(data stored in ACNUC7421 zone)

HOGENOMDNA: CLOSW_1

ID   CLOSW_1; SV 1; empty ; DNA; empty ; PRO; 4662871 BP.
XX
AC   NC_014376;
XX
PR   Project: 51419;
XX
DE   Clostridium saccharolyticum WM1 chromosome, complete genome.
XX
OS   Clostridium saccharolyticum WM1
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Clostridiaceae;
OC   Clostridium.
XX
RN   [1]
RP   1-4662871
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Bruce,D., Goodwin,L.,
RA   Pitluck,S., Chertkov,O., Detter,J.C., Han,C., Tapia,R., Land,M.,
RA   Hauser,L., Chang,Y.-J., Jeffries,C., Kyrpides,N., Ivanova,N.,
RA   Mikhailova,N., Mouttaki,H., Lin,L., Zhou,J., Hemme,C.L. and Woyke,T.;
RT   "Complete sequence of Clostridium saccharolyticum WM1";
RL   Unpublished
XX
RN   [2]
RP   1-4662871
RG   NCBI Genome Project
RT   "Direct Submission";
RL   Submitted (06-AUG-2010) National Center for Biotechnology Information,
RL   NIH, Bethesda, MD 20894, USA
XX
RN   [3]
RP   1-4662871
RG   US DOE Joint Genome Institute
RA   Lucas,S., Copeland,A., Lapidus,A., Cheng,J.-F., Bruce,D., Goodwin,L.,
RA   Pitluck,S., Chertkov,O., Detter,J.C., Han,C., Tapia,R., Land,M.,
RA   Hauser,L., Chang,Y.-J., Jeffries,C., Kyrpides,N., Ivanova,N.,
RA   Mikhailova,N., Mouttaki,H., Lin,L., Zhou,J., Hemme,C.L. and Woyke,T.;
RT   "Direct Submission";
RL   Submitted (20-JUL-2010) US DOE Joint Genome Institute, 2800 Mitchell Drive
RL   B310, Walnut Creek, CA 94598-1698, USA
XX
CC   PROVISIONAL REFSEQ: This record has not yet been subject to final
CC   NCBI review. The reference sequence is identical to CP002109.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4086885
CC   Source DNA and organism available from Christopher L. Hemme
CC   (hemmecl@ou.edu)
CC   Contacts: Christopher L. Hemme (hemmecl@ou.edu)
CC   Tanja Woyke (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   COMPLETENESS: full length.
XX
FH   Key             Location/Qualifiers
FT   source          1..4662871
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:610130"
FT                   /country="Canada"
FT                   /isolation_source="sludge"
FT                   /strain="WM1"
FT                   /organism="Clostridium saccharolyticum WM1"
FT   gene            82..1458
FT                   /db_xref="GeneID:9509627"
FT                   /locus_tag="Closa_0001"
FT   CDS_pept        82..1458
FT                   /locus_tag="Closa_0001"
FT                   /gene_family="HOG000235658" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /codon_start="1"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; KEGG:
FT                   cpy:Cphy_0001 chromosomal replication initiator protein
FT                   DnaA; SMART: Chromosomal replication initiator DnaA domain;
FT                   AAA ATPase"
FT                   /db_xref="GI:302384445"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="GeneID:9509627"
FT                   /translation="MLEKLKEKWDEILLNLKEEHEITDVSFKTWLLPLKVHSVNGEKVI
FT                   VTVPDVEFLGYIRKKYGFLLKITIEEVTGFECTVDFVVENQIQKEAATAPAGNTLITNT
FT                   MNQVSQSAIITANLNPKYTFDTFVVGANNNLAHAASLAVAESPGEIYNPLFIYGGVGLG
FT                   KTHLMHSIGHFILKNNPAAKVLYVTSEKFTNELIDAIRNKNNFSPTEFREKYRNNDVLL
FT                   IDDIQFIIGKESTQEEFFHTFNALYEAKKQIIISSDKPPKEIETLEERLRSRFEWGLTV
FT                   DIQSPDYETRMAILRKKEEMEGYNIDNEVIKYIATNIKSNIRELEGALTKIVALSRLDN
FT                   KEITVELAEEALKDIISPNDKREVTPELVIQVVADHYGLTPLDICSQKRNKEIVYPRQI
FT                   VMYLCREMVGTPLQMIGKFLGGRDHTTIIHGIEKITANADKNESLNNTIEILKKKINPQ
FT                   "
FT                   /protein_id="YP_003820267.1"
FT   misc_feature    91..1449
FT                   /note="chromosomal replication initiation protein;
FT                   Reviewed; Region: dnaA; PRK00149"
FT                   /db_xref="CDD:166824"
FT                   /locus_tag="Closa_0001"
FT   misc_feature    520..918
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Closa_0001"
FT   misc_feature    553..576
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Closa_0001"
FT   misc_feature    order(556..579,751..753,850..852)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Closa_0001"
FT   misc_feature    739..756
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Closa_0001"
FT   misc_feature    889..891
FT                   /note="arginine finger; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Closa_0001"
FT   misc_feature    1177..1446
FT                   /note="C-terminal domain of bacterial DnaA proteins. The
FT                   DNA-binding C-terminal domain of DnaA contains a
FT                   helix-turn-helix motif that specifically interacts with the
FT                   DnaA box, a 9-mer motif that occurs repetitively in the
FT                   replication origin oriC. Multiple...; Region: Bac_DnaA_C;
FT                   cd06571"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="Closa_0001"
FT   misc_feature    order(1246..1248,1270..1275,1294..1296,1312..1320,
FT                   1345..1359,1366..1368,1375..1380)
FT                   /note="DnaA box-binding interface; other site"
FT                   /db_xref="CDD:119330"
FT                   /locus_tag="Closa_0001"
FT   gene            1717..2838
FT                   /db_xref="GeneID:9505239"
FT                   /locus_tag="Closa_0002"
FT   CDS_pept        1717..2838
FT                   /locus_tag="Closa_0002"
FT                   /gene_family="HOG000071792" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /codon_start="1"
FT                   /EC_number="2.7.7.7"
FT                   /transl_table="11"
FT                   /note="SMART: DNA polymerase III beta chain; TIGRFAM: DNA
FT                   polymerase III, beta subunit; KEGG: ere:EUBREC_0002 DNA
FT                   polymerase III, beta subunit; PFAM: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="GI:302384446"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="GeneID:9505239"
FT                   /translation="MKLTFKQDEILNGINIVLKAVPSKTTMSILECIFIDASGSEIKLT
FT                   ANDMELGIETKVEGTILERGKIALEAKLLSEIVRKLSSAGDSLVTIESDEKFTTTISCE
FT                   NSVFHIQGRDGEEFAYLPYIERDHYICLSQFSLKEVIRQTIFSIAPNDSNKMMTGELFQ
FT                   VTGNQLKVVSLDGHRISIRNIELKDTYHDIKVIVPGKTLNEVSKILGGDSEKEVLIFFS
FT                   TNHILFEFDDTIVVSRLIEGEYFRIDQMLSSDYETKTSVNKRQLLDCLDRATILVREND
FT                   KKPLIMNIEDQEMELKMNSSFGSMNAQVPIHKTGSDIMIGFNPKFLIDALRIIDDEEVT
FT                   LYMLNPKSPCFIRDEEGKYIYLILPVNFNAAAV"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /protein_id="YP_003820268.1"
FT   misc_feature    1717..2814
FT                   /note="DNA polymerase III subunit beta; Validated; Region:
FT                   PRK05643"
FT                   /db_xref="CDD:168148"
FT                   /locus_tag="Closa_0002"
FT   misc_feature    1717..2814
FT                   /note="Beta clamp domain.  The beta subunit (processivity
FT                   factor) of DNA polymerase III holoenzyme, refered to as the
FT                   beta clamp, forms a ring shaped dimer that encircles dsDNA
FT                   (sliding clamp) in bacteria.  The beta-clamp is
FT                   structurally similar to the...; Region: beta_clamp;
FT                   cd00140"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Closa_0002"
FT   misc_feature    order(1786..1788,1930..1932,1951..1953,2314..2316)
FT                   /note="putative DNA binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Closa_0002"
FT   misc_feature    order(1933..1935,1942..1944,2029..2031,2035..2037,
FT                   2539..2541,2632..2637)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Closa_0002"
FT   misc_feature    order(2236..2238,2242..2253,2683..2685,2806..2814)
FT                   /note="beta-clamp/clamp loader binding surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Closa_0002"
FT   misc_feature    order(2236..2238,2242..2247,2464..2466,2572..2574,
FT                   2611..2616,2692..2694,2806..2814)
FT                   /note="beta-clamp/translesion DNA polymerase binding
FT                   surface; other site"
FT                   /db_xref="CDD:29053"
FT                   /locus_tag="Closa_0002"
FT   gene            2932..3237
FT                   /db_xref="GeneID:9505240"
FT                   /locus_tag="Closa_0003"
FT   CDS_pept        2932..3237
FT                   /locus_tag="Closa_0003"
FT                   /gene_family="HOG000074028" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:COG:COG2501"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cpy:Cphy_0003 RNA-binding S4 domain-containing
FT                   protein"
FT                   /db_xref="GI:302384447"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="GeneID:9505240"
FT                   /translation="METIKLRDEYIKLGQALKAAGLVGSGVDAKFVIEDGLVQVNGQVE
FT                   YQRGKKLRAGDVVTFEGNAIKIEERPDGQTLTPDKAGRAVPKKHGQERGNNTIHDN"
FT                   /protein_id="YP_003820269.1"
FT   misc_feature    2938..3114
FT                   /note="S4/Hsp/ tRNA synthetase RNA-binding domain; The
FT                   domain surface is populated by conserved, charged residues
FT                   that define a likely RNA-binding site;  Found in stress
FT                   proteins, ribosomal proteins and tRNA synthetases; This may
FT                   imply a hitherto unrecognized...; Region: S4; cl09940"
FT                   /db_xref="CDD:175052"
FT                   /locus_tag="Closa_0003"
FT   gene            3227..4312
FT                   /db_xref="GeneID:9505241"
FT                   /locus_tag="Closa_0004"
FT   CDS_pept        3227..4312
FT                   /locus_tag="Closa_0004"
FT                   /gene_family="HOG000269559" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /codon_start="1"
FT                   /product="DNA replication and repair protein RecF"
FT                   /transl_table="11"
FT                   /note="KEGG: eel:EUBELI_00004 DNA replication and repair
FT                   protein RecF; TIGRFAM: DNA replication and repair protein
FT                   RecF; PFAM: SMC domain protein"
FT                   /db_xref="GI:302384448"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="GeneID:9505241"
FT                   /translation="MIIESIELKNYRNYDELHMDFSQGTNILYGDNAQGKTNVLEAIYV
FT                   CATTKSHRGSKDKEIIQFDRDESHIKLNIRKNNIPYRIDMHLKKNKAKGVAVNGVPIKK
FT                   ASELFGIVNVVFFSPEDLNLIKNGPAERRRFVDLELCQLNRYYVHSLVQYNRIVTQRNK
FT                   LLKDMAFRPDYEETLDVWDMQLVQYGKEMIGYRKEFIEQLDGIIGSIHGQLSGEKEHLR
FT                   ILYEPNVGAEEFEEAIRRSRQQDMKQKTTLTGPHRDDLSFVINGIDIRRYGSQGQQRTA
FT                   ALSLKLAEIELVEKTVFDYPILLLDDVLSELDNSRQNQLLAGINHIQTVITCTGLEEFV
FT                   RNRFPVDKIFRVVSGTVGSEN"
FT                   /protein_id="YP_003820270.1"
FT   misc_feature    3233..>3724
FT                   /note="RecF is a recombinational DNA repair ATPase that
FT                   maintains replication in the presence of DNA damage.  When
FT                   replication is prematurely disrupted by DNA damage, several
FT                   recF pathway gene products play critical roles processing
FT                   the arrested replication...; Region: ABC_RecF; cd03242"
FT                   /db_xref="CDD:73001"
FT                   /locus_tag="Closa_0004"
FT   misc_feature    3314..3337
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73001"
FT                   /locus_tag="Closa_0004"
FT   misc_feature    order(3323..3328,3332..3340,3530..3532)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73001"
FT                   /locus_tag="Closa_0004"
FT   misc_feature    3521..3532
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73001"
FT                   /locus_tag="Closa_0004"
FT   misc_feature    <3953..4297
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Closa_0004"
FT   misc_feature    4043..4072
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Closa_0004"
FT   misc_feature    4130..4147
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Closa_0004"
FT   misc_feature    4154..4165
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Closa_0004"
FT   misc_feature    4217..4237
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Closa_0004"
FT   gene            4368..6281
FT                   /db_xref="GeneID:9505242"
FT                   /locus_tag="Closa_0005"
FT   CDS_pept        4368..6281
FT                   /locus_tag="Closa_0005"
FT                   /gene_family="HOG000075156" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /codon_start="1"
FT                   /EC_number="5.99.1.3"
FT                   /transl_table="11"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: cpy:Cphy_0005 DNA gyrase, B subunit; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM domain
FT                   protein; DNA gyrase subunit B domain protein"
FT                   /db_xref="GI:302384449"
FT                   /db_xref="InterPro:IPR000565"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="GeneID:9505242"
FT                   /translation="MSQEYGADQIQILEGLEAVRKRPGMYIGSTSTRGLHHLVYEIVDN
FT                   AVDEALAGYCDSIEVIIHPDNSVTVVDDGRGIPVGIQKKAGIPAVEVAFTILHAGGKFG
FT                   GGGYKVSGGLHGVGASVVNALSQWLEVEIRQDGKIYKQRYEKGKTMYPLKVIGECGPDE
FT                   HGTKVTFLPDGEIFEETVYDYDTLKIRLRETAFLTKNLKIILRDEREDKHEHVFHYEGG
FT                   IKEFITYLNKGKTPLYDQVFYCEGTKDGVYVEVAMQHNDSYTENIYSFVNNINTPEGGT
FT                   HLAGFKNALTTTLNDYARKNRLLKENETNLSGEDIREGLTAIISVKIEEPQFEGQTKQK
FT                   LGNSEARGAVDNLLREQFTYYLEQNPSLSKTICDKSILAQRARAAARKARDLTRRKTAL
FT                   EGMALPGKLADCSDKNPENCEIYIVEGDSAGGSAKTARSRNTQAILPLRGKILNVEKAR
FT                   LDKIYANAEIKAMITAFGTGIHEDFDLSKLRYHKIIIMTDADVDGAHISTLLLTFLYRF
FT                   MPDLIKEGYVYLAQPPLYKVEKNKKVWYAYSDEELNAILKEIGRDNNNKIQRYKGLGEM
FT                   DAEQLWETTMDPERRVLLRVIMNEDTTSEMDLTFTTLMGDQVEPRREFIEANAKYVQNL
FT                   DI"
FT                   /product="DNA gyrase, B subunit"
FT                   /protein_id="YP_003820271.1"
FT   misc_feature    4380..6278
FT                   /note="DNA gyrase, B subunit; Region: gyrB; TIGR01059"
FT                   /db_xref="CDD:162180"
FT                   /locus_tag="Closa_0005"
FT   misc_feature    4464..>4622
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cl00075"
FT                   /db_xref="CDD:173995"
FT                   /locus_tag="Closa_0005"
FT   misc_feature    5028..5498
FT                   /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
FT                   a ribosomal S5 domain 2-like fold, of the type found in
FT                   proteins of the type IIA family of DNA topoisomerases
FT                   similar to the B subunits of E. coli DNA gyrase and E. coli
FT                   Topoisomerase IV which are...; Region:
FT                   TopoII_Trans_DNA_gyrase; cd00822"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Closa_0005"
FT   misc_feature    5181..5183
FT                   /note="anchoring element; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Closa_0005"
FT   misc_feature    order(5355..5357,5364..5369,5373..5375)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Closa_0005"
FT   misc_feature    order(5373..5375,5379..5381)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:48467"
FT                   /locus_tag="Closa_0005"
FT   misc_feature    5622..5963
FT                   /note="TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM)
FT                   nucleotidyl transferase/hydrolase domain of the type found
FT                   in proteins of the type IIA family of DNA topoisomerases
FT                   similar to the Escherichia coli GyrB subunit. TopoIIA
FT                   enzymes cut both strands of...; Region:
FT                   TOPRIM_TopoIIA_GyrB; cd03366"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Closa_0005"
FT   misc_feature    order(5640..5645,5652..5654,5859..5861,5865..5867,
FT                   5871..5873)
FT                   /note="active site"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Closa_0005"
FT   misc_feature    order(5640..5642,5859..5861)
FT                   /note="putative metal-binding site; other site"
FT                   /db_xref="CDD:173786"
FT                   /locus_tag="Closa_0005"
FT   misc_feature    6066..6245
FT                   /note="DNA gyrase B subunit, carboxyl terminus; Region:
FT                   DNA_gyraseB_C; pfam00986"
FT                   /db_xref="CDD:144542"
FT                   /locus_tag="Closa_0005"
FT   gene            6296..8857
FT                   /db_xref="GeneID:9505243"
FT                   /locus_tag="Closa_0006"
FT   CDS_pept        6296..8857
FT                   /locus_tag="Closa_0006"
FT                   /gene_family="HOG000076278" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /codon_start="1"
FT                   /EC_number="5.99.1.3"
FT                   /transl_table="11"
FT                   /note="SMART: DNA gyrase/topoisomerase IV subunit A;
FT                   TIGRFAM: DNA gyrase, A subunit; KEGG: cpy:Cphy_0006 DNA
FT                   gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller"
FT                   /db_xref="GI:302384450"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="GeneID:9505243"
FT                   /translation="MEPNIFDKVHDVDLKKTMEKSYIDYAMSVIVSRALPDVRDGLKPV
FT                   QRRVLYSMIELNNGPDKPHRKCARIVGDTMGKYHPHGDSSIYGALVNLAQEWSTRYPLV
FT                   DGHGNFGSVDGDGAAAMRYTEARLSKISMEMLADINKDTVDFSPNFDETEREPDVLPSR
FT                   YPNLLVNGTSGIAVGMATNIPPHNLREVISAVVHIIDNQVEENRETTMEEILEIIKGPD
FT                   FPTGATILGKRGIEEAYRTGRGKIRVRAVSDIEAMANGKNRIIVTELPYMVNKARLIEK
FT                   IAELVKDKKVDGITDLRDESDRSGMRICIELRRDANANVVLNQLIKHTQLQDTFGVIML
FT                   ALVKNSAGVLEPKVLNILQMLNYYLDHQKEVVTRRTRYDLNKAEERAHILQGLLIALDN
FT                   IDEVIRIIRGSENVQAAKAELMSRFGLSDVQSQAIVDMRLRALTGLEREKLENEYRELE
FT                   ARIAELKSILADEKKLLGVIKEEISIISAKYGDDRRTSIGFDEFDMSMEDLIPDESTIV
FT                   AMTKLGYIKRMSVDNFKNQNRGGRGIKGMQTIDQDYIEDLMMTTTHHYLMFFTNTGRVY
FT                   RLKTYMIPEGSRTSRGTAIVNLLQMLPGESITAIIPMKEYDDDKFLFMATRNGMVKKTP
FT                   MMEYANVRKNGLQAIVLRENDELIEVKATDDTKDIFLVTKKGQCIRFHEKDVRITGRVS
FT                   MGVIGMKLNEDDQVVGMQKESQGPKLLIVSANGMGKRTPIEEFTPQRRGGKGVLCYKIT
FT                   EKTGDIVGAKLVEDDHDLLLITTEGIVIRISVNDISVIGRNTSGVKLMNIDQDSDITVA
FT                   SIAKVRDDGSKSDGEGLEELDIIDEELPEEIKEMEDAPEEE"
FT                   /product="DNA gyrase, A subunit"
FT                   /protein_id="YP_003820272.1"
FT   misc_feature    6296..8770
FT                   /note="DNA gyrase subunit A; Validated; Region: PRK05560"
FT                   /db_xref="CDD:168095"
FT                   /locus_tag="Closa_0006"
FT   misc_feature    6386..7741
FT                   /note="DNA Topoisomerase, subtype IIA; domain A'; bacterial
FT                   DNA topoisomerase IV (C subunit, ParC), bacterial DNA
FT                   gyrases (A subunit, GyrA),mammalian DNA toposiomerases II.
