FT                   /note="KEGG: cce:Ccel_2452 two component transcriptional
FT                   regulator, AraC family; PFAM: response regulator receiver;
FT                   helix-turn-helix- domain containing protein AraC type;
FT                   SMART: response regulator receiver; Helix-turn-helix, AraC
FT                   domain"
FT                   /db_xref="GI:302872957"
FT                   /db_xref="GO:0000156"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0043565"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="GeneID:9606854"
FT                   /translation="MLNVLIVDDEPIVREGLKIIIDWNKYGYTVCGEGLDGKDGFEKIL
FT                   TLKPDLVLVDINMPGMNGIEMIKAAKEQGALSKFIVLTGYSQFEYAQNAIKLGVKSYLL
FT                   KPIDEDELIENLKGLYLEIEQEKNKNKYLNLTKKHLRNELLRKIVTGSYLQDDLIEYRE
FT                   ISGQKSDAERFVVSIIDTCVGDETTKPIKIEERIEECLKDKMDIGLCRVEGKYVITFVD
FT                   KSDASIKMLLSSIYNQLVGNKNVSAFIAIGESVEVVEDISKSYKSAKEIIENKFIYDDE
FT                   KIVKYGSTNQGDKDITFGKDDIQALYTSIEIGDMDKLTNTIKLLEKSLINSNLSTEKMK
FT                   GLLIKYFLEIKSQLVASFPEYKDKFPKDDDIINGIYSYANLKTLLQYIKEEFMSMSEVI
FT                   ENNCSDNIMKRIVNYIDRNYYKDIKLEMLAEIFNYNSAYLGKMFKNHTNESFNSYLDKI
FT                   RIENAKKLLTNDSLKVYQVSEKVGYKNIDYFYSKFKRYVGMSPKEYKKLNKCENL"
FT                   /protein_id="YP_003841590.1"
FT   misc_feature    70914..72440
FT                   /note="Response regulator containing CheY-like receiver
FT                   domain and AraC-type DNA-binding domain [Signal
FT                   transduction mechanisms]; Region: COG4753"
FT                   /db_xref="CDD:34367"
FT                   /locus_tag="Clocel_0037"
FT   misc_feature    70926..71270
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Clocel_0037"
FT   misc_feature    order(70935..70940,71076..71078,71100..71102,71160..71162,
FT                   71217..71219,71226..71231)
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Clocel_0037"
FT   misc_feature    71076..71078
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Clocel_0037"
FT   misc_feature    order(71085..71090,71094..71102)
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Clocel_0037"
FT   misc_feature    71226..71234
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Clocel_0037"
FT   misc_feature    72321..72425
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="Clocel_0037"
FT   gene            72635..74287
FT                   /db_xref="GeneID:9606855"
FT                   /locus_tag="Clocel_0038"
FT   CDS_pept        72635..74287
FT                   /locus_tag="Clocel_0038"
FT                   /gene_family="HOG000269498" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: gym:GYMC10_5611 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="GI:302872958"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="GeneID:9606855"
FT                   /translation="MKKTKLLSLLLVSALAVTSLVGCGSKKEEAKTEKDDKAPITFSFY
FT                   SADGVANDFTDPIAKKITEKTGVSLKIDYPVGGNNQKVPLMIASGEYPDLIYAKGDTTK
FT                   LVEAGALVPLDDLIDKYGPNIKKLYGDYLNRLRFSSEDKKIYTLGVYGVNNANWKPDGS
FT                   MQIQNAVLEDAGYPQVKTLDDVYKLIKNYKAKYPTINGQETIGMSLCADDWRWLITVGN
FT                   PSGFVLGQGDNGQWKVDPETYKAEYKFLDPQMKEYYTWLNKLYKEGLLDPESFTQKYDQ
FT                   YIAKLSTGRVLLISDAYWDYKDANISLNANNQANRTFFPLAVTLNDKVKFNMTNAGYSG
FT                   ASGVGITTSCADPERAIKFIDWLCTDEAQILNNWGIEGVNYEIVDGKRVVPQAEKDKKN
FT                   TDKDYGKKTGLGQYGYPFPQYGDGVQDESGQYYTTNSKEDIIADYNEAYKKTLAAYGKK
FT                   MVLDMFPDEKDFPVSDFGAAYNIKIPNDSPITIAQKKADDLSQSKIPQLIMSNNFDADW
FT                   TAYQKDLNTPELQTANEEMTKLIKATVDLWSGK"
FT                   /protein_id="YP_003841591.1"
FT   misc_feature    <73139..73744
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Clocel_0038"
FT   gene            74507..75466
FT                   /db_xref="GeneID:9606856"
FT                   /locus_tag="Clocel_0039"
FT   CDS_pept        74507..75466
FT                   /locus_tag="Clocel_0039"
FT                   /gene_family="HOG000047980" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: gym:GYMC10_5613
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:302872959"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9606856"
FT                   /translation="MENTTVKDEELKFSKKKKIGLKNLIEQKYLIFMSLPFVIWAIIFK
FT                   YVPLWGWTMAFQDYKPAKAFSEQTWVGFKHFKAFITDPEFPKLMRNTLGMSILGIIFGF
FT                   VVPIIFALLLNELRGNKFKRTVQSVSYLPHFVSWVVTASIVTTLLAAPSGPINQLLMNL
FT                   HIISKPIQFLSEPKLFWGIVTVSDVWKETGWNAIIYLAAMTGIDPELYDAAKVDGAGRF
FT                   RRMWNITLPSIKPTIMVLLVMSIGSLINIGFEKQFLLKTPMVMDYANVLDLYALNYGIG
FT                   MFRYSFGTAIGIFKSVISIILIFSANKIAEKWGEGKIL"
FT                   /protein_id="YP_003841592.1"
FT   misc_feature    74585..75460
FT                   /note="ABC-type polysaccharide transport system, permease
FT                   component [Carbohydrate transport and metabolism]; Region:
FT                   LplB; COG4209"
FT                   /db_xref="CDD:33938"
FT                   /locus_tag="Clocel_0039"
FT   misc_feature    74771..>75256
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Clocel_0039"
FT   misc_feature    order(74819..74824,74831..74836,74849..74851,74882..74893,
FT                   74897..74926,74933..74938,74942..74944,75065..75070,
FT                   75080..75082,75086..75088,75095..75100,75104..75106,
FT                   75116..75121,75128..75130,75179..75181,75221..75226,
FT                   75233..75235,75254..75256)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Clocel_0039"
FT   misc_feature    order(74900..74944,75254..75256)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Clocel_0039"
FT   misc_feature    order(75131..75169,75185..75190,75200..75202)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Clocel_0039"
FT   gene            75485..76390
FT                   /db_xref="GeneID:9606857"
FT                   /locus_tag="Clocel_0040"
FT   CDS_pept        75485..76390
FT                   /locus_tag="Clocel_0040"
FT                   /gene_family="HOG000220527" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: dth:DICTH_0039
FT                   transmembrane lipoprotein"
FT                   /db_xref="GI:302872960"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9606857"
FT                   /translation="MEAVKAKKKRDIGAFDIFLYVLMILVMIATLYPFLNVLAISLNDS
FT                   MDTIKGSNFIIPREFTFDNYKEIFKYNNLVSAFFMSVLRTAVGTFTAVICTAMLAYVFS
FT                   RRDYAFNRPVVVLFVITMYVSGGMIPEYMLIKNIGLVGKFSVYIIPALISVFNVIVMRS
FT                   FIDGIPISLQESARIDGANDFVIFYKIIMPLCIPVLATISLFVAVGQWNSWFDTYLYSA
FT                   GKAWLSTLQFEMIKIMDNTNATTAISQAQVNSNSVTNAVVSPQSIRMALTITATVPILL
FT                   VYPFVQKYFVAGMTLGAVKS"
FT                   /protein_id="YP_003841593.1"
FT   misc_feature    75716..>76120
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Clocel_0040"
FT   misc_feature    order(75752..75757,75764..75769,75782..75784,75812..75823,
FT                   75827..75856,75869..75874,75878..75880,75944..75946,
FT                   75950..75952,75959..75964,75968..75970,75980..75985,
FT                   75992..75994,76043..76045,76085..76090,76097..76099,
FT                   76118..76120)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Clocel_0040"
FT   misc_feature    order(75830..75862,75869..75880,76118..76120)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Clocel_0040"
FT   misc_feature    order(75995..76033,76049..76054,76064..76066)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Clocel_0040"
FT   gene            76532..78565
FT                   /db_xref="GeneID:9606858"
FT                   /locus_tag="Clocel_0041"
FT   CDS_pept        76532..78565
FT                   /locus_tag="Clocel_0041"
FT                   /gene_family="HOG000117811" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:3.2.1.23"