FT                   DNA topoisomerases are essential enzymes that regulate the
FT                   conformational changes in...; Region: TOP4c; cd00187"
FT                   /db_xref="CDD:29149"
FT                   /locus_tag="Closa_0006"
FT   misc_feature    order(6386..6469,6482..6631,6635..6691,6695..6766,
FT                   6773..6775)
FT                   /note="CAP-like domain; other site"
FT                   /db_xref="CDD:29149"
FT                   /locus_tag="Closa_0006"
FT   misc_feature    6662..6664
FT                   /note="active site"
FT                   /db_xref="CDD:29149"
FT                   /locus_tag="Closa_0006"
FT   misc_feature    order(7487..7495,7502..7513,7544..7549,7589..7639)
FT                   /note="primary dimer interface; other site"
FT                   /db_xref="CDD:29149"
FT                   /locus_tag="Closa_0006"
FT   misc_feature    7832..7981
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Closa_0006"
FT   misc_feature    7982..8140
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Closa_0006"
FT   misc_feature    8150..8293
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Closa_0006"
FT   misc_feature    8294..8428
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Closa_0006"
FT   misc_feature    8450..8596
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Closa_0006"
FT   misc_feature    8597..8743
FT                   /note="DNA gyrase C-terminal domain, beta-propeller;
FT                   Region: DNA_gyraseA_C; pfam03989"
FT                   /db_xref="CDD:146561"
FT                   /locus_tag="Closa_0006"
FT   gene            complement(9037..10956)
FT                   /db_xref="GeneID:9505244"
FT                   /locus_tag="Closa_0007"
FT   CDS_pept        complement(9037..10956)
FT                   /locus_tag="Closa_0007"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.7.1.69"
FT                   /codon_start="1"
FT                   /EC_number="2.7.1.69"
FT                   /transl_table="11"
FT                   /note="KEGG: cdf:CD3083 transcription antiterminator; PFAM:
FT                   PRD domain protein; M trans-acting positive regulator;
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system EIIA 2"
FT                   /db_xref="GI:302384451"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR007737"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="GeneID:9505244"
FT                   /translation="MGPKLIKLIRILMMHTKEMTASALAAEMGVSERSIKNYISEINDN
FT                   HPQTISSSRKGYTIHAEAGRKILNNSGTHIPQSSKERLVYIINLLIKQEAGIDAYDLCD
FT                   TIFISYSTLKNELGAVKKKLGQFDLKLFNQKDNLFIEGLEKNKRRLLSSILYDESNINF
FT                   VSLKTIQHVFPDIEIEYIKNTLLNIFDQYQYFVNDYSLINIVLHITIAIDRIKNHNINT
FT                   QDVNELAKIRYHEYELANQVTKDLENHFHITYSEAEIYELALLLISRATTIDYKTITTA
FT                   NLENFIGKECFDLVEEMIQSVNAYYYIDLSEPEFLIRFAIHIRNLLQRSKNQQFSKNPL
FT                   TEEIKTSCPLIYDVSVYLSGIIKDRTGIMINDDEIAYITFHLGSTLEAQKSLNKKVTAV
FT                   LYCPNYYDLNVRLTDTINQHFSCEMLITNILTEESVLEQVPKCDFMISTVPHHGYLGMD
FT                   IVHIGMFLTDKDISVIRNKITSVRVSKKKATFKSYLEMLIIPEFFERRNDLKTERDSIE
FT                   YMAGKMHRLGYVDETFQEDIYMREKLSSTAFHDFAIPHAMKMHAEKTGLNILISNSPVS
FT                   WNEKPVSLIIMMCFNKNDRYIFNEIFEPLTMMLTDREFMKKLIQVKDHKAFIQMLTDNL
FT                   EVTF"
FT                   /product="transcriptional antiterminator, BglG"
FT                   /protein_id="YP_003820273.1"
FT   misc_feature    complement(9379..10956)
FT                   /note="Transcriptional antiterminator [Transcription];
FT                   Region: BglG; COG3711"
FT                   /db_xref="CDD:33506"
FT                   /locus_tag="Closa_0007"
FT   misc_feature    complement(10762..10947)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Closa_0007"
FT   misc_feature    complement(10198..10374)
FT                   /note="PRD domain; Region: PRD; pfam00874"
FT                   /db_xref="CDD:144460"
FT                   /locus_tag="Closa_0007"
FT   misc_feature    complement(9802..10071)
FT                   /note="PRD domain; Region: PRD; pfam00874"
FT                   /db_xref="CDD:144460"
FT                   /locus_tag="Closa_0007"
FT   misc_feature    complement(9064..9465)
FT                   /note="PTS_IIA, PTS system, fructose/mannitol specific IIA
FT                   subunit. The bacterial phosphoenolpyruvate: sugar
FT                   phosphotransferase system (PTS) is a multi-protein system
FT                   involved in the regulation of a variety of metabolic and
FT                   transcriptional processes. This...; Region: PTS_IIA_fru;
FT                   cd00211"
FT                   /db_xref="CDD:29266"
FT                   /locus_tag="Closa_0007"
FT   misc_feature    complement(order(9292..9294,9337..9339))
FT                   /note="active site"
FT                   /db_xref="CDD:29266"
FT                   /locus_tag="Closa_0007"
FT   misc_feature    complement(9292..9294)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29266"
FT                   /locus_tag="Closa_0007"
FT   gene            11185..11490
FT                   /db_xref="GeneID:9505245"
FT                   /locus_tag="Closa_0008"
FT   CDS_pept        11185..11490
FT                   /locus_tag="Closa_0008"
FT                   /gene_family="HOG000224223" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02302"
FT                   /codon_start="1"
FT                   /product="phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: phosphotransferase system
FT                   lactose/cellobiose-specific IIB subunit; KEGG:
FT                   lmy:LM5923_0949 hypothetical protein"
FT                   /db_xref="GI:302384452"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="GeneID:9505245"
FT                   /translation="MLNVLLVCGSGASSGFMAANIRKAAAARKMEVNIKARGESEIENY
FT                   IDEIDALMVGPHLAYIMDEIEEYTGGKDVKVILMKPEYYSTLNGDQALDHLLKELG"
FT                   /protein_id="YP_003820274.1"
FT   misc_feature    11191..11478
FT                   /note="PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme
FT                   II (EII) of the N,N-diacetylchitobiose-specific and
FT                   lichenan-specific phosphoenolpyruvate:carbohydrate
FT                   phosphotransferase system (PTS). In these systems, EII is
FT                   either a lichenan- or an N,N-...; Region:
FT                   PTS_IIB_chitobiose_lichenan; cd05564"
FT                   /db_xref="CDD:99906"
FT                   /locus_tag="Closa_0008"
FT   misc_feature    order(11206..11208,11212..11217,11221..11226,11353..11355,
FT                   11434..11436)
FT                   /note="active site"
FT                   /db_xref="CDD:99906"
FT                   /locus_tag="Closa_0008"
FT   misc_feature    11206..11226
FT                   /note="P-loop; other site"
FT                   /db_xref="CDD:99906"
FT                   /locus_tag="Closa_0008"
FT   misc_feature    11206..11208
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:99906"
FT                   /locus_tag="Closa_0008"
FT   gene            11513..12772
FT                   /db_xref="GeneID:9505246"
FT                   /locus_tag="Closa_0009"
FT   CDS_pept        11513..12772
FT                   /locus_tag="Closa_0009"
FT                   /gene_family="HOG000049544" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:2.7.1.69"
FT                   /codon_start="1"
FT                   /EC_number="2.7.1.69"
FT                   /transl_table="11"
FT                   /note="KEGG: ppe:PEPE_0579 phosphotransferase system
FT                   cellobiose-specific component IIC; PFAM: phosphotransferase
FT                   system EIIC"
FT                   /db_xref="GI:302384453"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR004501"
FT                   /db_xref="GeneID:9505246"
FT                   /translation="MKQLIYWLEHSFAPKMNKINNNVWVTTLKDSIMQVLPFILLGSIF
FT                   CFLTVPGDVFGWNWWPNFWTPFGWTMGLLSLFVAFLIPFNLMEKKRMRKQRIIAALSGV
FT                   VAFLIIISPQVIKDGQAGFQHASLGAGGMFVAITAGVFSGFIMGIFGKFSFFKESSVIP
FT                   DFVRAWFDSMLPTGIVVCTLWVLVDLLGIDIYNILLSLFMPISNVMQTPWGFVLSLLLV
FT                   CFLYSLGISSWVLTPVYKPAMLMAITANVSMAAAGTATYETLNLVTDPTVYSAYVWIGG
FT                   IGCTLPLVIMLVFAKSNKLRALGRASLVPAIFNINEPVVFGCIAWNPIMMIPMWLMGII
FT                   LPSVVWIFTKVIPFAPIPTRVFDMWYCPFPISTWLTTGSIRGIILMAVCALLSTVIWYP
FT                   FFRIYDNQEAKSEKEAEEKK"
FT                   /product="Protein-N(pi)-phosphohistidine--sugar
FT                   phosphotransferase"
FT                   /protein_id="YP_003820275.1"
FT   misc_feature    11513..12733
FT                   /note="Phosphotransferase system, EIIC; Region: PTS_EIIC;
FT                   cl00557"
FT                   /db_xref="CDD:174284"
FT                   /locus_tag="Closa_0009"
FT   gene            12796..13173
FT                   /db_xref="GeneID:9505247"
FT                   /locus_tag="Closa_0010"
FT   CDS_pept        12796..13173
FT                   /locus_tag="Closa_0010"
FT                   /gene_family="HOG000224338" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02255"
FT                   /codon_start="1"
FT                   /product="phosphotransferase system PTS
FT                   lactose/cellobiose-specific IIA subunit"
FT                   /transl_table="11"
FT                   /note="PFAM: phosphotransferase system PTS
FT                   lactose/cellobiose-specific IIA subunit; KEGG:
FT                   cdl:CDR20291_2919 PTS system, IIa component"
FT                   /db_xref="GI:302384454"
FT                   /db_xref="InterPro:IPR003188"
FT                   /db_xref="GeneID:9505247"
FT                   /translation="MDEKTLESAMSIIMNAGDARLLCKEALTAIADQDFTLANEKMKEA
FT                   QKKITEAHRIQTDAIQGETRGEKTEYSLIFAHAQDTLMTIYSEINIAKQMIKIFENWEN
FT                   RMKRLEDQIENHDIRKGRRTL"
FT                   /protein_id="YP_003820276.1"
FT   misc_feature    12814..13098
FT                   /note="PTS_IIA, PTS system, lactose/cellobiose specific IIA
FT                   subunit. The bacterial phosphoenolpyruvate: sugar
FT                   phosphotransferase system (PTS) is a multi-protein system
FT                   involved in the regulation of a variety of metabolic and
FT                   transcriptional processes. This...; Region: PTS_IIA_lac;
FT                   cd00215"
FT                   /db_xref="CDD:29270"
FT                   /locus_tag="Closa_0010"
FT   misc_feature    order(12853..12855,13024..13026,13030..13038)
FT                   /note="active site"
FT                   /db_xref="CDD:29270"
FT                   /locus_tag="Closa_0010"
FT   misc_feature    order(12970..12972,13018..13023,13042..13044)
FT                   /note="methionine cluster; other site"
FT                   /db_xref="CDD:29270"
FT                   /locus_tag="Closa_0010"
FT   misc_feature    13024..13026
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29270"
FT                   /locus_tag="Closa_0010"
FT   misc_feature    13033..13035
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:29270"
FT                   /locus_tag="Closa_0010"
FT   gene            13170..14606
FT                   /db_xref="GeneID:9505248"
FT                   /locus_tag="Closa_0011"
FT   CDS_pept        13170..14606
FT                   /locus_tag="Closa_0011"
FT                   /gene_family="HOG000088631" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00232"
FT                   /codon_start="1"
FT                   /product="glycoside hydrolase family 1"
FT                   /transl_table="11"
FT                   /note="PFAM: glycoside hydrolase family 1; KEGG:
FT                   cdl:CDR20291_2918 6-phospho-beta-glucosidase"
FT                   /db_xref="GI:302384455"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="GeneID:9505248"
FT                   /translation="MKKVPKGFPSDFMWGGAVAANQLEGAFDLDGKGLCLADINEFQKD
FT                   LPIEKRSNGEITRAYIEEALKGNDKNFPKRRGIDFYHTYPEDLKLLADLGLKTFRTSIN
FT                   WARIFPNGDDKQPNEKGLEFYDKLFDEIIKNGMEPMITISHYEMPLHLTTAYKGWYSRE
FT                   VIDYFVKYCKTVFDRYAGKIKYWIIVNQINLIGHESFNHLGVAEDTVEDLYSAKYQAVH
FT                   HEMVACARATKYAHEKYPDMQIGMMLCGGPEYAATCKPEDVLAALKHNQMEYFYADVLL
FT                   RGYYPGYAFRFFQDWNIKLTFEAGDEEDLKHTADFFSFSYYYTQICSKESYEMGNKAYR
FT                   NKQLPANPWGWSIDPIGLRILLNEFYDRYQKPIYITENGVGYYDEVENGEIHDSYRIDY
FT                   LRAHIEQMKEAIKDGVDLRGYYAWGPIDIVSCSSCEMSKRYGFIYVDYDDYGNGTGKRM
FT                   KKDSYAWMKKVIASGGEDLV"
FT                   /protein_id="YP_003820277.1"
FT   misc_feature    13191..14600
FT                   /note="Glycosyl hydrolase family 1; Region: Glyco_hydro_1;
FT                   cl01046"
FT                   /db_xref="CDD:174504"
FT                   /locus_tag="Closa_0011"
FT   gene            14620..14892
FT                   /db_xref="GeneID:9505249"
FT                   /locus_tag="Closa_0012"
FT   CDS_pept        14620..14892
FT                   /locus_tag="Closa_0012"
FT                   /gene_family="HOG000278399" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01003"
FT                   /codon_start="1"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /transl_table="11"
FT                   /note="KEGG: eel:EUBELI_20516 phosphocarrier protein HPr;
FT                   TIGRFAM: phosphocarrier, HPr family; PFAM: phosphoryl
FT                   transfer system HPr"
FT                   /db_xref="GI:302384456"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR005698"
FT                   /db_xref="GeneID:9505249"
FT                   /translation="MRQFEFVIQDALGIHARSAGDMAAAAKKFTSLITIKKEDIEADLK
FT                   NPLAIMRLAARQEERVIITAAGEDEYQAIEQLIELAERIGLSPSR"
FT                   /protein_id="YP_003820278.1"
FT   misc_feature    14632..14859
FT                   /note="Histidine-containing phosphocarrier protein
FT                   (HPr)-like proteins. HPr is a central component of the
FT                   bacterial phosphoenolpyruvate sugar phosphotransferase
FT                   system (PTS). The PTS catalyses the phosphorylation of
FT                   sugar substrates during their translocation...; Region:
FT                   PTS-HPr_like; cd00367"
FT                   /db_xref="CDD:29444"
FT                   /locus_tag="Closa_0012"
FT   misc_feature    14632..14643
FT                   /note="dimerization domain swap beta strand; other site"
FT                   /db_xref="CDD:29444"
FT                   /locus_tag="Closa_0012"
FT   misc_feature    order(14659..14661,14665..14670,14674..14679,14689..14691,
FT                   14698..14700,14752..14763,14770..14775)
FT                   /note="regulatory protein interface; other site"
FT                   /db_xref="CDD:29444"
FT                   /locus_tag="Closa_0012"
FT   misc_feature    14662..14664
FT                   /note="active site"
FT                   /db_xref="CDD:29444"
FT                   /locus_tag="Closa_0012"
FT   misc_feature    14755..14757
FT                   /note="regulatory phosphorylation site; other site"
FT                   /db_xref="CDD:29444"
FT                   /locus_tag="Closa_0012"
FT   gene            15085..15516
FT                   /db_xref="GeneID:9505250"
FT                   /locus_tag="Closa_0013"
FT   CDS_pept        15085..15516
FT                   /locus_tag="Closa_0013"
FT                   /gene_family="HOG000249815" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02082"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function UPF0074; KEGG:
FT                   ele:Elen_0624 transcriptional regulator, BadM/Rrf2 family"
FT                   /db_xref="GI:302384457"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="GeneID:9505250"
FT                   /translation="MTSEFAVAVHGIVYLNQRKVTISSEELASNVCTNPARVRKVMAKL
FT                   KKAGIITTKEGLEGGYHFAKDSSEVNLKSICDALDVTFVSSSWKSGNVDTPCMIASGMS
FT                   GVMDEIYGDLNELCRRRMEEITIKDIQDKLIKNRPGSME"
FT                   /protein_id="YP_003820279.1"
FT   misc_feature    15085..15513
FT                   /note="Predicted transcriptional regulator [Transcription];
FT                   Region: COG1959"
FT                   /db_xref="CDD:32142"
FT                   /locus_tag="Closa_0013"
FT   misc_feature    15085..15321
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Closa_0013"
FT   misc_feature    <15211..15483
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Closa_0013"
FT   gene            15720..16562
FT                   /db_xref="GeneID:9505251"
FT                   /locus_tag="Closa_0014"
FT   CDS_pept        15720..16562
FT                   /locus_tag="Closa_0014"
FT                   /gene_family="HOG000225707" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00722"
FT                   /codon_start="1"
FT                   /product="hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: eel:EUBELI_00009 fumarate hydratase; TIGRFAM:
FT                   hydro-lyase, Fe-S type, tartrate/fumarate subfamily, alpha
FT                   subunit; PFAM: Fe-S type hydro-lyase tartrate/fumarate
FT                   alpha region"
FT                   /db_xref="GI:302384458"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="GeneID:9505251"
FT                   /translation="MIRMVRIEEITKNVKEMCIEANHKLSGDMERVFFHAVDAETSPLG
FT                   RQVLCQLKDNLKIAAEDMIPICQDTGMAVIFIKIGQDVHIEGGNLTDAINQGVREGYVE
FT                   GYLRKSVVEPVERVNTKDNTPAVIHYEVVSGDKIDITVAPKGFGSENMSRIFMLKPADG
FT                   LEGIKDSILSAVKEAGPNACPPMVVGVGIGGTFEKCAQLAKQALTRDIEKRSLIPYVKE
FT                   LESEMLDKINQLGIGPGGLGGRITALAVNIETYPTHIAGLPVAVNICCHVNRHAHRVI"
FT                   /protein_id="YP_003820280.1"
FT   misc_feature    15741..16559
FT                   /note="Fumarate hydratase (Fumerase); Region: Fumerase;
FT                   cl00851"
FT                   /db_xref="CDD:174423"
FT                   /locus_tag="Closa_0014"
FT   gene            16562..17140
FT                   /db_xref="GeneID:9505252"
FT                   /locus_tag="Closa_0015"
FT   CDS_pept        16562..17140
FT                   /locus_tag="Closa_0015"
FT                   /gene_family="HOG000225718" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00723"
FT                   /codon_start="1"
FT                   /product="hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, beta subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: eel:EUBELI_00010 fumarate hydratase; TIGRFAM:
FT                   hydro-lyase, Fe-S type, tartrate/fumarate subfamily, beta
FT                   subunit; PFAM: Fe-S type hydro-lyase tartrate/fumarate beta
FT                   region"
FT                   /db_xref="GI:302384459"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="GeneID:9505252"
FT                   /translation="MIEAKNGGIMDHHIKVPISREDAKNLKAGDYVYLTGTIYTARDAA
FT                   HKRMKETLDQKEALPFDIEGNMIYYMGPSPAREGRPIGSAGPTTASRMDQYTPLLLDMG
FT                   MRGMIGKGKRSKEVIESIIKNQSVYFAAVGGAGALLSKCILASEIIAYEDLGTEAIRRL
FT                   EIKDFPAVVVIDSKGNNLYETAIERYRED"
FT                   /protein_id="YP_003820281.1"
FT   misc_feature    16589..17128
FT                   /note="Fumarase C-terminus; Region: Fumerase_C; cl00795"
FT                   /db_xref="CDD:174393"
FT                   /locus_tag="Closa_0015"
FT   gene            17149..17862
FT                   /db_xref="GeneID:9505253"
FT                   /locus_tag="Closa_0016"
FT   CDS_pept        17149..17862
FT                   /locus_tag="Closa_0016"
FT                   /gene_family="HOG000027668" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /codon_start="1"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /transl_table="11"
FT                   /note="KEGG: cpy:Cphy_0233 phospholipid/glycerol
FT                   acyltransferase; PFAM: phospholipid/glycerol
FT                   acyltransferase; SMART: phospholipid/glycerol
FT                   acyltransferase"
FT                   /db_xref="GI:302384460"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="GeneID:9505253"
FT                   /translation="MNRIFYMVIRNFFRVPIWFYRIWRMGLPNDTHTDGQRYDYLRNVV
FT                   KTVNRTGRIKVEVQGVDNLPSENGFILFPNHQGLFDVLALMDACPNPFGVVVKKEAAKL
FT                   ILVKQVIKALNGFSIDRQDIKASMEIIVRMAENVKLGKNYVIFPEGTRSREGNKLLAFK
FT                   GGTFKSAVNAKCPIVPVALIDCFKPFDENSSKKQTVQVCFLKPIYAEEYKNMKTLQIAE
FT                   LVHDNIQEKINQIIG"
FT                   /protein_id="YP_003820282.1"
FT   misc_feature    17281..17844
FT                   /note="Lysophospholipid Acyltransferases (LPLATs) of
FT                   Glycerophospholipid Biosynthesis: AGPAT-like; Region:
FT                   LPLAT_AGPAT-like; cd07989"
FT                   /db_xref="CDD:153251"
FT                   /locus_tag="Closa_0016"
FT   misc_feature    order(17374..17376,17383..17385,17389..17391,17437..17448,
FT                   17596..17604)
FT                   /note="putative acyl-acceptor binding pocket; other site"
FT                   /db_xref="CDD:153251"
FT                   /locus_tag="Closa_0016"
FT   gene            17949..18036
FT                   /note="tRNA-Ser1"
FT                   /db_xref="GeneID:9505254"
FT                   /locus_tag="Closa_R0001"
FT   tRNA            17949..18036
FT                   /db_xref="GeneID:9505254"
FT                   /locus_tag="Closa_R0001"
FT                   /product="tRNA-Ser"
FT   gene            18567..20085
FT                   /db_xref="GeneID:9505255"
FT                   /locus_tag="Closa_R0002"
FT   rRNA            18567..20085
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT                   /db_xref="GeneID:9505255"
FT                   /locus_tag="Closa_R0002"
FT                   /product="16S ribosomal RNA"
FT   gene            20321..20437
FT                   /db_xref="GeneID:9505256"
FT                   /locus_tag="Closa_R0003"
FT   rRNA            20321..20437
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT                   /db_xref="GeneID:9505256"
FT                   /locus_tag="Closa_R0003"
FT                   /product="5S ribosomal RNA"
FT   gene            20917..23805
FT                   /db_xref="GeneID:9505257"
FT                   /locus_tag="Closa_R0004"
FT   rRNA            20917..23805
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr
FT                   22, 2007"
FT                   /db_xref="GeneID:9505257"
FT                   /locus_tag="Closa_R0004"
FT                   /product="23S ribosomal RNA"
FT   gene            23894..23967
FT                   /note="tRNA-Asp1"
FT                   /db_xref="GeneID:9505258"
FT                   /locus_tag="Closa_R0005"
FT   tRNA            23894..23967
FT                   /db_xref="GeneID:9505258"
FT                   /locus_tag="Closa_R0005"
FT                   /product="tRNA-Asp"
FT   gene            23991..24063
FT                   /note="tRNA-Val1"
FT                   /db_xref="GeneID:9505259"
FT                   /locus_tag="Closa_R0006"
FT   tRNA            23991..24063
FT                   /db_xref="GeneID:9505259"
FT                   /locus_tag="Closa_R0006"
FT                   /product="tRNA-Val"
FT   gene            24100..24172
FT                   /note="tRNA-Thr1"
FT                   /db_xref="GeneID:9505260"
FT                   /locus_tag="Closa_R0007"
FT   tRNA            24100..24172
FT                   /db_xref="GeneID:9505260"
FT                   /locus_tag="Closa_R0007"
FT                   /product="tRNA-Thr"
FT   gene            24194..24275
FT                   /note="tRNA-Tyr1"
FT                   /db_xref="GeneID:9505261"
FT                   /locus_tag="Closa_R0008"
FT   tRNA            24194..24275
FT                   /db_xref="GeneID:9505261"
FT                   /locus_tag="Closa_R0008"
FT                   /product="tRNA-Tyr"
FT   gene            24322..24395
FT                   /note="tRNA-Met1"
FT                   /db_xref="GeneID:9505262"
FT                   /locus_tag="Closa_R0009"
FT   tRNA            24322..24395
FT                   /db_xref="GeneID:9505262"
FT                   /locus_tag="Closa_R0009"
FT                   /product="tRNA-Met"
FT   gene            24444..24516
FT                   /note="tRNA-Phe1"
FT                   /db_xref="GeneID:9505263"
FT                   /locus_tag="Closa_R0010"
FT   tRNA            24444..24516
FT                   /db_xref="GeneID:9505263"
FT                   /locus_tag="Closa_R0010"
FT                   /product="tRNA-Phe"
FT   gene            24520..24592
FT                   /note="tRNA-Lys1"
FT                   /db_xref="GeneID:9505264"
FT                   /locus_tag="Closa_R0011"
FT   tRNA            24520..24592
FT                   /db_xref="GeneID:9505264"
FT                   /locus_tag="Closa_R0011"
FT                   /product="tRNA-Lys"
FT   gene            complement(24694..24924)
FT                   /db_xref="GeneID:9505265"
FT                   /locus_tag="Closa_0017"
FT   CDS_pept        complement(24694..24924)
FT                   /locus_tag="Closa_0017"
FT                   /gene_family="HOG000027693" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:EUBELI_00960"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: eel:EUBELI_00960 hypothetical protein"
FT                   /db_xref="GI:302384461"
FT                   /db_xref="GeneID:9505265"
FT                   /translation="MRLIEFKMERPGLVKAGDQVQIIEREGTSSYSYIIDPAVAMSGCY
FT                   MGRDRIKSDHGVVKEIKHNDRGYYVIVEFDE"
FT                   /protein_id="YP_003820283.1"
FT   gene            25089..26564
FT                   /db_xref="GeneID:9505266"
FT                   /locus_tag="Closa_0018"
FT   CDS_pept        25089..26564
FT                   /locus_tag="Closa_0018"
FT                   /gene_family="HOG000083489" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01276"
FT                   /codon_start="1"
FT                   /product="Orn/Lys/Arg decarboxylase major region"
FT                   /transl_table="11"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region;
FT                   Orn/Lys/Arg decarboxylase domain protein; KEGG:
FT                   ere:EUBREC_3277 arginine/lysine/ornithine decarboxylase"
FT                   /db_xref="GI:302384462"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="GeneID:9505266"
FT                   /translation="MNDAPNLLKKLKEYGKSDFYPFHMPGHKRQSEGFFAVDFPNPFSI
FT                   DITEIDGFDNLHHPEGILKESMEWASGIYGSSRTYYLINGSSSGILSAISGTVSRGGTI
FT                   LMSRNCHKSAFHGVFLNQLKTEYIYPQIIPQFGIQGGLNPKKIEEMLMNHGEIEAVFVV
FT                   SPTYDGIVSDIKTIAEIVHRFHLPLIVDEAHGAHFPFGREGEFPVSALELGADVVIQSL
FT                   HKTLPSFTQTAVMHVREGYVDMGRLDRYVHMYQTSSPSYVLMAGIEGCIRYMIGEGLEQ
FT                   MKLFSSKIEKVRKVLSGLKHLKLLTDREKGLYGVYDIDHSKIIISTRGTGKSGTWLDDR
FT                   LRTEYHLEMEMCGPDYVTAITTLADTQEGLERLCNALLHIDSGLSIEESGKAETGFSQE
FT                   LEISPACRMTIAQAMDEPRHRIAISNGEGMVSAEFVYVYPPGIPIVVPGEVLNKESIDL
FT                   VMKYKELGLAVQGMEDEESRELYVVNEAGQTGE"
FT                   /protein_id="YP_003820284.1"
FT   misc_feature    25089..26552
FT                   /note="Arginine/lysine/ornithine decarboxylases [Amino acid
FT                   transport and metabolism]; Region: LdcC; COG1982"
FT                   /db_xref="CDD:32165"
FT                   /locus_tag="Closa_0018"
FT   misc_feature    25107..25937
FT                   /note="Aspartate aminotransferase (AAT) superfamily (fold
FT                   type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP
FT                   combines with an alpha-amino acid to form a compound called
FT                   a Schiff base or aldimine intermediate, which depending on
FT                   the reaction, is the...; Region: AAT_I; cl00321"
FT                   /db_xref="CDD:176816"
FT                   /locus_tag="Closa_0018"
FT   misc_feature    order(25344..25349,25356..25358,25575..25577,25659..25661,
FT                   25668..25670,25749..25751,25758..25760)
FT                   /note="pyridoxal 5'-phosphate binding pocket; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="Closa_0018"
FT   misc_feature    25758..25760
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:99742"
FT                   /locus_tag="Closa_0018"
FT   gene            26926..27513
FT                   /db_xref="GeneID:9505267"
FT                   /locus_tag="Closa_0019"
FT   CDS_pept        26926..27513
FT                   /locus_tag="Closa_0019"
FT                   /gene_family="HOG000027511" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00625"
FT                   /codon_start="1"
FT                   /product="guanylate kinase"
FT                   /transl_table="11"
FT                   /note="KEGG: ere:EUBREC_3276 guanylate kinase; PFAM:
FT                   guanylate kinase; SMART: guanylate kinase/L-type calcium
FT                   channel region"
FT                   /db_xref="GI:302384463"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="GeneID:9505267"
FT                   /translation="MGKIFYVMGKSASGKDTIYKRLLKRLPQLKKVVLYTTRPIRDGER
FT                   DGEEYYFTTTEKLEEFRKENRLIEERTYETIYGPWSYFTVDDGQIDLEGENGYLMIGTL
FT                   ESFEKTRSYFGKDRLFPLYVEVDDGDRLLRAIKRERGQKVPKYKELCRRFLADEEDFRD
FT                   ENLLRCGIHRRFCNQELEACLDEIVHAVTEEI"
FT                   /protein_id="YP_003820285.1"
FT   misc_feature    26935..>27213
FT                   /note="Nucleoside/nucleotide kinase (NK) is a protein
FT                   superfamily consisting of multiple families of enzymes that
FT                   share structural similarity and are functionally related to
FT                   the catalysis of the reversible phosphate group transfer
FT                   from nucleoside...; Region: NK; cl11962"
FT                   /db_xref="CDD:175376"
FT                   /locus_tag="Closa_0019"
FT   misc_feature    order(26950..26952,26965..26976)
FT                   /note="active site"
FT                   /db_xref="CDD:73295"
FT                   /locus_tag="Closa_0019"
FT   gene            complement(27583..28584)
FT                   /db_xref="GeneID:9505268"
FT                   /locus_tag="Closa_0020"
FT   CDS_pept        complement(27583..28584)
FT                   /locus_tag="Closa_0020"
FT                   /gene_family="HOG000212232" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /codon_start="1"
FT                   /product="inner-membrane translocator"
FT                   /transl_table="11"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   clo:HMPREF0868_0027 amino acid or sugar ABC transport
FT                   system, permease protein"
FT                   /db_xref="GI:302384464"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="GeneID:9505268"
FT                   /translation="MKKKKMKDILGKVAPLLALVLLFIVLSLATDKFFTLNNMMNILRQ
FT                   TAVNGLISAAMLVVLITAGIDLSVGANAILCACMMGMLKTSFGITNSLVLILVCIITGV
FT                   FVGFLNGILLTKMHLPHPFVSTLGMKNVLCGLALLVVSTKTISDFPAAVTFLGSSNLFK
FT                   VSGGFSGIPLCFLILILIYVVYHFFLNKTALGRMIYCVGGNPEAARLSGINSDNILIFV
FT                   YSLSGFMCAIAGLVIVGRSAVANPSAAISPYDTDAIAACIIGGASFMGGKGTIWGTLIG
FT                   ALMISTIRNGLTLLNTSSSVQYVVIGLVIIAAVFIDVTRTRMEAKAKRLAAK"
FT                   /protein_id="YP_003820286.1"
FT   misc_feature    complement(27634..28449)
FT                   /note="Transmembrane subunit (TM) of Escherichia coli AraH
FT                   and related proteins. E. coli AraH is the TM of a
FT                   Periplasmic Binding Protein (PBP)-dependent ATP-Binding
FT                   Cassette (ABC) transporter involved in the uptake of the
FT                   monosaccharide arabinose. This group...; Region:
FT                   TM_PBP1_transp_AraH_like; cd06579"
FT                   /db_xref="CDD:119321"
FT                   /locus_tag="Closa_0020"
FT   misc_feature    complement(27913..27969)
FT                   /note="TM-ABC transporter signature motif; other site"
FT                   /db_xref="CDD:119321"
FT                   /locus_tag="Closa_0020"
FT   gene            complement(28584..30086)
FT                   /db_xref="GeneID:9505269"
FT                   /locus_tag="Closa_0021"
FT   CDS_pept        complement(28584..30086)
FT                   /locus_tag="Closa_0021"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: clo:HMPREF0868_0026 ABC transporter,
FT                   ATP-binding protein; PFAM: ABC transporter related; SMART:
FT                   AAA ATPase"
FT                   /db_xref="GI:302384465"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9505269"
FT                   /translation="MSNYLIELKGVTKRFPGVVAMRNMSLQIRPGEIHGLIGENGAGKS
FT                   TLIKVLTGVHIPEEGTINIEGNKVSFKNPNDAAAAGIACVYQELNIVKLLSVTDNIFIN
FT                   KALKKKGSPFLEYAKMHEIAHEVMLSLGQDIDVKKECGSYGMGIQQMVEIAKAVLIDAK
FT                   LIIMDEPTSSLGEKEVEQLMKTVRSLKEKGIAILFVSHKLEELFELCDRVTVMRDGEHI
FT                   LTKNTVELDNDSLIAAMVGRTLDNQYPKVESKTGTEALRVEHLNSAGVLRDVSFHANHG
FT                   EILGFAGLVGAGRTETFRAVFGADPFDSGDIYVNGKKAAIKSPKDGIQCGMAFLTEDRK
FT                   GQGLVLSQSVRTNLILSNMRSCVKGLFFDEKQIDQLAEEAISDLKIKTPTADEVVGQLS
FT                   GGNQQKVVIGKWINTDADIYIFDEPTRGIDVGAKVEVYNIMNRLVLAGKCVIMISSELP
FT                   EIIGMSDRVIIMREGRVMGELSKKTDVLNQEIIMKAAWGGKI"
FT                   /protein_id="YP_003820287.1"
FT   misc_feature    complement(28593..30086)
FT                   /note="ABC-type sugar transport system, ATPase component
FT                   [Carbohydrate transport and metabolism]; Region: MglA;
FT                   COG1129"
FT                   /db_xref="CDD:31325"
FT                   /locus_tag="Closa_0021"
FT   misc_feature    complement(29415..30071)
FT                   /note="This family represents the domain I of the
FT                   carbohydrate uptake proteins that transport only
FT                   monosaccharides (Monos).  The Carb_Monos family is involved
FT                   in the uptake of monosaccharides, such as pentoses (such as
FT                   xylose, arabinose, and ribose) and...; Region:
FT                   ABC_Carb_Monos_I; cd03216"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="Closa_0021"
FT   misc_feature    complement(29952..29975)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="Closa_0021"
FT   misc_feature    complement(order(29484..29486,29580..29585,29826..29828,
FT                   29949..29957,29961..29966))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="Closa_0021"
FT   misc_feature    complement(29826..29837)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="Closa_0021"
FT   misc_feature    complement(order(29628..29642,29688..29702))
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="Closa_0021"
FT   misc_feature    complement(29580..29597)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="Closa_0021"
FT   misc_feature    complement(29562..29573)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="Closa_0021"
FT   misc_feature    complement(29478..29498)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="Closa_0021"
FT   misc_feature    complement(28662..29321)
FT                   /note="This family represents domain II of the carbohydrate
FT                   uptake proteins that transport only monosaccharides
FT                   (Monos).  The Carb_Monos family is involved in the uptake
FT                   of monosaccharides, such as pentoses (such as xylose,
FT                   arabinose, and ribose) and hexoses (; Region:
FT                   ABC_Carb_Monos_II; cd03215"
FT                   /db_xref="CDD:72974"
FT                   /locus_tag="Closa_0021"
FT   gene            complement(30123..31097)
FT                   /db_xref="GeneID:9505270"
FT                   /locus_tag="Closa_0022"
FT   CDS_pept        complement(30123..31097)
FT                   /locus_tag="Closa_0022"
FT                   /gene_family="HOG000212345" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /codon_start="1"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: gtn:GTNG_1813
FT                   D-ribose-binding periplasmic protein"
FT                   /db_xref="GI:302384466"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="GeneID:9505270"
FT                   /translation="MKRKIVSMLLASAMLASMTGCGGQKTVTESVATEKASSEDITVGV
FT                   ILKTLSSEYWGYVAAGVQAASKDLGVKVDLQGPASETAYDEQNNMIETMLSGGVDAFVI
FT                   SPLQSDSVASVIGDVNIPIITVDTDAEIAGKVSFVGTGNDNAAYQGGLFAAKKAGKGAK
FT                   AVIIGGVEGNATSDARQAGYTKALEENGVEIVSVQYAQSNPDTAANVMENIITAQNGDI
FT                   QIVCCHNDDTAAGASNAVKQLGLKDVVIVGFDGNQSGVQNIIDGNITATCAQAAYTMGY
FT                   KAVETALQAIKGETVETFVDTGCEVITADNAETYLEKLKGYLK"
FT                   /protein_id="YP_003820288.1"
FT   misc_feature    complement(30138..31010)
FT                   /note="ABC-type sugar transport system, periplasmic
FT                   component [Carbohydrate transport and metabolism]; Region:
FT                   RbsB; COG1879"
FT                   /db_xref="CDD:32063"
FT                   /locus_tag="Closa_0022"
FT   misc_feature    complement(30168..30974)
FT                   /note="Periplasmic sugar-binding domain of uncharacterized
FT                   ABC-type transport systems; Region:
FT                   PBP1_ABC_sugar_binding_like_2; cd06310"
FT                   /db_xref="CDD:107305"
FT                   /locus_tag="Closa_0022"
FT   misc_feature    complement(order(30276..30278,30336..30338,30561..30563,
FT                   30717..30719,30936..30938))
FT                   /note="putative ligand binding site; other site"
FT                   /db_xref="CDD:107305"
FT                   /locus_tag="Closa_0022"
FT   gene            complement(31318..32745)
FT                   /db_xref="GeneID:9505271"
FT                   /locus_tag="Closa_0023"
FT   CDS_pept        complement(31318..32745)
FT                   /locus_tag="Closa_0023"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:COG:COG1129"
FT                   /codon_start="1"
FT                   /product="ABC-type sugar transport system ATPase
FT                   component-like protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cpy:Cphy_3280 ABC-type sugar transport system