FT                   /codon_start="1"
FT                   /EC_number="3.2.1.23"
FT                   /transl_table="11"
FT                   /note="KEGG: gym:GYMC10_5609 beta-galactosidase; PFAM:
FT                   Glycoside hydrolase family 42 domain protein;
FT                   Beta-galactosidase trimerisation domain protein"
FT                   /db_xref="GI:302872961"
FT                   /db_xref="InterPro:IPR003476"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR013738"
FT                   /db_xref="GeneID:9606858"
FT                   /translation="MKNLSSIFYGGDYNPDQWPDEIYQEDMRLFKLAGINIITIPVFSW
FT                   ALLQPSEDEYKFEWLDKILDLAWENGISVCLATSTAAQPSWMSKKYPEMLPVDFYGRRR
FT                   KHGGRVNFCPNNEKYHEFSTKLTGLMAERYKNHPAIALWHIGNEYGNYCYCDKCEEEFR
FT                   NWAKKRYGTIENLNKKWYLNFWGHTIYDWDEIVIPSGLSEVWMDGWTAKTNFQSIAIDY
FT                   NRFMSESVFNCYKAEYDIIKNITPEIPITTNLMGTFKPLDYFKWAEYMDIISWDNYPSL
FT                   TDPMFKTAMRHDLMRGLKDGKPFLLMEQTPSQQNWQPYNSVKRPGVLRLQSYQTLAHGA
FT                   DAIMFFQLRQSIGACEKYHGAVISHAGHENTRVFKELTQIGDELKALGDKTIDSRMQAK
FT                   VAIVFDWENWWAVEFSSGPSKDLNYVEQVEKYYEAFYNMNIAVDMVKPEADLSQYKIVV
FT                   APVLYMLRPGVAKNFESYVENGGTFVTTFFSGYVDETDIVKVGGYPGELRKLLGLWVEE
FT                   IDAIFPDMSNSIVMKETVGKLEKEYISKMLCDILNVETAKVLAVYGKDFYAGKPALTVN
FT                   NFGKGKAYYIATDPEQSFIAGLMEVLCEDNSITAPFQAKAGVEIAQRFKDDKEITFIMN
FT                   YNDEDVVINLKDENYIDLIKNKGKKGEILIKSKDVLVLERKI"
FT                   /product="Beta-galactosidase"
FT                   /protein_id="YP_003841594.1"
FT   misc_feature    76550..78556
FT                   /note="Beta-galactosidase [Carbohydrate transport and
FT                   metabolism]; Region: LacA; COG1874"
FT                   /db_xref="CDD:32058"
FT                   /locus_tag="Clocel_0041"
FT   misc_feature    76565..77692
FT                   /note="Beta-galactosidase; Region: Glyco_hydro_42; cl03154"
FT                   /db_xref="CDD:155315"
FT                   /locus_tag="Clocel_0041"
FT   misc_feature    77729..>78091
FT                   /note="A4 beta-galactosidase middle domain: a type 1
FT                   glutamine amidotransferase (GATase1)-like domain; Region:
FT                   A4_beta-galactosidase_middle_domain; cd03143"
FT                   /db_xref="CDD:153237"
FT                   /locus_tag="Clocel_0041"
FT   misc_feature    78380..78556
FT                   /note="Beta-galactosidase C-terminal domain; Region:
FT                   Glyco_hydro_42C; pfam08533"
FT                   /db_xref="CDD:117110"
FT                   /locus_tag="Clocel_0041"
FT   gene            79044..79808
FT                   /db_xref="GeneID:9606859"
FT                   /locus_tag="Clocel_0042"
FT   CDS_pept        79044..79808
FT                   /locus_tag="Clocel_0042"
FT                   /gene_family="HOG000271392" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01226"
FT                   /codon_start="1"
FT                   /product="formate/nitrite transporter"
FT                   /transl_table="11"
FT                   /note="PFAM: formate/nitrite transporter; KEGG:
FT                   cbk:CLL_A3042 formate/nitrite family of transporter"
FT                   /db_xref="GI:302872962"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="GeneID:9606859"
FT                   /translation="MAEVIHDVCKTAHKKLALYKKGKGRYFVSSALAGLYIGLGIILIY
FT                   TVGGYMHAANSPMTKVAMGAFFGIALSLVMMCGADLFTGNTLVMPIASLEKEVSWKDTF
FT                   KIWGLSYFGNLIGSIVLAFIYKASGLASGHTGEFISEVVATKMTTPYGELIVRGILCNI
FT                   LVCLAVWCTIKLKEETAKLIMIFWCLFAFITSGFEHSIANMFLLATGLLVANDPAVSIA
FT                   GYIHNISAVTIGNIIGGVVFVALAYWYIGKEK"
FT                   /protein_id="YP_003841595.1"
FT   misc_feature    79047..79793
FT                   /note="Formate/nitrite transporter; Region: Form_Nir_trans;
FT                   cl00927"
FT                   /db_xref="CDD:174462"