FT                   ATPase component-like protein"
FT                   /db_xref="GI:302384467"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="GeneID:9505271"
FT                   /translation="MKTELIRYENIHCTMDGQTCFNGLHFRAFEGEISCVIVNNSIEKE
FT                   YFLELLRGNLKPGYGWTYYKGKKIITPKMQELMLRQTAFIGRNKGIFSALSVAENIFVA
FT                   SGRVPFWKLVNPLCRQAPGLLDDLDSPIPLLDKAHLLDPGMQKQAELIRAYVSGCHLAV
FT                   ITDMEMIMTEEQLKNFFILVKKLKARGMTFLYVVNSSTKLYEYADEITIIKNGRTVGHM
FT                   NQEDFSKFQTYMELFEKTKKNTLKKNNLALKQIDKKTVLEFRDVKLPDLPLLNLSLNAG
FT                   DVLNILDLDSTKCRNILPILQGECGFEAGRILLNGREYSFQSVHQSIGDGIAFVEARPM
FT                   EEMLFADMTVLDYMTFMIQRNKKKYFLRKKYRKMTWHLMEGIFTEEELMKKTYTVSDEC
FT                   KLKLLYYRWIFVRPKVLVCIKPFSSVDFQMRQITINLLKEVLKSGIAVIIITNQIAEAY
FT                   TMEGKNVTFHNGTITMD"
FT                   /protein_id="YP_003820289.1"
FT   misc_feature    complement(31327..32745)
FT                   /note="ABC-type sugar transport system, ATPase component
FT                   [Carbohydrate transport and metabolism]; Region: MglA;
FT                   COG1129"
FT                   /db_xref="CDD:31325"
FT                   /locus_tag="Closa_0023"
FT   misc_feature    complement(32095..32721)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Closa_0023"
FT   misc_feature    complement(32611..32634)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Closa_0023"
FT   misc_feature    complement(order(32152..32154,32248..32253,32608..32616,
FT                   32620..32625))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Closa_0023"
FT   misc_feature    complement(32296..32325)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Closa_0023"
FT   misc_feature    complement(32248..32265)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Closa_0023"
FT   misc_feature    complement(32230..32241)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Closa_0023"
FT   misc_feature    complement(32146..32166)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Closa_0023"
FT   misc_feature    complement(31330..31908)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Closa_0023"
FT   misc_feature    complement(31861..31884)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Closa_0023"
FT   misc_feature    complement(order(31390..31392,31486..31491,31735..31737,
FT                   31858..31866,31870..31875))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Closa_0023"
FT   misc_feature    complement(31735..31746)
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Closa_0023"
FT   misc_feature    complement(order(31534..31551,31603..31614))
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Closa_0023"
FT   misc_feature    complement(31486..31503)
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Closa_0023"
FT   misc_feature    complement(31468..31479)
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Closa_0023"
FT   misc_feature    complement(31384..31404)
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Closa_0023"
FT   gene            complement(32742..33779)
FT                   /db_xref="GeneID:9505272"
FT                   /locus_tag="Closa_0024"
FT   CDS_pept        complement(32742..33779)
FT                   /locus_tag="Closa_0024"
FT                   /gene_family="HOG000027698" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /codon_start="1"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /transl_table="11"
FT                   /note="KEGG: cpy:Cphy_3281 signal transduction histidine
FT                   kinase, LytS; PFAM: histidine kinase internal region;
FT                   ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="GI:302384468"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="GeneID:9505272"
FT                   /translation="MKKQWLKKRILIWIRAMVSWSCLALILFILILLKPELTESILYGI
FT                   MVWIMLLSFLLLLVIGRFRILEPLGTMRKKIELFNDGIIFTEIFKSLEGISPDTDALLL
FT                   KMDTILDKDKMMENAKQQARYLALQNQINPHFLYNVLESIRSDALMAGVPEIGKITEAL
FT                   AVFFRYTTSKMERLSTLQEELANVENYFLIQKYRFDDKLELKIQLPRDDDEILKTRIPK
FT                   LTLQPIVENAIKHGLEPKVSGGTVIIDIEHSDTILYLSVIDNGIGIEEARLESLNEKLS
FT                   RIDAGDGSANEGGKGGIALINVNSRIRLLMGDEYGLHILSTPRIGTEVRLILPYMFEPE
FT                   EGRKS"
FT                   /protein_id="YP_003820290.1"
FT   misc_feature    complement(33162..33410)
FT                   /note="Histidine kinase; Region: His_kinase; pfam06580"
FT                   /db_xref="CDD:148281"
FT                   /locus_tag="Closa_0024"
FT   misc_feature    complement(32781..33107)
FT                   /note="Histidine kinase-like ATPases; This family includes
FT                   several ATP-binding proteins for example: histidine kinase,
FT                   DNA gyrase B, topoisomerases, heat shock protein HSP90,
FT                   phytochrome-like ATPases and DNA mismatch repair proteins;
FT                   Region: HATPase_c; cd00075"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Closa_0024"
FT   misc_feature    complement(order(32793..32795,32799..32804,32817..32819,
FT                   32823..32825,32880..32891,32976..32981,32985..32987,
FT                   32991..32993,32997..32999,33078..33080,33087..33089,
FT                   33099..33101))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Closa_0024"
FT   misc_feature    complement(33087..33089)
FT                   /note="Mg2+ binding site; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Closa_0024"
FT   misc_feature    complement(order(32883..32885,32889..32891,32979..32981,
FT                   32985..32987))
FT                   /note="G-X-G motif; other site"
FT                   /db_xref="CDD:28956"
FT                   /locus_tag="Closa_0024"
FT   gene            complement(33797..35425)
FT                   /db_xref="GeneID:9505273"
FT                   /locus_tag="Closa_0025"
FT   CDS_pept        complement(33797..35425)
FT                   /locus_tag="Closa_0025"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /codon_start="1"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /transl_table="11"
FT                   /note="KEGG: cpy:Cphy_3282 two component AraC family
FT                   transcriptional regulator; PFAM: response regulator
FT                   receiver; helix-turn-helix- domain containing protein AraC
FT                   type; SMART: Helix-turn-helix, AraC domain; response
FT                   regulator receiver"
FT                   /db_xref="GI:302384469"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="GeneID:9505273"
FT                   /translation="MILILGIIIADDEKKICRLLEYLIDWDEIGAKLLGVAYDGISAFQ
FT                   LIQEKKPDVLLTDIRMPGMDGLQLIEEAKKQNASLKCIIISGYKDFQYAQQGIRYGVRD
FT                   YLLKPINQDDLTRTLKKLVNETMEQKSSQEARRHLEKTVRDYSGEFKRVFLKIVLEQKP
FT                   EERPETVLKEVRKINTSQVIDQGGRCLVVKPDIEYKDFTKDAYQLLIDKTIEILQVEFA
FT                   SEEGELTIESSYEGIFLLLCHESPDKEELIKALNHVRDRVMGLQDLFPKIYFTAIITEP
FT                   VDSDEELIRQIQYSRIAMYNRLLTDTNMVSELNAPAAKSEKNHILSSKISNLLENRPES
FT                   FEPEEIKKSLKEAKRIMHETKNISGLDVKTELLHMARNYMDWFELLDTTLDKSGKAVYF
FT                   SEMYEHCISLDQAFELLEETLIKTLFEVLNHLKSREIKPVAYAKHYIEKNKGIDIKLEE
FT                   LAKNAGFSYSYFSYLFKKETGKTLTEYIQMVRIETAKKLLVEKERNVSEIAEMVGYSDI
FT                   KFFTKQFKKTLGVSPNEYRKMFLER"
FT                   /protein_id="YP_003820291.1"
FT   misc_feature    complement(33815..35407)
FT                   /note="Response regulator containing CheY-like receiver
FT                   domain and AraC-type DNA-binding domain [Signal
FT                   transduction mechanisms]; Region: COG4753"
FT                   /db_xref="CDD:34367"
FT                   /locus_tag="Closa_0025"
FT   misc_feature    complement(35057..35404)
FT                   /note="Signal receiver domain; originally thought to be
FT                   unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
FT                   recently identified in eukaroytes ETR1 Arabidopsis
FT                   thaliana; this domain receives the signal from the sensor
FT                   partner in a two-component systems...; Region: REC;
FT                   cd00156"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Closa_0025"
FT   misc_feature    complement(order(35099..35104,35111..35113,35168..35170,
FT                   35228..35230,35252..35254,35390..35395))
FT                   /note="active site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Closa_0025"
FT   misc_feature    complement(35252..35254)
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Closa_0025"
FT   misc_feature    complement(order(35228..35236,35240..35245))
FT                   /note="intermolecular recognition site; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Closa_0025"
FT   misc_feature    complement(35096..35104)
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:29071"
FT                   /locus_tag="Closa_0025"
FT   misc_feature    complement(33965..34090)
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="Closa_0025"
FT   misc_feature    complement(33815..33928)
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="Closa_0025"
FT   gene            35684..36673
FT                   /db_xref="GeneID:9505274"
FT                   /locus_tag="Closa_0026"
FT   CDS_pept        35684..36673
FT                   /locus_tag="Closa_0026"
FT                   /gene_family="HOG000192593" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00678"
FT                   /codon_start="1"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: DNA polymerase III, delta prime subunit;
FT                   KEGG: cpy:Cphy_3913 DNA polymerase III, delta prime
FT                   subunit"
FT                   /db_xref="GI:302384470"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="GeneID:9505274"
FT                   /translation="MPGFKDIIGHERIKEHLQKAIESNHVSHAYILSGEAGMGRKSLAN
FT                   AFAMTLLCEKGKSEPCMQCHACKQVMSGNHPDLVFLTHEKPGSIGVDDVREQIHDTIMI
FT                   RPYSSYYKIYIVDEAEKMTVQAQNALLKTIEEPPSYAVIMLLTTNQEAFLPTILSRCVQ
FT                   LTLKPLQDSVVKTYLSGSLGIGESKAEVYAAFARGNLGRAIHLASSEEFQLMYTELIHM
FT                   LKHIKDMDIIELLYYIKKMKDENFDIYDCLDFMQLWYRDVLMFKVTQDINLLIFREEYN
FT                   TMKELSAASAYDGIEMILKAIDKARIRLDANVNMELAMELMLLVMKEN"
FT                   /protein_id="YP_003820292.1"
FT   misc_feature    35732..36292
FT                   /note="DNA polymerase III, delta' subunit; Region: holB;
FT                   TIGR00678"
FT                   /db_xref="CDD:161993"
FT                   /locus_tag="Closa_0026"
FT   misc_feature    <36023..>36163
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Closa_0026"
FT   gene            36677..37585
FT                   /db_xref="GeneID:9505275"
FT                   /locus_tag="Closa_0027"
FT   CDS_pept        36677..37585
FT                   /locus_tag="Closa_0027"
FT                   /gene_family="HOG000193708" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04468"
FT                   /codon_start="1"
FT                   /product="PSP1 domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: PSP1 domain protein; KEGG: cpy:Cphy_3912 PSP1
FT                   domain-containing protein"
FT                   /db_xref="GI:302384471"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="GeneID:9505275"
FT                   /translation="MIKVIGVRFRNAGKIYYFDPMNLEVRTGDHVIVETARGIEYGYVV
FT                   LGCREVEDDKVIQPLKPVIRMATKGDDEVEKKNHEKEKEAFKICKEKIRKHGLQMKLID
FT                   AEYTFDNNKVLFYFTADGRIDFRELVKDLASVFKTRIELRQVGVRDETKIVGGIGICGR
FT                   TLCCHSYLSEFIPVSIKMAKEQNLSLNPTKISGVCGRLMCCLKNEEETYEELNSKLPNV
FT                   GDFVTTDDGLKGEVHSVSVLRQLVKVVVTIKDEKEIREYKVEQLKFKPRRRREKTQVTD
FT                   AELKALEALEKREGKSKLDDN"
FT                   /protein_id="YP_003820293.1"
FT   misc_feature    36677..37384
FT                   /note="PSP1 C-terminal conserved region; Region: PSP1;
FT                   cl00770"
FT                   /db_xref="CDD:153984"
FT                   /locus_tag="Closa_0027"
FT   gene            37575..38312
FT                   /db_xref="GeneID:9505276"
FT                   /locus_tag="Closa_0028"
FT   CDS_pept        37575..38312
FT                   /locus_tag="Closa_0028"
FT                   /gene_family="HOG000194826" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /codon_start="1"
FT                   /product="Methyltransferase type 11"
FT                   /transl_table="11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: cpy:Cphy_3911
FT                   methyltransferase type 11"
FT                   /db_xref="GI:302384472"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="GeneID:9505276"
FT                   /translation="MTIDLKENERIDDLQRNGYKIIQNRDGFCFGMDAVLLSGFALVKP
FT                   GEKAVDLGTGTGIIPLLLEAKNQGIHYTGLEIQEAMAEMARRSVALNHLEEKITIVTGD
FT                   IKEASRLFGAASFDVVTSNPPYMNDSHGLKNPDLPKAIARHEVLCSLSDVTREAARLLR
FT                   PGGRFYMVHRPHRLVEIITALKDCRLEPKRMKMVHPFADKEANMVLIEAVRGGRSMIKV
FT                   EAPVIVYKEPGVYTDEIYTIYGY"
FT                   /protein_id="YP_003820294.1"
FT   misc_feature    37587..38303
FT                   /note="Predicted O-methyltransferase [General function
FT                   prediction only]; Region: COG4123"
FT                   /db_xref="CDD:33880"
FT                   /locus_tag="Closa_0028"
FT   misc_feature    37767..38087
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cd02440"
FT                   /db_xref="CDD:100107"
FT                   /locus_tag="Closa_0028"
FT   gene            38400..39257
FT                   /db_xref="GeneID:9505277"
FT                   /locus_tag="Closa_0029"
FT   CDS_pept        38400..39257
FT                   /locus_tag="Closa_0029"
FT                   /gene_family="HOG000195942" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /codon_start="1"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: cpy:Cphy_3910
FT                   uroporphyrin-III C/tetrapyrrole methyltransferase"
FT                   /db_xref="GI:302384473"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="GeneID:9505277"
FT                   /translation="MEEIKGKLFLCATPIGNLDDITLRVLNTLKEVDLIAAEDTRHSIK
FT                   LLNHFEIKTPMTSYHEHNKVEKARYLVEQMKQGVRIALITDAGTPGISDPGEELVRQCY
FT                   EAGIELTSLPGPAACITALTLSGLGTRRFCFEAFLPTDKKEKQWILEELKEETKTMIIY
FT                   EAPHRLVKTLKELYEVLGDRRITICRELTKRFETAFRTTFSNALKAYEEEDPKGECVIV
FT                   IEGKSIRDRIEEKVMASREMSLEEHMELYVNQGLDRKEAMRMVAKDRGISKREVYQYLI
FT                   KNES"
FT                   /protein_id="YP_003820295.1"
FT   misc_feature    38403..39251
FT                   /note="Tetrapyrrole (Corrin/Porphyrin) Methylases; Region:
FT                   TP_methylase; cl00304"
FT                   /db_xref="CDD:174096"
FT                   /locus_tag="Closa_0029"
FT   gene            39382..40359
FT                   /db_xref="GeneID:9505278"
FT                   /locus_tag="Closa_0030"
FT   CDS_pept        39382..40359
FT                   /locus_tag="Closa_0030"
FT                   /gene_family="HOG000246674" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00747"
FT                   /codon_start="1"
FT                   /EC_number="2.3.1.41"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) synthase
FT                   III; KEGG: ere:EUBREC_3140 3-oxoacyl-[acyl-carrier-protein]
FT                   synthase III; PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III domain protein;
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III"
FT                   /db_xref="GI:302384474"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="GeneID:9505278"
FT                   /translation="MGEFMTTRIIGTGSAVPEQVVTNEDLARLVDTSDEWIRTRTGIKE
FT                   RRIASAESGTSDLAIQAAKEALNHAGVSAEELDIIILATSSADCCFPSGACEVQAAIGA
FT                   LHAAAFDISAACSGFVYALNTVHGFFKAGIYQTGLVIGADTLSKLIDWNDRSTCVLFGD
FT                   GAGAAVVRAEEKGILHTVMGADGTRGKVLECGGRTTGNFLTGKKPELGYMTMDGQEVFK
FT                   FAAKTVPESIKRVVEESGTAMEEIKYFILHQANYRIFESIAKRLKIPMEKFPTNLDRYG
FT                   NTSGATIPILLDEMNREGKFQRGDKIVLAGFGAGLTWGATLLEW"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase III"
FT                   /protein_id="YP_003820296.1"
FT   misc_feature    39394..40356
FT                   /note="3-oxoacyl-(acyl carrier protein) synthase III;
FT                   Reviewed; Region: PRK09352"
FT                   /db_xref="CDD:169809"
FT                   /locus_tag="Closa_0030"
FT   misc_feature    39403..40350
FT                   /note="Ketoacyl-acyl carrier protein synthase III (KASIII)
FT                   initiates the elongation in type II fatty acid synthase
FT                   systems. It is found in bacteria and plants. Elongation of
FT                   fatty acids in the type II systems occurs by Claisen
FT                   condensation of malonyl-acyl...; Region: KAS_III; cd00830"
FT                   /db_xref="CDD:29417"
FT                   /locus_tag="Closa_0030"
FT   misc_feature    order(39634..39636,39640..39642,39667..39669,39676..39678,
FT                   39700..39720,39742..39744,39751..39756,39763..39768,
FT                   39823..39825,39925..39942,39958..39963,40324..40326)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29417"
FT                   /locus_tag="Closa_0030"
FT   misc_feature    order(39727..39729,40135..40137,40225..40227)
FT                   /note="active site"
FT                   /db_xref="CDD:29417"
FT                   /locus_tag="Closa_0030"
FT   misc_feature    40144..40146
FT                   /note="CoA binding pocket; other site"
FT                   /db_xref="CDD:29417"
FT                   /locus_tag="Closa_0030"
FT   gene            40436..40672
FT                   /db_xref="GeneID:9505279"
FT                   /locus_tag="Closa_0031"
FT   CDS_pept        40436..40672
FT                   /locus_tag="Closa_0031"
FT                   /gene_family="HOG000178184" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00517"
FT                   /codon_start="1"
FT                   /product="acyl carrier protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ere:EUBREC_3148 acyl carrier protein; TIGRFAM:
FT                   acyl carrier protein; PFAM: phosphopantetheine-binding"
FT                   /db_xref="GI:302384475"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="GeneID:9505279"
FT                   /translation="MMLEKMQEIIAEQLNVEAGTITAQSSFKEDLGADSLDLFELVMAL
FT                   EDEYSVEIPSEDLEKLTTVQQVMDYLKAKGVEA"
FT                   /protein_id="YP_003820297.1"
FT   misc_feature    40436..40657
FT                   /note="Phosphopantetheine attachment site; Region:
FT                   PP-binding; cl09936"
FT                   /db_xref="CDD:175050"
FT                   /locus_tag="Closa_0031"
FT   gene            40672..41595
FT                   /db_xref="GeneID:9505280"
FT                   /locus_tag="Closa_0032"
FT   CDS_pept        40672..41595
FT                   /locus_tag="Closa_0032"
FT                   /gene_family="HOG000123285" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03151"