FT                   /locus_tag="Clocel_0042"
FT   gene            complement(79966..80868)
FT                   /db_xref="GeneID:9606860"
FT                   /locus_tag="Clocel_0043"
FT   CDS_pept        complement(79966..80868)
FT                   /locus_tag="Clocel_0043"
FT                   /gene_family="HOG000282408" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00163"
FT                   /codon_start="1"
FT                   /EC_number="4.1.1.65"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: phosphatidylserine decarboxylase; KEGG:
FT                   cac:CAC0031 phosphatidylserine decarboxylase; PFAM:
FT                   phosphatidylserine decarboxylase-related"
FT                   /db_xref="GI:302872963"
FT                   /db_xref="GO:0004609"
FT                   /db_xref="InterPro:IPR003817"
FT                   /db_xref="InterPro:IPR005221"
FT                   /db_xref="GeneID:9606860"
FT                   /translation="MIKVYNRTTEKYEIEKVAGEKFLNMLYSSPAGKGPLELFIKKKAF
FT                   SRVYGAYNDSFLSKRSIPKFVNSFDIDMDQSVKQLKEFKSFNDFFTRNLVETARPISKN
FT                   NSDFISLGDGRLIAYTNIDMNNLVQVKGLTYSLKDLIKNDTIANKYAGGICLILRLNPT
FT                   DYHRFHFIDSGVCSETTKIKGHYYSVNPIALEKIQRLFCENKREWSIFKSDNFGELLYV
FT                   EVGATCVGSIIQSYKPNKPVARGDEKGYFKFGGSTVILFIEKDKLKLDDDILAQSSLGI
FT                   ETKVSLGETIGCKIQNYNV"
FT                   /product="phosphatidylserine decarboxylase"
FT                   /protein_id="YP_003841596.1"
FT   misc_feature    complement(79981..80868)
FT                   /note="Phosphatidylserine decarboxylase; Region:
FT                   PS_Dcarbxylase; cl03656"
FT                   /db_xref="CDD:174796"
FT                   /locus_tag="Clocel_0043"
FT   gene            81432..81653
FT                   /db_xref="GeneID:9606861"
FT                   /locus_tag="Clocel_0044"
FT   CDS_pept        81432..81653
FT                   /locus_tag="Clocel_0044"
FT                   /gene_family="HOG000277030" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04324"
FT                   /codon_start="1"
FT                   /product="BFD domain-containing protein (2Fe-2S)-binding
FT                   domain-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: BFD domain protein [2Fe-2S]-binding domain
FT                   protein; KEGG: cac:CAC0669 hypothetical protein"
FT                   /db_xref="GI:302872964"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="GeneID:9606861"
FT                   /translation="MDQNIKPEILDKLTKICLCKSISRATIKAAIIKGAKTIEEVNKAT
FT                   GAGTGGCQGRRCGPKIQELLEAHENGEF"
FT                   /protein_id="YP_003841597.1"
FT   gene            81760..81834
FT                   /note="tRNA-Arg2"
FT                   /db_xref="GeneID:9606862"
FT                   /locus_tag="Clocel_R0010"
FT   tRNA            81760..81834
FT                   /db_xref="GeneID:9606862"
FT                   /locus_tag="Clocel_R0010"
FT                   /product="tRNA-Arg"
FT   gene            81936..82379
FT                   /db_xref="GeneID:9606863"
FT                   /locus_tag="Clocel_0045"
FT   CDS_pept        81936..82379
FT                   /locus_tag="Clocel_0045"
FT                   /gene_family="HOG000085050" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /codon_start="1"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /transl_table="11"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   cac:CAC0123 cytosine deaminase"
FT                   /db_xref="GI:302872965"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="GeneID:9606863"
FT                   /translation="MNNNFLKIAIEEAKKARELGEVPVGAVIIKDDKVIAAAHNLKETK
FT                   KEVTAHAELLAIKMASEILDNWRLNDCEIYVTLEPCAMCASAIVQSRIKKIYIGTFEPT
FT                   TGACGSVINLVQNEALNSFVHVEWLYSDECSDIITEFFKERRS"
FT                   /protein_id="YP_003841598.1"
FT   misc_feature    81951..82274
FT                   /note="Nucleoside deaminases include adenosine, guanine and
FT                   cytosine deaminases. These enzymes are Zn dependent and
FT                   catalyze the deamination of nucleosides. The zinc ion in
FT                   the active site plays a central role in the proposed
FT                   catalytic mechanism, activating a...; Region:
FT                   nucleoside_deaminase; cd01285"
FT                   /db_xref="CDD:29828"
FT                   /locus_tag="Clocel_0045"
FT   misc_feature    order(82005..82007,82053..82055,82086..82094,82176..82178,
FT                   82185..82187)
FT                   /note="nucleoside/Zn binding site; other site"
FT                   /db_xref="CDD:29828"
FT                   /locus_tag="Clocel_0045"
FT   misc_feature    order(82080..82082,82095..82097,82107..82109,82179..82184,
FT                   82191..82196,82203..82208)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29828"
FT                   /locus_tag="Clocel_0045"
FT   misc_feature    order(82086..82094,82173..82178,82185..82187)
FT                   /note="catalytic motif; other site"
FT                   /db_xref="CDD:29828"
FT                   /locus_tag="Clocel_0045"
FT   gene            83108..84976
FT                   /db_xref="GeneID:9606864"
FT                   /locus_tag="Clocel_0046"
FT   CDS_pept        83108..84976
FT                   /locus_tag="Clocel_0046"
FT                   /gene_family="HOG000055696" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /codon_start="1"
FT                   /product="amino acid permease-associated region"
FT                   /transl_table="11"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   csc:Csac_0715 amino acid transporter-like protein"
FT                   /db_xref="GI:302872966"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="GeneID:9606864"
FT                   /translation="MDIKSIILGKPLKNSEIKHERLSRLWGLPIMASDAVSSVAYAIEE
FT                   ILLILIPAVGLLSFKLVPSVVIPILILLSILVLSYSQIIDTYPNGGGAYAVAKENMGKT
FT                   PSLLTAAALIIDYIMTVAVSISSASAALSSAFTVLQEHKILVSLICVAFITLMNLRGIR
FT                   EASKVFGLPTYIFIGSMAILIICGVFKMVSGTLNPISYAEPILPAETVKGIGILILLRA
FT                   FSSGCSAMTGVEAVSNAVPSFKDPTTRNAKHILYMLGIIIVFIFGGTSILAVHLNVAPL
FT                   EGHTVLSQISSAVFGNNFMYYIIQIFTALILILAANTAYNGLPQLLYILAHDGYVPRQF
FT                   SSRGTKLSFSNGIVFIFIAASILIIGAKSDVHKLIPLYSVGVFISFTVSQFGMFRRWIR
FT                   NKGKNWHYKAFINGLGSLVTLVVSGIVLFTKFFDGAWMLVIAMPALMVGMYFINKYYTF
FT                   IGRQLTLKTFNPYDKDEVTSTQCILLVHDINKPFLKAMNYANSISDNIVALHVCRHPEH
FT                   AEELRNQWKDLKIPVELVIIETPYRDIIKPMDDYLWKRESQLKHGENISVIMIKFLSTH
FT                   WYDRFLHNQTTYFLEHHLSRHKNVSTVILPFHYKFDKSLLRKHKNS"
FT                   /protein_id="YP_003841599.1"
FT   misc_feature    <83540..84271
FT                   /note="Transmembrane amino acid transporter protein;
FT                   Region: Aa_trans; cl00524"
FT                   /db_xref="CDD:176584"
FT                   /locus_tag="Clocel_0046"
FT   gene            complement(85197..86177)
FT                   /db_xref="GeneID:9606865"
FT                   /locus_tag="Clocel_0047"
FT   CDS_pept        complement(85197..86177)
FT                   /locus_tag="Clocel_0047"
FT                   /gene_family="HOG000276980" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /codon_start="1"
FT                   /product="Rhomboid family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Rhomboid family protein; KEGG: cbe:Cbei_4326
FT                   rhomboid family protein"
FT                   /db_xref="GI:302872967"
FT                   /db_xref="InterPro:IPR002610"
FT                   /db_xref="GeneID:9606865"
FT                   /translation="MNTIINKIIHNLINNYGFVVEKYGDNVNNSDKLVLLKYLPDGIYS
FT                   VIFSNAYDEASNAMFLRKYLLVKGQKFIINNIIFLESTHNYIPSSPFYNYMLIDSKAKI
FT                   ILYSNIAIDSLRSSVENSLFSRKHIKNNLFSSNQITSIIIFLNIVIFLYSSYINGDIFD