FT                   /codon_start="1"
FT                   /product="enoyl-(acyl-carrier-protein) reductase II"
FT                   /transl_table="11"
FT                   /note="KEGG: ere:EUBREC_3147 2-nitropropane
FT                   dioxygenase-like dioxygenase; TIGRFAM:
FT                   enoyl-(acyl-carrier-protein) reductase II; PFAM:
FT                   2-nitropropane dioxygenase NPD"
FT                   /db_xref="GI:302384476"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR017569"
FT                   /db_xref="GeneID:9505280"
FT                   /translation="MKTRITELLGVEHPIIQGGMAWVAEHHLAAAVSEAGGLGLIGGAN
FT                   APGEVVRAEIRKAKELTGKPIGVNVMLLSPHAEDVAKVVVEEGIKVVTTGAGNPERFMD
FT                   MWKAAGIKVIPVVASVALAKRMEKYGADAVVAEGCESGGHIGEQTTMTLVPQIVDAVSI
FT                   PVIAAGGIGDGRGMAAAFMLGAEAVQIGTRFVVAKESIVHDNYKQRIIKAKDIDSAVTG
FT                   RSHGHPVRSLRNQMTREYARLEQEGKSFEELEYMTLGTLRKAVQEGDITNGTVMAGQIA
FT                   GMISREQTCREMIDEMMEQAERLLCR"
FT                   /protein_id="YP_003820298.1"
FT   misc_feature    40675..41592
FT                   /note="putative enoyl-(acyl-carrier-protein) reductase II;
FT                   Region: enACPred_II; TIGR03151"
FT                   /db_xref="CDD:132195"
FT                   /locus_tag="Closa_0032"
FT   misc_feature    40702..41367
FT                   /note="2-Nitropropane dioxygenase (NPD), one of the
FT                   nitroalkane oxidizing enzyme families, catalyzes oxidative
FT                   denitrification of nitroalkanes to their corresponding
FT                   carbonyl compounds and nitrites. NDP is a member of the
FT                   NAD(P)H-dependent flavin...; Region: NPD_like; cd04730"
FT                   /db_xref="CDD:73392"
FT                   /locus_tag="Closa_0032"
FT   misc_feature    order(40726..40731,40882..40884,40954..40956,41017..41019,
FT                   41080..41082,41092..41097,41173..41181,41236..41247)
FT                   /note="FMN binding site; other site"
FT                   /db_xref="CDD:73392"
FT                   /locus_tag="Closa_0032"
FT   misc_feature    41098..41103
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:73392"
FT                   /locus_tag="Closa_0032"
FT   misc_feature    41101..41103
FT                   /note="putative catalytic residue; other site"
FT                   /db_xref="CDD:73392"
FT                   /locus_tag="Closa_0032"
FT   gene            41612..42526
FT                   /db_xref="GeneID:9505281"
FT                   /locus_tag="Closa_0033"
FT   CDS_pept        41612..42526
FT                   /locus_tag="Closa_0033"
FT                   /gene_family="HOG000036504" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00128"
FT                   /codon_start="1"
FT                   /product="malonyl CoA-acyl carrier protein transacylase"
FT                   /transl_table="11"
FT                   /note="KEGG: cpy:Cphy_0516 malonyl CoA-acyl carrier protein
FT                   transacylase; TIGRFAM: malonyl CoA-acyl carrier protein
FT                   transacylase; PFAM: Acyl transferase"
FT                   /db_xref="GI:302384477"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="GeneID:9505281"
FT                   /translation="MSKIAFIFPGQGAQYCGMGQDFYEQTRIGKETYDMASDLLGFSLP
FT                   ELCFEKNDRLDITEYTQAAMVTTSIAMMRVLEAEKGIRPQVSAGLSLGEYCALAASGVM
FT                   SDRDAIRTVRQRGILMQEAVPAGIGAMAAVLALDACKIEEVLSSMEGVQIANYNCPGQI
FT                   VISGKKEAVEAANEKLLAAGAKRVLMLNVSGPFHSSMLTGAGERLGEVLKGVEIQTPQI
FT                   PYVANVTARYVRDREMVKPLLKEQVYSSVRWQQSVETMVADGVDTFVEIGPGKTLAGFI
FT                   KKITKDARVFNIEKLEDMEAYFS"
FT                   /protein_id="YP_003820299.1"
FT   misc_feature    41612..42514
FT                   /note="Acyl transferase domain; Region: Acyl_transf_1;
FT                   cl08282"
FT                   /db_xref="CDD:174994"
FT                   /locus_tag="Closa_0033"
FT   misc_feature    41615..42475
FT                   /note="malonyl CoA-acyl carrier protein transacylase;
FT                   Region: fabD; TIGR00128"
FT                   /db_xref="CDD:161724"
FT                   /locus_tag="Closa_0033"
FT   gene            42625..43365
FT                   /db_xref="GeneID:9505282"
FT                   /locus_tag="Closa_0034"
FT   CDS_pept        42625..43365
FT                   /locus_tag="Closa_0034"
FT                   /inference="protein motif:TFAM:TIGR01830"
FT                   /codon_start="1"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /transl_table="11"
FT                   /note="KEGG: ere:EUBREC_3145
FT                   3-oxoacyl-[acyl-carrier-protein] reductase; TIGRFAM:
FT                   3-oxoacyl-(acyl-carrier-protein) reductase; PFAM:
FT                   short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="GI:302384478"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="GeneID:9505282"
FT                   /translation="MLNGKIAVVTGAARGIGRAIAVKLAEQGATVIINYNGSDSLAMEV
FT                   VKEIEDKGGKAEAIQCNVAEYERVGVLLEGVIKKYGTLDILVNNAGITRDNLLMKMSEE
FT                   DFDAVINTNLKGVFNCMKHVARQMIKQKSGRIINISSVSGVLGNAGQANYSAAKAGVIG
FT                   ITKSFAREVASRGITVNAVAPGFIQTAMTDVLPESIKAATLEQIPMKRFGAADDIAGAV
FT                   AFLASEEAGYITGQVISVDGGMAM"
FT                   /protein_id="YP_003820300.1"
FT   misc_feature    42625..43362
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05557"
FT                   /db_xref="CDD:168093"
FT                   /locus_tag="Closa_0034"
FT   misc_feature    42691..43362
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="Closa_0034"
FT   gene            43497..44735
FT                   /db_xref="GeneID:9505283"
FT                   /locus_tag="Closa_0035"
FT   CDS_pept        43497..44735
FT                   /locus_tag="Closa_0035"
FT                   /gene_family="HOG000060166" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR03150"
FT                   /codon_start="1"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase 2"
FT                   /transl_table="11"
FT                   /note="KEGG: ere:EUBREC_3144 FabF; TIGRFAM:
FT                   3-oxoacyl-[acyl-carrier-protein] synthase 2; PFAM:
FT                   Beta-ketoacyl synthase"
FT                   /db_xref="GI:302384479"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="GeneID:9505283"
FT                   /translation="MKRRVVVTGMGAITPIGKDVESFWNGLKEKNVGIGPITQFDTTDY
FT                   KAKLAAEVKDFDPKEYMDVKAAKRMERFAQFAVAASKEALEMSGIDIEKEDPYRVGVSV
FT                   GSGIGSLQALERENKKLLEKGPGRVNPLLVPLMISNMAAGNVGIQFGLKGKCINVVTAC
FT                   ATGTHSIGEAFRSIQYGEADVMVAGGAEASITPIGVAGFTALTALTTADDPLRASIPFD
FT                   KDRSGFVMGEGAGVVILEELEHALSRNAVIYGEVVGYGSTCDAYHITSPAEDGSGAARA
FT                   MTDAIKDGGITPEVIDYVNAHGTSTHHNDLFETLAIKTALGDHAKDVKISSTKSMVGHL
FT                   LGAAGGVEFIACIKSIEDGFVHATAGLEEEGEGCDLDYTKGEGVSFDVTYAISNSLGFG
FT                   GHNASILVKKFEH"
FT                   /protein_id="YP_003820301.1"
FT   misc_feature    43503..44720
FT                   /note="beta-ketoacyl-acyl-carrier-protein synthase II;
FT                   Region: fabF; TIGR03150"
FT                   /db_xref="CDD:163158"
FT                   /locus_tag="Closa_0035"
FT   misc_feature    43503..44717
FT                   /note="Beta-ketoacyl-acyl carrier protein (ACP) synthase
FT                   (KAS), type I and II. KASs are responsible for the
FT                   elongation steps in fatty acid biosynthesis. KASIII
FT                   catalyses the initial condensation and KAS I and II
FT                   catalyze further elongation steps by Claisen...; Region:
FT                   KAS_I_II; cd00834"
FT                   /db_xref="CDD:29421"
FT                   /locus_tag="Closa_0035"
FT   misc_feature    order(43815..43817,43836..43841,43851..43853,43857..43862,
FT                   43896..43898,43914..43916,43926..43928,43938..43940,
FT                   43956..43958,43962..43964,43968..43976,44010..44012,
FT                   44019..44024,44031..44033,44094..44099,44106..44111,
FT                   44280..44294,44334..44336,44691..44693,44697..44699)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29421"
FT                   /locus_tag="Closa_0035"
FT   misc_feature    order(43983..43985,44400..44402,44511..44513)
FT                   /note="active site"
FT                   /db_xref="CDD:29421"
FT                   /locus_tag="Closa_0035"
FT   gene            44746..45225
FT                   /db_xref="GeneID:9505284"
FT                   /locus_tag="Closa_0036"
FT   CDS_pept        44746..45225
FT                   /locus_tag="Closa_0036"
FT                   /gene_family="HOG000008876" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00531"
FT                   /codon_start="1"
FT                   /product="acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pvi:Cvib_1602 biotin carboxyl carrier protein;
FT                   TIGRFAM: acetyl-CoA carboxylase, biotin carboxyl carrier
FT                   protein; PFAM: biotin/lipoyl attachment domain-containing
FT                   protein"
FT                   /db_xref="GI:302384480"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="GeneID:9505284"
FT                   /translation="MEINDIIRLMQAVKENDLTGFKMEEGDLKLSIKKEKEREIVTISA
FT                   NPVVPAEAPAGAYARQVSDAAAPSGNGEEMAGNDISSERIVSSPLVGTFYNAPTPDSEP
FT                   FVKAGDQVNKGQVLGIIEAMKLMNEIECEFDGVVEAILAGNEDVVEYGQPLFRIR"
FT                   /protein_id="YP_003820302.1"
FT   misc_feature    44761..45222
FT                   /note="Biotin carboxyl carrier protein [Lipid metabolism];
FT                   Region: AccB; COG0511"
FT                   /db_xref="CDD:30857"
FT                   /locus_tag="Closa_0036"
FT   misc_feature    45001..45219
FT                   /note="The biotinyl-domain or biotin carboxyl carrier
FT                   protein (BCCP) domain is present in all biotin-dependent
FT                   enzymes, such as acetyl-CoA carboxylase, pyruvate
FT                   carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA
FT                   carboxylase, geranyl-CoA carboxylase...; Region:
FT                   biotinyl_domain; cd06850"
FT                   /db_xref="CDD:133459"
FT                   /locus_tag="Closa_0036"
FT   misc_feature    order(45088..45090,45115..45123,45142..45144)
FT                   /note="carboxyltransferase (CT) interaction site; other
FT                   site"
FT                   /db_xref="CDD:133459"
FT                   /locus_tag="Closa_0036"
FT   misc_feature    45118..45120
FT                   /note="biotinylation site; other site"
FT                   /db_xref="CDD:133459"
FT                   /locus_tag="Closa_0036"
FT   gene            45291..45713
FT                   /db_xref="GeneID:9505285"
FT                   /locus_tag="Closa_0037"
FT   CDS_pept        45291..45713
FT                   /locus_tag="Closa_0037"
FT                   /gene_family="HOG000277829" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01750"
FT                   /codon_start="1"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabZ"
FT                   /transl_table="11"
FT                   /note="KEGG: cno:NT01CX_0928 (3R)-hydroxymyristoyl-ACP
FT                   dehydratase; TIGRFAM:
FT                   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabZ;
FT                   PFAM: Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
FT                   FabA/FabZ"
FT                   /db_xref="GI:302384481"
FT                   /db_xref="InterPro:IPR010084"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="GeneID:9505285"
FT                   /translation="MLGIKEIQEIIPHRHPFLLVDCIEEFEPGVRAVGYKCVTYNEPFF
FT                   QGHFPAEPVMPGVLIIEALAQVGTVAILSLEENKGKIGYFGGIDKAKFKHKVIPGEMLK
FT                   LECEIIKRKGPVGVGRAIATVDGKLAASAELTFMIG"
FT                   /protein_id="YP_003820303.1"
FT   misc_feature    45321..45710
FT                   /note="FabZ is a 17kD beta-hydroxyacyl-acyl carrier protein
FT                   (ACP) dehydratase that primarily catalyzes the dehydration
FT                   of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, the third step
FT                   in the elongation phase of the bacterial/ plastid, type II,
FT                   fatty-acid...; Region: FabZ; cd01288"
FT                   /db_xref="CDD:48033"
FT                   /locus_tag="Closa_0037"
FT   gene            45723..47075
FT                   /db_xref="GeneID:9505286"
FT                   /locus_tag="Closa_0038"
FT   CDS_pept        45723..47075
FT                   /locus_tag="Closa_0038"
FT                   /gene_family="HOG000008988" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00514"
FT                   /codon_start="1"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase"
FT                   /transl_table="11"
FT                   /note="KEGG: cpy:Cphy_0521 acetyl-CoA carboxylase, biotin
FT                   carboxylase; TIGRFAM: acetyl-CoA carboxylase, biotin
FT                   carboxylase; PFAM: Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein"
FT                   /db_xref="GI:302384482"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="GeneID:9505286"
FT                   /translation="MFDKILIANRGEIAVRIIRACREMGIKTVAVYSEADRDSLHTLLA
FT                   DEAVCIGPAPSTQSYLNMERILTATVAMKADAVHPGFGFLSENERFAELCEKCNITFIG
FT                   PSSAVIGKMGNKSEARKTMIEAGVPVVPGGKEAVRQVNEAKSMAERIGFPVMIKASSGG
FT                   GGKGMRISRCLEDFEANFKNAQMESVKGFSDDTMYIEKYIEKPRHIEFQIMADKFGNVV
FT                   HLGERDCSIQRRHQKVLEESPSAAISQDLRIRMGETAVRAAKAVGYENAGTIEFLLDNQ
FT                   KNFYFMEMNTRIQVEHPVTEMVTGLDLIKEQIRIAAGEPLSIRQEDVVITGHAIECRIN
FT                   AENPSKNFMPCPGLIKNVHVPGGNGVRIDTHIYSDYKVPANYDSMLMKMIVHGKNREEA
FT                   ILKMRSALGELIIEGIETNVDFQFDILSHDAYRDGDVDTDFIPKYFPDYVR"
FT                   /protein_id="YP_003820304.1"
FT   misc_feature    45723..47057
FT                   /note="acetyl-CoA carboxylase biotin carboxylase subunit;
FT                   Validated; Region: PRK08591"
FT                   /db_xref="CDD:169508"
FT                   /locus_tag="Closa_0038"
FT   misc_feature    45726..46052
FT                   /note="Carbamoyl-phosphate synthase L chain, N-terminal
FT                   domain; Region: CPSase_L_chain; pfam00289"
FT                   /db_xref="CDD:144029"
FT                   /locus_tag="Closa_0038"
FT   misc_feature    46068..46694
FT                   /note="Carbamoyl-phosphate synthase L chain, ATP binding
FT                   domain; Region: CPSase_L_D2; cl03087"
FT                   /db_xref="CDD:164032"
FT                   /locus_tag="Closa_0038"
FT   misc_feature    46728..47045
FT                   /note="Biotin carboxylase C-terminal domain; Region:
FT                   Biotin_carb_C; cl08365"
FT                   /db_xref="CDD:158273"
FT                   /locus_tag="Closa_0038"
FT   gene            47096..48820
FT                   /db_xref="GeneID:9505287"
FT                   /locus_tag="Closa_0039"
FT   CDS_pept        47096..48820
FT                   /locus_tag="Closa_0039"
FT                   /gene_family="HOG000244564" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00515"
FT                   /codon_start="1"
FT                   /product="acetyl-CoA carboxylase, carboxyl transferase,
FT                   beta subunit"
FT                   /transl_table="11"
FT                   /note="KEGG: ere:EUBREC_3141 acetyl-coA carboxylase
FT                   carboxyl transferase subunit beta/alpha; TIGRFAM:
FT                   acetyl-CoA carboxylase, carboxyl transferase, beta subunit;
FT                   acetyl-CoA carboxylase, carboxyl transferase, alpha
FT                   subunit; PFAM: Acetyl-CoA carboxylase, alpha subunit,
FT                   conserved region"
FT                   /db_xref="GI:302384483"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR020582"
FT                   /db_xref="GeneID:9505287"
FT                   /translation="MLKSMFKKTYTLIDSKYKAPDKTEEPNIPAGLWKKCNKCSQPVYA
FT                   EDVRRNHFICPKCKGYFRLHAHQRIEMIADKGTFEEWDQEMEFKNPLDFPGYDKKVAQA
FT                   REKTGLSEAIVTGICEIDGQKAVIGVCDARFIMSSMGQVMGEKIARAVERATKEKLPVI
FT                   LFACSGGARMQEGIVSLMQMAKTSAALKRHHKAGQLYISVLTDPTTGGVTASFAMLGDI
FT                   ILAEPFALIGFAGPRVIEQTIGQKLPEGFQRSEFLLEHGFIDKIVPREEMKETLASILS
FT                   LHNPQNRKELSVDNRAKAEFIGGKKKPFRLRKNKRSPWDTVLLSRSSDRPVATDYIYAV
FT                   FDDFMEFAGDRYYKDDGAIVGGIASFHGMPVTVIGQEKGKNTKDNIKRNFGMPSPEGYR
FT                   KALRLMKQAEAFGRPIVCFVDTPGAFCGLEAEERGQGEAIARNLFEMADLTVPVLSIVI
FT                   GEGGSGGALAMAVGNEVWMMENSIYSILSPEGFASILYKDSKKANDAARVMKITARDLM
FT                   ELGLIERVIPEEEPACADNLDLIAEDMDKAMKEFFACYLTMTKEELADQRYERFRRM"
FT                   /protein_id="YP_003820305.1"
FT   misc_feature    47105..47965
FT                   /note="acetyl-CoA carboxylase subunit beta; Validated;
FT                   Region: PRK05654"
FT                   /db_xref="CDD:168155"
FT                   /locus_tag="Closa_0039"
FT   misc_feature    47141..47953
FT                   /note="Acetyl co-enzyme A carboxylase carboxyltransferase
FT                   alpha subunit; Region: ACCA; cl00513"
FT                   /db_xref="CDD:174255"
FT                   /locus_tag="Closa_0039"
FT   misc_feature    48044..48817
FT                   /note="Acetyl co-enzyme A carboxylase carboxyltransferase
FT                   alpha subunit; Region: ACCA; cl00513"
FT                   /db_xref="CDD:174255"
FT                   /locus_tag="Closa_0039"
FT   gene            48820..49941
FT                   /db_xref="GeneID:9505288"
FT                   /locus_tag="Closa_0040"
FT   CDS_pept        48820..49941
FT                   /locus_tag="Closa_0040"
FT                   /gene_family="HOG000123286" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03060"
FT                   /codon_start="1"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /transl_table="11"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   cpy:Cphy_3113 2-nitropropane dioxygenase NPD"
FT                   /db_xref="GI:302384484"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="GeneID:9505288"
FT                   /translation="MGTLKPLVIGDLVAKHPVIQGGMGVGISLSSLAGAVAKTGGIGII
FT                   STAQIGFREPDFKKNPLEANLRAIGQEMKKAREIAPEGIIGFNIMVATKNYASYVKKAV
FT                   KAGADLIISGAGLPVSLPEYVAEAAEEAGIVLKTKIAPIVSTVKSAMVICKLWDRKYHR
FT                   APDLVVVEGPLAGGHLGFSREELKNLGVDTSEVDLTYKQADYDEEVKGIIRLVKEYGDK
FT                   YNKKIPVVTAGGIYTHEDVLHQLSLGVDGVQVATRFVTTVECDAPEEFKQAYILAEKED
FT                   IVITKSPVGMPGRAIKNPFLKGVGEVPFRLEHCYQCLERCDRETIPYCITKALVNSAEG
FT                   RTGEGLVFCGSKAYLATGLETVEEVMNDLVGEN"
FT                   /protein_id="YP_003820306.1"
FT   misc_feature    48826..49929
FT                   /note="Dioxygenases related to 2-nitropropane dioxygenase
FT                   [General function prediction only]; Region: COG2070"
FT                   /db_xref="CDD:32253"
FT                   /locus_tag="Closa_0040"