FT                   INTLILVQLGAKVNSYIINGEFYRLLTCTFLHSGLMHIAFNMYALNNIGRLIERVYGWK
FT                   KFILIYIFAGLSGSLASFLFSPYVSVGASGAIFGLFGAALIMGLKLKKYINSNFLGSLA
FT                   SVIVVNVIFGFSSTGIDNYGHIGGLLGGLLMGALLFNKKNALAKL"
FT                   /protein_id="YP_003841600.1"
FT   misc_feature    complement(85281..85640)
FT                   /note="Rhomboid family; Region: Rhomboid; cl11446"
FT                   /db_xref="CDD:175259"
FT                   /locus_tag="Clocel_0047"
FT   gene            complement(86417..86662)
FT                   /db_xref="GeneID:9606866"
FT                   /locus_tag="Clocel_0048"
FT   CDS_pept        complement(86417..86662)
FT                   /locus_tag="Clocel_0048"
FT                   /gene_family="HOG000197059" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /transl_table="11"
FT                   /note="KEGG: cbi:CLJ_B0097 transcriptional regulator, AbrB
FT                   family; TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain-containing protein"
FT                   /db_xref="GI:302872968"
FT                   /db_xref="InterPro:IPR006339"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="GeneID:9606866"
FT                   /translation="MRSTGIVRKVDELGRIVIPIELRRTLDIEIKDALEIYVNSEEIIL
FT                   KKYQPSCIFCGEVKDVENYKGKKICHNCLNELKENV"
FT                   /protein_id="YP_003841601.1"
FT   misc_feature    complement(<86456..86662)
FT                   /note="SpoVT / AbrB like domain; Region: SpoVT_AbrB;
FT                   cl00877"
FT                   /db_xref="CDD:174436"
FT                   /locus_tag="Clocel_0048"
FT   gene            87086..88021
FT                   /db_xref="GeneID:9606867"
FT                   /locus_tag="Clocel_0049"
FT   CDS_pept        87086..88021
FT                   /locus_tag="Clocel_0049"
FT                   /gene_family="HOG000180308" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /codon_start="1"
FT                   /product="periplasmic solute binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   ckr:CKR_2696 hypothetical protein"
FT                   /db_xref="GI:302872969"
FT                   /db_xref="GO:0046872"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="GeneID:9606867"
FT                   /translation="MLKRVTMLFVSAIFCVSIAGCDKKATSTEDSEKIQVVASFHAVKE
FT                   ITTLVGGDKVDIVSIVPSGTEAHDFEPKASDIKRIAGADIFIYNGLGMEEWVDDALNSA
FT                   QNSELQIINLSKSSDLIKLSDEEQNHVDMEDTSENKEDHKHGEYDPHIWLSIKEVEKSI
FT                   LTIKDKLVEEDPENKSYYEENYNKNVKRLQDIYEEYKAKFDGLNNKSFIAGHEAFGYLC
FT                   RDFSLKQIGVEDAFASGDPSPAKLKALVDYVKENKVKTIFSEEAASSKISDTLAKEVGA
FT                   TVKPLVTFENSGSYIDDMRKNLDIIYEGIK"
FT                   /protein_id="YP_003841602.1"
FT   misc_feature    87176..88018
FT                   /note="Helical backbone metal receptor (TroA-like domain).
FT                   These proteins have been shown to function in the ABC
FT                   transport of ferric siderophores and metal ions such as
FT                   Mn2+, Fe3+, Cu2+ and/or Zn2+.  Their ligand binding site is
FT                   formed in the interface...; Region: TroA-like; cl00262"
FT                   /db_xref="CDD:174075"
FT                   /locus_tag="Clocel_0049"
FT   misc_feature    order(87377..87382,87389..87391,87587..87589)
FT                   /note="intersubunit interface; other site"
FT                   /db_xref="CDD:29734"
FT                   /locus_tag="Clocel_0049"
FT   gene            88311..88400
FT                   /note="tRNA-Ser4"
FT                   /db_xref="GeneID:9606868"
FT                   /locus_tag="Clocel_R0011"
FT   tRNA            88311..88400
FT                   /db_xref="GeneID:9606868"
FT                   /locus_tag="Clocel_R0011"
FT                   /product="tRNA-Ser"
FT   gene            88510..88610
FT                   /db_xref="GeneID:9606869"
FT                   /locus_tag="Clocel_R0012"