FT   misc_feature    48862..49707
FT                   /note="2-Nitropropane dioxygenase (NPD), one of the
FT                   nitroalkane oxidizing enzyme families, catalyzes oxidative
FT                   denitrification of nitroalkanes to their corresponding
FT                   carbonyl compounds and nitrites. NDP is a member of the
FT                   NAD(P)H-dependent flavin...; Region: NPD_like; cd04730"
FT                   /db_xref="CDD:73392"
FT                   /locus_tag="Closa_0040"
FT   misc_feature    order(48883..48888,49087..49089,49159..49161,49246..49248,
FT                   49330..49332,49342..49347,49513..49521,49576..49587)
FT                   /note="FMN binding site; other site"
FT                   /db_xref="CDD:73392"
FT                   /locus_tag="Closa_0040"
FT   misc_feature    49348..49353
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:73392"
FT                   /locus_tag="Closa_0040"
FT   misc_feature    49351..49353
FT                   /note="putative catalytic residue; other site"
FT                   /db_xref="CDD:73392"
FT                   /locus_tag="Closa_0040"
FT   gene            50134..51396
FT                   /db_xref="GeneID:9505289"
FT                   /locus_tag="Closa_0041"
FT   CDS_pept        50134..51396
FT                   /locus_tag="Closa_0041"
FT                   /gene_family="HOG000038200" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00801"
FT                   /codon_start="1"
FT                   /product="uracil-xanthine permease"
FT                   /transl_table="11"
FT                   /note="KEGG: apr:Apre_0262 uracil-xanthine permease;
FT                   TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease"
FT                   /db_xref="GI:302384485"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="GeneID:9505289"
FT                   /translation="MESKKIIQVEEKVPFKMLVPLSIQHMFAMFGASVLVPFIFGINPA
FT                   VVLFMNGFGTLFFIFITKGKAPAYLGSSFAFLAPAGIVISKWGYHYALGGFVAVGICGC
FT                   ILALIIYKFGSDWIDTVLPPAAMGPVVALIGLELAGTAASNAGLKDEMIDMKNVIVFLV
FT                   TLLTAVIGSVVFKKFLSVIPILIAIIVGYVAALLCGIVDFTEVSTAAWLSLPNFTAPKF
FT                   KLEAILIILPVLLVVTSEHIGHQIVTSKIVNRDLIKDPGLHRSLLGDYISTTLSGFVGS
FT                   VPTTTYGENIGVMAMTKVYSVYVIGGAAVLSVACSFIGKMTTLINTIPGPVIGGISFLL
FT                   YGMIGASGIRILVDAQVDYGKSRNMAMTSVIFVTGLSGVAVQFGSIQLSGMVLACVVGM
FT                   LMGLMFYGLDKLNLTNDRENG"
FT                   /protein_id="YP_003820307.1"
FT   misc_feature    50137..51381
FT                   /note="Permease family; Region: Xan_ur_permease; cl00967"
FT                   /db_xref="CDD:176823"
FT                   /locus_tag="Closa_0041"
FT   gene            51567..52184
FT                   /db_xref="GeneID:9505290"
FT                   /locus_tag="Closa_0042"
FT   CDS_pept        51567..52184
FT                   /locus_tag="Closa_0042"
FT                   /gene_family="HOG000060604" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /codon_start="1"
FT                   /product="nucleoside recognition domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   cpy:Cphy_3908 spore maturation protein"
FT                   /db_xref="GI:302384486"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="GeneID:9505290"
FT                   /translation="MLNYLWAFMMLVGVLWGAFHGNLNGVTDGALTSAKEAVMLCITML
FT                   GIMSFWSGIMEIGNRSGLIQRMSQKMSPVLRFLFPRIPKDHGAFEYISTNIIANILGLG
FT                   WAATPAGLKAMESLKELEESRRKGEVSGKYSLKPVPEGTANNEMCTFLIINISSLQLIP
FT                   VNMIAYRSQYGSPNPMAVVGPALIATLLSTIVGVAACKLMDR"
FT                   /protein_id="YP_003820308.1"
FT   misc_feature    51567..52181
FT                   /note="Uncharacterized membrane protein, required for spore
FT                   maturation in B.subtilis. [General function prediction
FT                   only]; Region: SpmA; COG2715"
FT                   /db_xref="CDD:32608"
FT                   /locus_tag="Closa_0042"
FT   gene            52405..52890
FT                   /db_xref="GeneID:9505291"
FT                   /locus_tag="Closa_0043"
FT   CDS_pept        52405..52890
FT                   /locus_tag="Closa_0043"
FT                   /gene_family="HOG000085050" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /codon_start="1"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   str:Sterm_0944 CMP/dCMP deaminase zinc-binding protein"
FT                   /db_xref="GI:302384487"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="GeneID:9505291"
FT                   /translation="MDYNIDMKNLKRCAEISRQSREAGNTPFGALLAGKDGSILLEQPN
FT                   IEITEGKCTGHAETQVAERASQLYSKDFLSDCTLYTTAEPCAMCAGAIYWAGIGRVVYG
FT                   MSEKDLLSHTGGDPQNPTFDLPCREVFARGQKKIEVVGPFPELVEEIAEVHKGYWNN"
FT                   /protein_id="YP_003820309.1"
FT   misc_feature    52432..52734
FT                   /note="Nucleoside deaminases include adenosine, guanine and
FT                   cytosine deaminases. These enzymes are Zn dependent and
FT                   catalyze the deamination of nucleosides. The zinc ion in
FT                   the active site plays a central role in the proposed
FT                   catalytic mechanism, activating a...; Region:
FT                   nucleoside_deaminase; cd01285"
FT                   /db_xref="CDD:29828"
FT                   /locus_tag="Closa_0043"
FT   misc_feature    order(52486..52488,52537..52539,52570..52578,52660..52662,
FT                   52669..52671)
FT                   /note="nucleoside/Zn binding site; other site"
FT                   /db_xref="CDD:29828"
FT                   /locus_tag="Closa_0043"
FT   misc_feature    order(52564..52566,52579..52581,52591..52593,52663..52668,
FT                   52675..52680,52687..52692)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29828"
FT                   /locus_tag="Closa_0043"
FT   misc_feature    order(52570..52578,52657..52662,52669..52671)
FT                   /note="catalytic motif; other site"
FT                   /db_xref="CDD:29828"
FT                   /locus_tag="Closa_0043"
FT   gene            52923..54215
FT                   /db_xref="GeneID:9505292"
FT                   /locus_tag="Closa_0044"
FT   CDS_pept        52923..54215
FT                   /locus_tag="Closa_0044"
FT                   /gene_family="HOG000097640" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02133"
FT                   /codon_start="1"
FT                   /product="permease for cytosine/purines uracil thiamine
FT                   allantoin"
FT                   /transl_table="11"
FT                   /note="PFAM: permease for cytosine/purines uracil thiamine
FT                   allantoin; KEGG: vpr:Vpar_1798 permease for
FT                   cytosine/purines uracil thiamine allantoin"
FT                   /db_xref="GI:302384488"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="GeneID:9505292"
FT                   /translation="MEQKNQSQQTDTEYSRSAVPLNQRKSYFSLTIIWTGFVFVITSMM
FT                   AGGGLAAGLDFKGIIAATLGGNIFLSIIAVLISIIACKTGLTFALLTRYSFGSGGSKAA
FT                   SIFVPVVNFGWYTIQAATYGHFVAQVFHFGRVGEGVCMAVSAIIMGIFAMFGIQAIAIL
FT                   GYIAIPAIVFLSIATAIRSLGVIGGAEALFSYVPSNNISLYSGITAVIGTWVLSTATCI
FT                   ADIMRYAKDTKTAVSATLTGLLGGNILMIVCGAIAAIAMHNSDLTVILLSFGLVIPSLI
FT                   LMTTNIFTTNAANLYSTSLNLSNAFKMERKKMLGILLALSAVATLTKPYEIGFLFRFLN
FT                   ILGTVVPPLSGIILSDYFLVHKGRYEEYDKASFRKWNPVPWITWGGSIAAVYIIPFGLP
FT                   SLNGIILGAAIYTALMAVTGRQAAGKLAEEA"
FT                   /protein_id="YP_003820310.1"
FT   misc_feature    52941..54209
FT                   /note="Purine-cytosine permease and related proteins
FT                   [Nucleotide transport and metabolism]; Region: CodB;
FT                   COG1457"
FT                   /db_xref="CDD:31646"
FT                   /locus_tag="Closa_0044"
FT   misc_feature    53010..54212
FT                   /note="Sodium:solute symporter family; Region: SSF;
FT                   cl00456"
FT                   /db_xref="CDD:174215"
FT                   /locus_tag="Closa_0044"
FT   gene            54230..54394
FT                   /db_xref="GeneID:9505293"
FT                   /locus_tag="Closa_0045"
FT   CDS_pept        54230..54394
FT                   /locus_tag="Closa_0045"
FT                   /gene_family="HOG000097639" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Vpar_1799"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: vpr:Vpar_1799 hypothetical protein"
FT                   /db_xref="GI:302384489"
FT                   /db_xref="GeneID:9505293"
FT                   /translation="MNRYKLSALMGTVIMGIGSFMACLAEKGPYIITGNVLLMVSIFIM
FT                   IYGYAKWQP"
FT                   /protein_id="YP_003820311.1"
FT   gene            complement(54553..55347)
FT                   /db_xref="GeneID:9505294"
FT                   /locus_tag="Closa_0046"
FT   CDS_pept        complement(54553..55347)
FT                   /locus_tag="Closa_0046"
FT                   /gene_family="HOG000109113" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, GntR family"
FT                   /transl_table="11"
FT                   /note="KEGG: str:Sterm_0942 transcriptional regulator, GntR
FT                   family; PFAM: regulatory protein GntR HTH; UbiC
FT                   transcription regulator-associated domain protein; SMART:
FT                   regulatory protein GntR HTH"
FT                   /db_xref="GI:302384490"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="GeneID:9505294"
FT                   /translation="MAEESKEPKPRRIQKTDLKTQVETELLHFIKQMDLSVNNKLPREE
FT                   ELSKMLGVSRITLRSVLDDLSAKGMIFRRHGKGTFINNSFFEMKASFNPVMHFVDMITS
FT                   SGYTPRVEMIHHDIIKADRDVAVHLEMAEGGLVLICDKIFYADHQICAVTRDYIPFSYL
FT                   NGVDMAELDNFVESVFYFMYKATGKKLEWDKVELNAVYSKDVELLNGLLERFHLPPKAF
FT                   LLLKAMNYDEDGTAAVYTWEYVDTSILKYSQIRKRLLHYEDI"
FT                   /protein_id="YP_003820312.1"
FT   misc_feature    complement(54619..55314)
FT                   /note="Transcriptional regulators [Transcription]; Region:
FT                   PhnF; COG2188"
FT                   /db_xref="CDD:32371"
FT                   /locus_tag="Closa_0046"
FT   misc_feature    complement(55102..55296)
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cd07377"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Closa_0046"
FT   misc_feature    complement(order(55111..55122,55126..55131,55159..55161,
FT                   55168..55173,55177..55191,55213..55218,55222..55224,
FT                   55291..55293))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Closa_0046"
FT   misc_feature    complement(54619..55032)
FT                   /note="UTRA domain; Region: UTRA; cl06649"
FT                   /db_xref="CDD:176600"
FT                   /locus_tag="Closa_0046"
FT   gene            55750..56457
FT                   /db_xref="GeneID:9505295"
FT                   /locus_tag="Closa_0047"
FT   CDS_pept        55750..56457
FT                   /locus_tag="Closa_0047"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /codon_start="1"
FT                   /product="GntR domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cbe:Cbei_4096 GntR domain-containing protein;
FT                   PFAM: GntR domain protein; regulatory protein GntR HTH;
FT                   SMART: regulatory protein GntR HTH"
FT                   /db_xref="GI:302384491"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="GeneID:9505295"
FT                   /translation="MRRNTDKMQNVDVLPMATAQKVKTMIIQREMKPGDRLPTEKELTE
FT                   VFGVSRSTLREAMKYLRAENVVVIRQGSGTFVSAGTGIGEDPLGLHFTDQKYLIQNLFE
FT                   TRMLIEPQIAGLAVQRATPQDIKNLERLVAEMDQIQINSTATAEMDVQFHTAVAECTHN
FT                   EVLIRVVPIINESIRRSHVETHDDLESFKRAKRSHKGIYKAIADGNYMEAKFLAERHVW
FT                   ETLNDVREREEQK"
FT                   /protein_id="YP_003820313.1"
FT   misc_feature    55768..56451
FT                   /note="Transcriptional regulators [Transcription]; Region:
FT                   FadR; COG2186"
FT                   /db_xref="CDD:32369"
FT                   /locus_tag="Closa_0047"
FT   misc_feature    55804..55983
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cd07377"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Closa_0047"
FT   misc_feature    order(55861..55863,55867..55872,55894..55908,55912..55917,
FT                   55924..55926,55954..55959,55963..55974)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:153418"
FT                   /locus_tag="Closa_0047"
FT   misc_feature    56053..56412
FT                   /note="FCD domain; Region: FCD; cl11656"
FT                   /db_xref="CDD:159608"
FT                   /locus_tag="Closa_0047"
FT   gene            56454..57812
FT                   /db_xref="GeneID:9505296"
FT                   /locus_tag="Closa_0048"
FT   CDS_pept        56454..57812
FT                   /locus_tag="Closa_0048"
FT                   /gene_family="HOG000251141" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: smd:Smed_0186 extracellular solute-binding protein"
FT                   /db_xref="GI:302384492"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="GeneID:9505296"
FT                   /translation="MKKRLIGKKTMAVVLAALMAGGAMAGCSSGSKETTAAGTETTEAQ
FT                   ATTAGTQTTSAKEGQTPSGDIKPCTIKFRYWADNTDYSQLMQDIIKKFNEENGKGITVV
FT                   GEESPWDGGAYSENLFNAKMGGGDIDCATWKLTSTPLFVNNDLLADLTPMIDGWDKKAD
FT                   IDDNIYEIMKKAGDMERIYVMPWNIQVLYVYYRPSIFKKAGIEVPKTYEEFLQAIEKCT
FT                   MDTDGDGKTDVYGFGMRGAKGGQEPWGSFIYGRGGSLEDLTTPEAVQGMQDFIDIYKKG
FT                   YVPPTATSDGFSEIIANFQSGLTAMTIHHTGSSKDMEKLLGDDVSAFAFPAGKDQWTSM
FT                   GDTETVIFESCENKEAAFEWVSYLAAGEGQKMWCEGTGNVPVSKSVQETDFFQNNRFMK
FT                   ASIDGQKYAGIIPILDTTTEWISTLWPNTVSQALTGSITADECMKTLQAGLYQ"
FT                   /protein_id="YP_003820314.1"
FT   misc_feature    56661..57809
FT                   /note="ABC-type sugar transport system, periplasmic
FT                   component [Carbohydrate transport and metabolism]; Region:
FT                   UgpB; COG1653"
FT                   /db_xref="CDD:31839"
FT                   /locus_tag="Closa_0048"
FT   misc_feature    56679..57566
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Closa_0048"
FT   gene            57876..58748
FT                   /db_xref="GeneID:9505297"
FT                   /locus_tag="Closa_0049"
FT   CDS_pept        57876..58748
FT                   /locus_tag="Closa_0049"
FT                   /gene_family="HOG000220407" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rsk:RSKD131_3903
FT                   binding-protein-dependent transport systems inner membrane
FT                   component precursor"
FT                   /db_xref="GI:302384493"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9505297"
FT                   /translation="MVKKRTIWPYVLVAPAVIIILCVVFIPVMNAVLMSFQNYDLRRPK
FT                   EIAFHGLANYASACKDPLFWGALVRTILWVVCGVGFQFLFGFILALLLNQEFFGRGMVR
FT                   AVSMIPWVTPGVLIGLMWRWIYDGNFGVLNDLLLKFHVISDKIPFLSQVATAFPSVIVT
FT                   IIWQGIPFFALMLLAALQGVSSEIYEASSIDGATAWQKLFYITIPSIKNTIFVTALLRV
FT                   IWVANSVDVIFNMTEGGPAYSTQTLSVYIFNKGNALNLGYASAMAILLAVLLLFAAIPY
FT                   LRMNFKGEE"
FT                   /protein_id="YP_003820315.1"
FT   misc_feature    58077..58661
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Closa_0049"
FT   misc_feature    order(58125..58130,58137..58142,58155..58157,58182..58193,
FT                   58197..58226,58233..58238,58242..58244,58368..58373,
FT                   58380..58382,58386..58388,58395..58400,58404..58406,
FT                   58416..58421,58428..58430,58479..58481,58521..58526,
FT                   58533..58535,58554..58565,58572..58577,58617..58622,
FT                   58650..58655)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Closa_0049"
FT   misc_feature    order(58200..58244,58554..58571)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Closa_0049"
FT   misc_feature    order(58242..58244,58353..58355,58572..58574,58611..58613,
FT                   58620..58622,58650..58652)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Closa_0049"
FT   misc_feature    order(58431..58469,58485..58490,58500..58502)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Closa_0049"
FT   gene            58752..59588
FT                   /db_xref="GeneID:9505298"
FT                   /locus_tag="Closa_0050"
FT   CDS_pept        58752..59588
FT                   /locus_tag="Closa_0050"
FT                   /gene_family="HOG000220526" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rsp:RSP_3672 ABC sugar
FT                   transporter, inner membrane subunit"
FT                   /db_xref="GI:302384494"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9505298"
FT                   /translation="MKKLSDIKRILCVYLPLIVILLFILFPFYWTLVTSLKPQDELYGM
FT                   VVTYLPRSITFESYRKLFTTTVNFLAAIKNSFVVAAITTLVSLTASTLAAYAFSRYQFA
FT                   GRKLLMCTFLCNNMFPTVLLLIPLYSIMRKMGLLFTPASLVLSYTTFTIPFSVWLLLGF
FT                   LNDLPMSLEEAALVDGCNRGIAFVRIILPILGPCLVATGVYIFMTSWNEYTFAVMFTNT
FT                   ETRTIPVALKSLIGQLGVQWDLLTAGGIITIIPVCIMFFFAQKRLVEGLTAGAVKG"
FT                   /protein_id="YP_003820316.1"
FT   misc_feature    59049..59519
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Closa_0050"
FT   misc_feature    order(59076..59087,59091..59120,59127..59132,59136..59138,
FT                   59199..59204,59208..59210,59214..59216,59223..59228,
FT                   59232..59234,59244..59249,59256..59258,59307..59309,
FT                   59349..59354,59361..59363,59382..59393,59400..59405,
FT                   59439..59444,59472..59477,59484..59489,59493..59498,
FT                   59505..59510,59517..59519)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Closa_0050"
FT   misc_feature    order(59094..59138,59382..59399)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Closa_0050"
FT   misc_feature    order(59136..59138,59400..59402,59436..59438,59442..59444,
FT                   59472..59474)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Closa_0050"
FT   misc_feature    order(59259..59297,59313..59318,59328..59330)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Closa_0050"
FT   gene            59615..60415
FT                   /db_xref="GeneID:9505299"
FT                   /locus_tag="Closa_0051"
FT   CDS_pept        59615..60415
FT                   /locus_tag="Closa_0051"
FT                   /gene_family="HOG000243880" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00456"
FT                   /codon_start="1"
FT                   /product="Transketolase domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Transketolase domain protein; KEGG:
FT                   tpd:Teth39_0491 transketolase domain-containing protein"
FT                   /db_xref="GI:302384495"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="GeneID:9505299"
FT                   /translation="MQYNKKAKELRAEILKMLFACQSGHPGGSLSCVEMLMALYYEVMN
FT                   VDPKNPDKPDRDRLVLSKGHACPALYAVLADRGYFPKEDLGGLRQIDSHLQGHPDCTKT
FT                   PGVDMNTGSLGQGASLAMGLALAAKHGGASYHVYAVLGDGECQEGLVWEAAMAAAHYKL
FT                   DNLTFLLDYNKLQIDGCNAEVMSLGDIVKKFEAFGFECFEVDGHDISAITAALKAPVRD
FT                   KPKFICCNTIKGKGVSFMEDQSGWHGKPMNEEEFTQAMKEQEAE"
FT                   /protein_id="YP_003820317.1"
FT   misc_feature    59636..60394
FT                   /note="Thiamine pyrophosphate (TPP) family, Transketolase
FT                   (TK) subfamily, TPP-binding module; TK catalyzes the
FT                   transfer of a two-carbon unit from ketose phosphates to
FT                   aldose phosphates. In heterotrophic organisms, TK provides
FT                   a link between glycolysis and the...; Region: TPP_TK;
FT                   cd02012"
FT                   /db_xref="CDD:48175"
FT                   /locus_tag="Closa_0051"
FT   misc_feature    order(59807..59809,59948..59950,59954..59956,60041..60046,
FT                   60056..60058,60131..60133,60137..60139,60143..60145,
FT                   60353..60355)
FT                   /note="TPP-binding site; other site"
FT                   /db_xref="CDD:48175"
FT                   /locus_tag="Closa_0051"
FT   misc_feature    order(59879..59881,59903..59908,59912..59914,59951..59956,
FT                   59960..59962,60050..60061,60068..60073,60080..60082,
FT                   60092..60094,60140..60145,60191..60193)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48175"
FT                   /locus_tag="Closa_0051"
FT   gene            60415..61341
FT                   /db_xref="GeneID:9505300"
FT                   /locus_tag="Closa_0052"
FT   CDS_pept        60415..61341
FT                   /locus_tag="Closa_0052"
FT                   /gene_family="HOG000243869" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /codon_start="1"
FT                   /product="Transketolase central region"
FT                   /transl_table="11"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: bhy:BHWA1_00092 transketolase,
FT                   pyridine binding subunit"
FT                   /db_xref="GI:302384496"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="GeneID:9505300"
FT                   /translation="MGKSLRVAYGESLVKLGAENKKVVVLDADLAHATQTCMFQEKYPD
FT                   RFYNMGIAEANMMCAAAGFANTGYIPFASTFALFGAGRAYEQIRNSICYTNANVKFGFS
FT                   HSGLSVGEDGGSHQSFEDIALMREMPHMTIFVPCDPAETEKAVMAAAEINGPVYIRVAR
FT                   PVCMDLTTPETPFIPGKANVMKEGDDVCIISCGLMIPEALKASEELEKEGIHAAVVNMH
FT                   TIKPIDKDIILKMNETCKGIVTIEEHSVIGGLGSAVAEVLAGHGGAKFTSLGIQDKFGK
FT                   SGKPEELFEAYGLTAGHVAKACRNLLD"
FT                   /protein_id="YP_003820318.1"
FT   misc_feature    60415..61335
FT                   /note="Transketolase, C-terminal subunit [Carbohydrate
FT                   transport and metabolism]; Region: COG3958"
FT                   /db_xref="CDD:33739"
FT                   /locus_tag="Closa_0052"
FT   misc_feature    60436..60903
FT                   /note="Pyrimidine (PYR) binding domain of
FT                   1-deoxy-D-xylulose-5-phosphate synthase (DXS),
FT                   transketolase (TK), and related proteins; Region:
FT                   TPP_PYR_DXS_TK_like; cd07033"
FT                   /db_xref="CDD:132916"
FT                   /locus_tag="Closa_0052"
FT   misc_feature    order(60475..60477,60481..60483,60499..60501,60550..60552,
FT                   60559..60561,60565..60582,60589..60594,60598..60606,
FT                   60661..60663,60670..60675,60751..60753,60760..60762,
FT                   60808..60813,60874..60876)
FT                   /note="PYR/PP interface; other site"
FT                   /db_xref="CDD:132916"
FT                   /locus_tag="Closa_0052"
FT   misc_feature    order(60499..60501,60559..60561,60568..60576,60658..60663,
FT                   60667..60669,60751..60753,60757..60759,60784..60789,
FT                   60793..60798,60802..60804)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:132916"
FT                   /locus_tag="Closa_0052"
FT   misc_feature    order(60568..60570,60574..60576,60652..60654,60661..60663)
FT                   /note="TPP binding site; other site"
FT                   /db_xref="CDD:132916"
FT                   /locus_tag="Closa_0052"
FT   misc_feature    60949..61311
FT                   /note="Transketolase, C-terminal domain; Region:
FT                   Transketolase_C; pfam02780"
FT                   /db_xref="CDD:145764"
FT                   /locus_tag="Closa_0052"
FT   gene            61357..61752
FT                   /db_xref="GeneID:9505301"
FT                   /locus_tag="Closa_0053"
FT   CDS_pept        61357..61752
FT                   /locus_tag="Closa_0053"
FT                   /gene_family="HOG000151481" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:CAC3497"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cac:CAC3497 hypothetical protein"
FT                   /db_xref="GI:302384497"
FT                   /db_xref="GeneID:9505301"
FT                   /translation="MNIAVYEFAGEGMQRVFENEKWTVGIKNWKPANDVTGIDCLERHN
FT                   KTDELFVLVEGACTLVYANEEKNGLVFGAVHMQPNKVYNIPAALWHNTITRKGTKMILI
FT                   EDSNTSMNNSDILELKEEQIAELRSLA"
FT                   /protein_id="YP_003820319.1"
FT   misc_feature    <61477..61671
FT                   /note="Cupin domain; Region: Cupin_2; cl09118"
FT                   /db_xref="CDD:175009"
FT                   /locus_tag="Closa_0053"
FT   gene            complement(61831..62079)
FT                   /db_xref="GeneID:9505302"
FT                   /locus_tag="Closa_0054"
FT   CDS_pept        complement(61831..62079)
FT                   /locus_tag="Closa_0054"
FT                   /gene_family="HOG000056833" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:EUBELI_00054"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: eel:EUBELI_00054 hypothetical protein"
FT                   /db_xref="GI:302384498"
FT                   /db_xref="GeneID:9505302"
FT                   /translation="MKYKTHGVCSREIDFEVENNKLVHVQFVGGCSGNTQGVSRLVEGM
FT                   DVDEAIRRLEGIQCGYRPTSCPDQLAEALKQYKDGLL"
FT                   /protein_id="YP_003820320.1"
FT   misc_feature    complement(61849..>61995)
FT                   /note="ribonucleotide-diphosphate reductase subunit alpha;
FT                   Validated; Region: PRK08665"
FT                   /db_xref="CDD:169547"
FT                   /locus_tag="Closa_0054"
FT   gene            62231..62929
FT                   /db_xref="GeneID:9505303"
FT                   /locus_tag="Closa_0055"
FT   CDS_pept        62231..62929
FT                   /locus_tag="Closa_0055"
FT                   /gene_family="HOG000259346" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01704"
FT                   /codon_start="1"
FT                   /EC_number="3.2.2.9"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: MTA/SAH nucleosidase; KEGG: cpy:Cphy_3729
FT                   adenosylhomocysteine nucleosidase; PFAM: purine or other
FT                   phosphorylase family 1"
FT                   /db_xref="GI:302384499"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="GeneID:9505303"
FT                   /translation="MLGIIGAMDVEVAEVKKAMEDVTVETIAAMDFYRGILKGKEAVVV
FT                   RSGIGKVNAAVCTQILADHYHVTAVINTGIAGSLKKEINIGDVVLSTDVVHHDMDATGF
FT                   GYPAGQIPQMKEFAFRADEGLRNLAEECCRRVNPEVGVFTGRVVSGDQFISDRVKKQWI
FT                   SETFGGYCTEMEGAAIAQAAYLNHIPFLIIRAISDKADDSANMDYSEFEEKAVRHSVNL
FT                   ILAMAEQDSY"
FT                   /product="MTA/SAH nucleosidase"
FT                   /protein_id="YP_003820321.1"
FT   misc_feature    62231..62908
FT                   /note="Phosphorylase superfamily; Region: PNP_UDP_1;
FT                   cl00303"
FT                   /db_xref="CDD:176815"
FT                   /locus_tag="Closa_0055"
FT   gene            63057..63998
FT                   /db_xref="GeneID:9505304"
FT                   /locus_tag="Closa_0056"
FT   CDS_pept        63057..63998
FT                   /locus_tag="Closa_0056"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cpy:Cphy_0418 hypothetical protein"
FT                   /db_xref="GI:302384500"
FT                   /db_xref="GeneID:9505304"
FT                   /translation="MLEFLQTGKALYVLAALCGIGIITRWLTRNLYKRLIKESDNLTLT
FT                   KNKNLRAFKQKTETTYQMNQGIPKVKPYLERQMYDFKHMGITLHGWNMFSNQMTLWCFL
FT                   AGGGLAFASYWYRTDSYYIVLYGSAGIMAGLFTILVDHGAGIAEKRQQLFSSLDNYLEN
FT                   TLIYRLDMDREESQAISGPHMETRENIRSIYPQSTMAGAEGEPELDKKAERRSARQRNV
FT                   SLEKSIRNRPQKQSMEAFSEASEAGAERKEIQGQPDMKNSRRDVDYLKRSLEQIAASRE
FT                   RERGGRQGEDWLKDLSPDELKLIGEILQEYLT"
FT                   /protein_id="YP_003820322.1"
FT   gene            64204..65550
FT                   /db_xref="GeneID:9505305"
FT                   /locus_tag="Closa_0057"
FT   CDS_pept        64204..65550
FT                   /locus_tag="Closa_0057"
FT                   /gene_family="HOG000100403" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:5.3.1.9"
FT                   /codon_start="1"
FT                   /EC_number="5.3.1.9"
FT                   /transl_table="11"
FT                   /note="KEGG: cpy:Cphy_0419 glucose-6-phosphate isomerase;
FT                   PFAM: phosphoglucose isomerase (PGI)"
FT                   /db_xref="GI:302384501"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="GeneID:9505305"
FT                   /translation="MGNVIFDYSRASGFVSAEEMENMKATVMCARNVLMNKSGAGSDFL
FT                   GWIDLPVDYDKEEFQRIKMAAEKIQNDSEVLLVIGIGGSYLGARAAIEFLSHSFYNVLP
FT                   KGKRKTPEIYFVGNSISSKYIQDLKDVLDGKDFSVNIISKSGTTTEPAIAFRVFKDMLI
FT                   EKYGREEANKRIYATTDKARGALKNLADEEGYESFVVPDDVGGRFSVLTAVGLLPIAVS
FT                   GADIDKLMEGAEAARKEALEADFETNGSLQYAAVRNILLRKGKTVEIVANYEPSLHYVS
FT                   EWWKQLFGESEGKDQRGIFPAAVDLTTDLHSMGQFIQDGARIMFETVLNVEASPAEILL
FT                   KEEEVDTDGMNYLAGKSVDFVNKSAMNGTILAHTDGDVPNLMVGIPKQDEYSLGQLFYF
FT                   FEYACGISGYILGVNPFNQPGVESYKKNMFALLGKPGYEKEREELLKRL"
FT                   /product="Glucose-6-phosphate isomerase"
FT                   /protein_id="YP_003820323.1"
FT   misc_feature    64204..65514
FT                   /note="glucose-6-phosphate isomerase; Provisional; Region:
FT                   pgi; PRK14097"
FT                   /db_xref="CDD:172587"
FT                   /locus_tag="Closa_0057"
FT   misc_feature    64369..64866
FT                   /note="Phosphoglucose isomerase (PGI) contains two SIS
FT                   (Sugar ISomerase) domains. This classification is based on
FT                   the alignment of the first SIS domain. PGI is a
FT                   multifunctional enzyme which as an intracellular dimer
FT                   catalyzes the reversible isomerization of...; Region:
FT                   SIS_PGI_1; cd05015"
FT                   /db_xref="CDD:88410"
FT                   /locus_tag="Closa_0057"
FT   misc_feature    order(64444..64446,64450..64455,64630..64638,64645..64647,
FT                   64819..64821)
FT                   /note="active site"
FT                   /db_xref="CDD:88410"
FT                   /locus_tag="Closa_0057"
FT   misc_feature    order(64552..64557,64561..64566,64651..64653,64663..64665,
FT                   64672..64674)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:88410"
FT                   /locus_tag="Closa_0057"
FT   misc_feature    65002..65496
FT                   /note="Phosphoglucose isomerase (PGI) contains two SIS
FT                   (Sugar ISomerase) domains. This classification is based on
FT                   the alignment of the second SIS domain. PGI is a
FT                   multifunctional enzyme which as an intracellular dimer
FT                   catalyzes the reversible isomerization of...; Region:
FT                   SIS_PGI_2; cd05016"
FT                   /db_xref="CDD:88411"
FT                   /locus_tag="Closa_0057"
FT   misc_feature    order(65023..65025,65059..65061,65071..65073,65080..65085,
FT                   65113..65115,65119..65127,65134..65139,65146..65151,
FT                   65158..65160,65275..65277,65281..65283,65305..65307,
FT                   65314..65316)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:88411"
FT                   /locus_tag="Closa_0057"
FT   misc_feature    order(65059..65061,65071..65073)
FT                   /note="active site"
FT                   /db_xref="CDD:88411"
FT                   /locus_tag="Closa_0057"
FT   gene            65747..66517
FT                   /db_xref="GeneID:9505306"
FT                   /locus_tag="Closa_0058"
FT   CDS_pept        65747..66517
FT                   /locus_tag="Closa_0058"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bha:BH3611 hypothetical protein"
FT                   /db_xref="GI:302384502"
FT                   /db_xref="GeneID:9505306"
FT                   /translation="MKKCLMLFLALATALSLAACKGEKDPKVIYDEATKKTSELASMDV
FT                   VSAVSMQMTQGEDTTDIKMDLDMKMADINTENMRYLATGTTSLMGQNLDILMYYENGYY
FT                   YMDSMGQKIKYAMDLDAMMKQIKQSTEGASVDSSYLKDITAKKDGDNQVLTFTVDAEKM
FT                   DAYVQELMGQLGTNMEGVTYTIKEASGEATVNKEGYFTNSKIKMSLDMNNQDQTVTMVM
FT                   DTDSTYNNPGQTVEVTAPDLEGYTEIDASALKNQ"
FT                   /protein_id="YP_003820324.1"
FT   gene            66998..68236
FT                   /db_xref="GeneID:9505307"
FT                   /locus_tag="Closa_0059"
FT   CDS_pept        66998..68236
FT                   /locus_tag="Closa_0059"
FT                   /gene_family="HOG000065443" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: pjd:Pjdr2_1679 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="GI:302384503"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="GeneID:9505307"
FT                   /translation="MKRKLAALCMLSLTAVAVLSGCGGGKASQDTAKDGKTKIRFASWD
FT                   VAEDVDRQQELVDKFNAAHEDIEVSLEAYGKDFDTKISAGMGSGDTPDVMYMWNYPAYY
FT                   QGLEPLDGFIEKEGEAYKANFYDTLWNYNSMEGQVYGIPIGFTTHTLFYNKDLFQEAGI
FT                   PEPTNDWTWDDLRQAAKTISEKTSAKGFAFPMKPDPYDFEMYLWSNGAAYCDKEGKLEG
FT                   NINSKASEEVFQMFQDMEKEGYAVATEKSGTDEFRSKAVAMYVYGAWSINSLKEDGLNY
FT                   GVVAIPAFANAGKDSVSILSSSGISISKDSKNKEAAWEFVKFWTNEESNKARIGLELPV
FT                   LSSVVESEKIMDQPEYAPFYLMLEQSTGYTSASFIIKEWSELSENLSLSFEEVFNPSSL
FT                   QSVPDVLNSAAQQ"
FT                   /protein_id="YP_003820325.1"
FT   misc_feature    67004..67993
FT                   /note="The substrate binding domain of LysR-type
FT                   transcriptional regulators (LTTRs), a member of the type 2
FT                   periplasmic binding fold protein superfamily; Region:
FT                   PBP2_LTTR_substrate; cl11398"
FT                   /db_xref="CDD:176835"
FT                   /locus_tag="Closa_0059"
FT   gene            68340..69257
FT                   /db_xref="GeneID:9505308"
FT                   /locus_tag="Closa_0060"
FT   CDS_pept        68340..69257
FT                   /locus_tag="Closa_0060"
FT                   /gene_family="HOG000220406" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: str:Sterm_0718
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:302384504"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9505308"
FT                   /translation="MKQKKFIRNATPYFFITPWIIGFLVFTIGPLILSLGMSFFDWPLT
FT                   SDPVFKGVGNYAEMFTRDNQFWKSLTISLKYAAIFVPLNMAIALFLAMLITQPVNGVKI
FT                   YRTIFYIPAVISGVAVSIIWGWILNGDYGVLNYLLSLLGIKGPRWLVDPAWALFAVVLA
FT                   SAFGVGTMMLIFYTDIKNIPIDLYEASSLDGASPVKQFFSITLPIITPTILFNLITSVI
FT                   SSFQQVTLVMLLTGGGPLKSTYFYGLYTYNNAFKHHKLGYASANAWVMFIIILILTALI
FT                   FKSSSTWVFYETEAKNGKKKKGGK"
FT                   /protein_id="YP_003820326.1"
FT   misc_feature    68340..69152
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cl00427"
FT                   /db_xref="CDD:174197"
FT                   /locus_tag="Closa_0060"
FT   gene            69260..70081
FT                   /db_xref="GeneID:9505309"
FT                   /locus_tag="Closa_0061"
FT   CDS_pept        69260..70081
FT                   /locus_tag="Closa_0061"
FT                   /gene_family="HOG000220525" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: str:Sterm_0717
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:302384505"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9505309"
FT                   /translation="MKMSKKSKVMIYALLTAVAVYFLAPFIYMFFTAFKTEAEAIAYPP
FT                   RLFPSKWLFDNFKNAWQSQPFGTYLKNSIIITVMTTAGQILSCSLVAYGFARFEFKGKN
FT                   LLFMILLSTMMIPWDVTMIPQYMEFNLFGWINTLKPLIVPAWFGSAYYIFLMRQFLMGV
FT                   PKDFEEAARIDGANAFQIYWKIFMPILKPSLILVGVLNMITVWNDYLGPLIFLHDRSKY
FT                   TLALGLATFKGVHSTRIIPMLCITIIMIIPPIIIFIIAQKYIVEGTSGSIK"
FT                   /protein_id="YP_003820327.1"
FT   misc_feature    69467..69907
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Closa_0061"
FT   misc_feature    order(69515..69520,69527..69532,69545..69547,69575..69586,
FT                   69590..69619,69626..69631,69635..69637,69695..69700,
FT                   69704..69706,69710..69712,69719..69724,69728..69730,
FT                   69740..69745,69752..69754,69803..69805,69845..69850,
FT                   69857..69859,69878..69889,69896..69901)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Closa_0061"
FT   misc_feature    order(69593..69637,69878..69895)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Closa_0061"
FT   misc_feature    order(69635..69637,69680..69682,69896..69898)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Closa_0061"
FT   misc_feature    order(69755..69793,69809..69814,69824..69826)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Closa_0061"
FT   gene            70179..73169
FT                   /db_xref="GeneID:9505310"
FT                   /locus_tag="Closa_0062"
FT   CDS_pept        70179..73169
FT                   /locus_tag="Closa_0062"
FT                   /gene_family="HOG000252444" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02836"
FT                   /codon_start="1"
FT                   /product="glycoside hydrolase family 2 TIM barrel"
FT                   /transl_table="11"
FT                   /note="PFAM: glycoside hydrolase family 2 TIM barrel;
FT                   glycoside hydrolase family 2 sugar binding; glycoside
FT                   hydrolase family 2 immunoglobulin domain protein
FT                   beta-sandwich; glycoside hydrolase family 42 domain 5 loop
FT                   region; KEGG: str:Sterm_0715 beta-galactosidase"
FT                   /db_xref="GI:302384506"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="GeneID:9505310"
FT                   /translation="MTRRTKKRWEDQTLGHIGRREARTEFYKDSASRINLNGEWRFLYL
FT                   EAPELSPEGFMNRETGTDWDLIDVPSVWQLRGYDRMHYTDVLYLFPINPPFVPSENPTG
FT                   IYKKTVHLNREWIQKDTILKFHGVDSAFDVWVNGTHAGYSKVSRLPSEFDITGYVQEGD
FT                   NDITVRVYKWSDGTYLEDQDMWWLSGIYRDVELINEPKDSIIDCTVEGDLDSTYKNGIL
FT                   KANITTKQKTCEGIWKLERDGQVVTRGIFQAEEGKAQVRETIPGAELWTAETPGLYELT
FT                   VSAGNHEIVVRVGFRKVEIKDNNFRVNNQVILLNGVNHHDFHPKEGRCVTREQMEADIL
FT                   LMKQNNINALRCSHYPANGYLYDLCDEYGLYVIDEADLECHGFEWVERYDWITDDPSWK
FT                   EAYVDRSVRMVKRDRNHPCIIMWSMGNESSFGCNFKSAAEAVKELDPGRLLHYEGDYEA
FT                   EVADVYSTMYTRLNRLKEIGESDIKGNKPHVMCEYGHAMGNGPGGLKAYQELYRKYKRL
FT                   QGGFLWEWYDHGIYTEEGKETYYRYGGNYGDFPTNGNFCIDGLLMPDRTPSPAMLEYKQ
FT                   VIAPVEVIRAGTGREVLVRNHYDFLTLGHVTLKWEIRTEEHNIQEGTITHMTALPHEEE
FT                   KVTIPFLPFLPEANTDYYLNITVCQKEDTNFAKAGHEISKVQFPLNISCDVLEERPKGE
FT                   PLQVSETTDLLKVENGAVTVTFHKIFGKLLSVGAGDQVYINEGPVMNVYRATIDNDMYK
FT                   KEDWLNKYFIQKSSEQTEYFTYQTEADQVVVSIGKYFGCLNQSWGFECDYEYTIYSCGQ
FT                   VKVDLKGKAVQRGKLEPSFLPRIGVVMKGNKSLQNAVWYGLGPGENYSDSKAASLMGIY
FT                   SSSVDEMGTNYVFPQENGHREEVKWFGIGDGNKSLLCKMEAPMGLNLGNYTDESLEEAK
FT                   HPFQIQRADHVEIHLDYLQSGLGSNSCGEEQLEEYKVKLQDFSMAFVMQVVDDGEVRKE
FT                   AKKHYLD"
FT                   /protein_id="YP_003820328.1"
FT   misc_feature    70197..73160
FT                   /note="cryptic beta-D-galactosidase subunit alpha;
FT                   Reviewed; Region: ebgA; PRK10340"
FT                   /db_xref="CDD:170375"
FT                   /locus_tag="Closa_0062"
FT   misc_feature    70266..70778
FT                   /note="Glycosyl hydrolases family 2, sugar binding domain;
FT                   Region: Glyco_hydro_2_N; pfam02837"
FT                   /db_xref="CDD:145805"
FT                   /locus_tag="Closa_0062"
FT   misc_feature    70767..71066
FT                   /note="domain; Region: Glyco_hydro_2; pfam00703"
FT                   /db_xref="CDD:144343"
FT                   /locus_tag="Closa_0062"
FT   misc_feature    71070..71921
FT                   /note="Glycosyl hydrolases family 2, TIM barrel domain;
FT                   Region: Glyco_hydro_2_C; pfam02836"
FT                   /db_xref="CDD:145804"
FT                   /locus_tag="Closa_0062"
FT   misc_feature    72294..73115
FT                   /note="Beta galactosidase small chain; Region:
FT                   Bgal_small_N; pfam02929"
FT                   /db_xref="CDD:111779"
FT                   /locus_tag="Closa_0062"
FT   gene            73195..75516
FT                   /db_xref="GeneID:9505311"
FT                   /locus_tag="Closa_0063"
FT   CDS_pept        73195..75516
FT                   /locus_tag="Closa_0063"
FT                   /gene_family="HOG000055022" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03632"
FT                   /codon_start="1"
FT                   /product="glycoside hydrolase family 65 central catalytic"
FT                   /transl_table="11"
FT                   /note="PFAM: glycoside hydrolase family 65 central
FT                   catalytic; glycoside hydrolase family 65 domain protein;
FT                   KEGG: tit:Thit_0754 glycoside hydrolase family 65 central
FT                   catalytic"
FT                   /db_xref="GI:302384507"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="GeneID:9505311"
FT                   /translation="MIKDRFSGKLKEMLSSDEWMILQPEYDPEENLKFESLFSLSNGYL
FT                   GIRGSHEEGGKITLPYLYINGVFDKSETFMRELAALPNWLGIKLFIEKELIGIENCQIL
FT                   KFSRALDMKQALLAKSLILRDKKGRETLVEGIRFVSRANVHRMGIKLYVTPLNYSGIIE
FT                   VENIIDGTIINFYDAPRFKVKHTYMTANEPLDKDGIYMEVATRDNHLHTGVGCRIEAYK
FT                   NGKSILKNRMFHAFGEQGVEFGDFDAAEGETVEIIKYVSMYTEREAARYTLHTKVKEEI
FT                   DGFMVKGFLEELEAHKTVYEEMWKAADIRIAGDFELDRAIRFNVFHLMSTGNENDSRVN
FT                   VGAKLLSGEEYGGHAFWDTEIFMLPFFAYIFPETAKNLESYRYHLLEAAKANARKNGFK
FT                   GAQYPWESADDGTEQCPDWTIEPDGSCYRCYVAVYEHHVTAAVAYGIYNYVKITRDLDF
FT                   LLNQGAEILTETARFWASRCEYVAEKDRYEINQVTGPDEWHEPVNNNLYTNYLAKWNLR
FT                   YVISLIDTLKKGHSKEYDTLMEKTGLTAREIKDWEIVQEKIYLPRKEGTDLLEQFEGYF
FT                   KLEDVVIEKYDEHDWPVRPEALKTKRASQTQIIKQADVVMLLHLMGQEFTEDEIRKNYE
FT                   YYEKRTLHGSSLSPSIYSVMGLKVGDDSKAYRYLKRAAFLDLLNLQKNTREGIHAANTG
FT                   GVWQTVVFGFAGVSIGEDGMLTVRPHMPKEWEGLDFCLRHRNSRLRITISRDNSVSVKV
FT                   LEGEALEVNVNGQIVKAVRE"
FT                   /protein_id="YP_003820329.1"
FT   misc_feature    73222..75498
FT                   /note="Trehalose and maltose hydrolases (possible
FT                   phosphorylases) [Carbohydrate transport and metabolism];
FT                   Region: ATH1; COG1554"
FT                   /db_xref="CDD:31743"
FT                   /locus_tag="Closa_0063"
FT   misc_feature    73255..73998
FT                   /note="Glycosyl hydrolase family 65, N-terminal domain;
FT                   Region: Glyco_hydro_65N; pfam03636"
FT                   /db_xref="CDD:146332"
FT                   /locus_tag="Closa_0063"
FT   gene            75530..76390
FT                   /db_xref="GeneID:9505312"
FT                   /locus_tag="Closa_0064"
FT   CDS_pept        75530..76390
FT                   /locus_tag="Closa_0064"
FT                   /gene_family="HOG000156003" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: cdf:CD1523 hypothetical protein"
FT                   /db_xref="GI:302384508"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="GeneID:9505312"
FT                   /translation="MKKRLAIGGLILVTIIWGGGFVASDMALESMRPFQIMAVRFLLGT
FT                   VFMGLISIRSLGGITKSEVMAGGLMGLALFAGFAFQIVGLQYTTPSKNAFLTALNVVIV
FT                   PFISYLILRKKIGARGIAGAVMSVAGVALLSLDRNFSLGLGDGLTLICAVGFAFQIFLT
FT                   SEFVKKYRATVLNFIQMITAFLLSFISLIAFGETQFHVTGKGILSVLYLGVISTTVCYL
FT                   LQTASQKYVDETKAAIILSLESVFGTLFSILILKEVVTPRMLAGSMIILAAVVISNLSE
FT                   SGQVE"
FT                   /protein_id="YP_003820330.1"
FT   misc_feature    75572..75937
FT                   /note="EamA-like transporter family; Region: EamA; cl01037"
FT                   /db_xref="CDD:154161"
FT                   /locus_tag="Closa_0064"
FT   misc_feature    75995..76366
FT                   /note="EamA-like transporter family; Region: EamA; cl01037"
FT                   /db_xref="CDD:154161"
FT                   /locus_tag="Closa_0064"
FT   gene            76403..77044
FT                   /db_xref="GeneID:9505313"
FT                   /locus_tag="Closa_0065"
FT   CDS_pept        76403..77044
FT                   /locus_tag="Closa_0065"
FT                   /gene_family="HOG000248341" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01990"
FT                   /codon_start="1"
FT                   /product="beta-phosphoglucomutase"
FT                   /transl_table="11"
FT                   /note="KEGG: cpy:Cphy_1021 beta-phosphoglucomutase;
FT                   TIGRFAM: beta-phosphoglucomutase; beta-phosphoglucomutase
FT                   family hydrolase; HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase"
FT                   /db_xref="GI:302384509"
FT                   /db_xref="InterPro:IPR005834"
FT                   /db_xref="InterPro:IPR006402"
FT                   /db_xref="InterPro:IPR010972"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="GeneID:9505313"
FT                   /translation="MKYKAVIFDLDGVICHTDRYHYQAWKQVADDLGIYFDEEINNRLR
FT                   GVSRMESFEIILENYYGSMSQEEKTFYAEKKNEVYKELLKHMSPKDLSQEVKETLAALR
FT                   LKGLKLAIGSSSKNAGFILERLGLSGYFDAISDGNNITYSKPDPEVFLKAAQFLSEAPI
FT                   DCLVVEDAKAGLEAAKAGNMDCGAIGDGKTCNIATYQLDRFSDLLEIVEG"
FT                   /protein_id="YP_003820331.1"
FT   misc_feature    76406..76954
FT                   /note="Haloacid dehalogenase-like hydrolases. The haloacid
FT                   dehalogenase-like (HAD) superfamily includes L-2-haloacid
FT                   dehalogenase, epoxide hydrolase, phosphoserine phosphatase,
FT                   phosphomannomutase, phosphoglycolate phosphatase, P-type
FT                   ATPase, and many others...; Region: HAD_like; cl11391"
FT                   /db_xref="CDD:175233"
FT                   /locus_tag="Closa_0065"
FT   misc_feature    76415..76969
FT                   /note="beta-phosphoglucomutase; Region: bPGM; TIGR01990"
FT                   /db_xref="CDD:162644"
FT                   /locus_tag="Closa_0065"
FT   gene            77165..78172
FT                   /db_xref="GeneID:9505314"
FT                   /locus_tag="Closa_0066"
FT   CDS_pept        77165..78172
FT                   /locus_tag="Closa_0066"
FT                   /gene_family="HOG000220180" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, LacI family"
FT                   /transl_table="11"
FT                   /note="KEGG: str:Sterm_0714 transcriptional regulator, LacI
FT                   family; PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein LacI"
FT                   /db_xref="GI:302384510"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="GeneID:9505314"
FT                   /translation="MATIKEIAEMAGVSAATVSRVLNFDDTLNVQDETKQRVFEAAERL
FT                   EYQMRDKKKYKKKLKLGMISSYSLEEELEDTFYLSVRIAIERKIEEEGFKRFPVNIGDS
FT                   VESTSNLDGLICLGTFSESMVNKVKAFHKPAVFVDALGDLDLFDSVVTDLTHSVKKVLS
FT                   YFMQEGHRKIAFIGGRDVDVDGKEVVDLRIPIFRSFMEDRGILKEEYIKIGGYTPKHGY
FT                   RLGKELLAMEDKPSAIFTANDSLAVGCYKAIQEAGLKIPEDISVIGFNDISIAKYLIPP
FT                   LTTVHIYMDFMGSQAVSVLAERIYSGREISMHISLPTKLMVRGSVSKWKGENQA"
FT                   /protein_id="YP_003820332.1"
FT   misc_feature    77165..78139
FT                   /note="DNA-binding transcriptional repressor EbgR;
FT                   Provisional; Region: PRK10339"
FT                   /db_xref="CDD:137829"
FT                   /locus_tag="Closa_0066"
FT   misc_feature    77177..77308
FT                   /note="Helix-turn-helix (HTH) DNA binding domain of the
FT                   LacI family of transcriptional regulators; Region:
FT                   HTH_LacI; cd01392"
FT                   /db_xref="CDD:143331"
FT                   /locus_tag="Closa_0066"
FT   misc_feature    order(77177..77179,77201..77215,77219..77224,77231..77233,
FT                   77252..77257,77264..77266,77303..77305)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:143331"
FT                   /locus_tag="Closa_0066"
FT   misc_feature    77348..78139
FT                   /note="Ligand-binding domain of DNA transcription repressor
FT                   GalR which is one of two regulatory proteins involved in
FT                   galactose transport and metabolism; Region: PBP1_GalR;
FT                   cd01544"
FT                   /db_xref="CDD:107257"
FT                   /locus_tag="Closa_0066"
FT   misc_feature    order(77393..77398,77405..77407,77513..77515,77579..77581,
FT                   77618..77620,77738..77740,77810..77812,77972..77974,
FT                   78023..78025)
FT                   /note="putative ligand binding site; other site"
FT                   /db_xref="CDD:107257"
FT                   /locus_tag="Closa_0066"
FT   misc_feature    order(77396..77404,77411..77416,77420..77425,77438..77452,
FT                   77456..77458,77471..77473,77480..77482,77489..77494,
FT                   77819..77821,77903..77905,77915..77917,77924..77929)
FT                   /note="putative dimerization interface; other site"
FT                   /db_xref="CDD:107257"
FT                   /locus_tag="Closa_0066"
FT   gene            complement(78263..78529)
FT                   /db_xref="GeneID:9505315"
FT                   /locus_tag="Closa_0067"
FT   CDS_pept        complement(78263..78529)
FT                   /locus_tag="Closa_0067"
FT                   /gene_family="HOG000245751" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Cphy_0044"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cpy:Cphy_0044 hypothetical protein"
FT                   /db_xref="GI:302384511"
FT                   /db_xref="GeneID:9505315"
FT                   /translation="MFRMWAKLIKDTRIVKDTVISISDYSLSRTSMVFQALDDICLQFD
FT                   LGKPIWLDATIHGFQKHSKVRFTQDNFIEQIEFDFLEIQVIEE"
FT                   /protein_id="YP_003820333.1"
FT   gene            78699..79790
FT                   /db_xref="GeneID:9505316"
FT                   /locus_tag="Closa_0068"
FT   CDS_pept        78699..79790
FT                   /locus_tag="Closa_0068"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Cphy_0049"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cpy:Cphy_0049 hypothetical protein"
FT                   /db_xref="GI:302384512"
FT                   /db_xref="GeneID:9505316"
FT                   /translation="MAQPISDQVGFLGEACRAVQELSVSRNLLEKFRLEERRLEKELEA
FT                   ERKAVTDAISLTVKKRMEEINDTYDREIAREQERLKRVRSKREKAKTQGIRERIEEETA
FT                   ELKGNNRELKLQMKAVFQQDRVPGFCKSGWFYALYFPRGFTESMVLLLNILLFFLAIPC
FT                   GVYLFLPNKSPFYLMGIYFAVILFFGGIYILINNLTKVRHQSALKKGRSIRDLIKANNR
FT                   KIRVIVRTIKRDRDEAVYNLEKYDDEIAQIDQDLADIADKKREALNTFDKVTRTILSDE
FT                   IASNSREKIAKLEEDYEGAAANAKEAEIRVKEQTLFINDNYASYIGKEFMVPERLDELA
FT                   DMIRMGKASTISEAKTLYKSLKE"
FT                   /protein_id="YP_003820334.1"
FT   gene            80069..80668
FT                   /db_xref="GeneID:9505317"
FT                   /locus_tag="Closa_0069"
FT   CDS_pept        80069..80668
FT                   /locus_tag="Closa_0069"
FT                   /gene_family="HOG000054678" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02841"
FT                   /codon_start="1"
FT                   /product="sporulation protein YyaC"
FT                   /transl_table="11"
FT                   /note="KEGG: cth:Cthe_2165 hypothetical protein; TIGRFAM:
FT                   sporulation protein YyaC; PFAM: protein of unknown function
FT                   DUF1256"
FT                   /db_xref="GI:302384513"
FT                   /db_xref="InterPro:IPR009665"
FT                   /db_xref="GeneID:9505317"
FT                   /translation="MKLWERIAIRGNRDVFYYDTKQTFEAEEFASRLYDMIRTEMENGK
FT                   AAGVLFLCIGTDRSTGDSLGPLIGYKLKERELENIEILGTLERPVHAMNLETYQAILKL
FT                   RYPNHVVVAVDASVGSMEHIGYVTLGKGALKPGLGVSKELRAVGDIFITGIVGSCGNYD
FT                   PLMLQSIRLSIVMRMADCISYSIYLVEKLWENTALL"
FT                   /protein_id="YP_003820335.1"
FT   misc_feature    80210..80626
FT                   /note="Protein of unknown function (DUF1256); Region:
FT                   DUF1256; cl06087"
FT                   /db_xref="CDD:141909"
FT                   /locus_tag="Closa_0069"
FT   gene            80731..81981
FT                   /db_xref="GeneID:9505318"
FT                   /locus_tag="Closa_0070"
FT   CDS_pept        80731..81981
FT                   /locus_tag="Closa_0070"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01476"
FT                   /codon_start="1"
FT                   /product="Peptidoglycan-binding lysin domain protein"
FT                   /transl_table="11"
FT                   /note="KEGG: eel:EUBELI_01972 hypothetical protein; PFAM:
FT                   Peptidoglycan-binding lysin domain; SMART:
FT                   Peptidoglycan-binding LysM"
FT                   /db_xref="GI:302384514"
FT                   /db_xref="InterPro:IPR002482"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="GeneID:9505318"
FT                   /translation="MGELYNPFPKLPKNIRQIGERDQIVKLYVEDYVNTYLKRLYPAGG
FT                   QELRVGLLLGGMEFNDGTPYIFIDGALEMEDVTDAGRRVMFSELAWKRAYRNMEQLFPK
FT                   RTIQGWFICGRPGDDLSPINYWKQHIQYFGEPNKLMYLSNGTDGEENIYITSEDGFYKL
FT                   QGYSIYYERNQMMQDYMVLRKDVKRIETDTNDKVIEEFRKRMDEHKVEVTDRHQTVGLL
FT                   RGMCMAMSVVILAGGIVMFNNYERMRDMESVIASAIPAKAEQILIGKKGLEKESKGESK
FT                   VVVEEAEGGVYPTTAVNKETMSETMPRGAQGDTMAESKAAETLPPATQSAKETATQPAK
FT                   ETATQPATEAATQPASQETEAAVSGDPRVHVVQEGETLYGICIAEYQTMNKMKEICELN
FT                   GLDDENKIVAGQKLLLP"
FT                   /protein_id="YP_003820336.1"
FT   misc_feature    81838..81978
FT                   /note="Lysin domain, found in a variety of enzymes involved
FT                   in bacterial cell wall degradation. This domain may have a
FT                   general peptidoglycan binding function; Region: LysM;
FT                   cl00107"
FT                   /db_xref="CDD:153515"
FT                   /locus_tag="Closa_0070"
FT   gene            82055..83329
FT                   /db_xref="GeneID:9505319"
FT                   /locus_tag="Closa_0071"
FT   CDS_pept        82055..83329
FT                   /locus_tag="Closa_0071"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:EUBELI_01971"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: eel:EUBELI_01971 hypothetical protein"
FT                   /db_xref="GI:302384515"
FT                   /db_xref="GeneID:9505319"
FT                   /translation="MSDRDSMNREIKKNQLRRQIVSSSPEAVEDSQEIIKKALTRVRKR
FT                   KIKIALVLFLVLFAGAIGVYEYFTLYQYTQYGVVWDKQMNEGSYVGYLSFGSNVLKYSK
FT                   DGASYLDSQGKEVWIQSYEMKSPKAWVSGNYAAIADQQGNSIYIFDKTGNTGIATTVLP
FT                   IVKATVSSYGVVAAILEDSTSNYIYFFKRDGSVLDVKIKALLGGDSGYPVDISLSPDGN
FT                   QLIGAYAYLKNGTLNGRVAFHNFAEIGKSIPDRLVGGFDEPYDASLVAQVHFLDNTYSC
FT                   AFADNSVSFYSTKNELSPELIRQVAVEEEIKSVFYSEKYVGLIVDNQEGENPYRLDVYK
FT                   PNGALVFSKGFQYQYTHADIDGDHVILYNEDSCRVYKMSGRLKFAGTFDFPISKIRNGR
FT                   FPNTLIVTGPQNMKEIRLQIGGQYQ"
FT                   /protein_id="YP_003820337.1"
FT   gene            83326..85305
FT                   /db_xref="GeneID:9505320"
FT                   /locus_tag="Closa_0072"
FT   CDS_pept        83326..85305
FT                   /locus_tag="Closa_0072"
FT                   /gene_family="HOG000225954" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00232"
FT                   /codon_start="1"
FT                   /product="transketolase"
FT                   /transl_table="11"
FT                   /note="KEGG: cpy:Cphy_0014 transketolase; TIGRFAM:
FT                   transketolase; PFAM: Transketolase domain protein;
FT                   Transketolase central region"
FT                   /db_xref="GI:302384516"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="GeneID:9505320"
FT                   /translation="MSNIHTMSVNAIRVLSADAIQKANSGHPGLPLGCASAAYELWANH
FT                   MNHNPADPDWANRDRFILSGGHGSMLLYSLLHLFGYGNLSKEDLMNFRQHGSKTPGHPE
FT                   YGHTIGVEATTGPLGAGMGMAVGMAIAEKHLSSVFNKENYPVVDHYTYVLGGDGCMMEG
FT                   ISSEVFSLAGTLGLGKLIVLYDSNKISIEGSTDIAFTEDVQKRMEAFHFQTITVEDGND
FT                   LEAIGRAIEEAKSDTEHPSFITIKTQIGYGCPAKQGKASAHGEPLGADNVTALKENLGW
FT                   PSMEPFFVPEEVYRNYRKIAEEKAETEAAWNVMFAAYCQEYPDMEELWNAYHDPDAGEK
FT                   AIEKCEDFWKRSEKADATRNLSGQVLNRLKTYMPNLIGGSADLAPSNKTNMTDMGDFSR
FT                   EDSSGRNLHFGVRELGMTAIGNGMMLHGGLRTYVATFFVFSDYTKPMARLSALMGVPLT
FT                   YIFTHDSIGVGEDGPTHEPIEQLAMLRAMPNFHVFRPCDETETEAAWYSALTSKKTPTA
FT                   LVLTRQNLTPMPGSSKEALKGGYVIDDCEGTPEIILMASGSEVELAVKAKTLLTGNKVR
FT                   VVSMPCMDLFEEQTEEYKESVLPKAVRRRVAVEALSDFGWGKYVGLDGTYVTMTGFGAS
FT                   GPANLLFEHFGFAAERIAEAALSI"
FT                   /protein_id="YP_003820338.1"
FT   misc_feature    83326..85302
FT                   /note="transketolase; Reviewed; Region: PRK05899"
FT                   /db_xref="CDD:168290"
FT                   /locus_tag="Closa_0072"
FT   misc_feature    83353..84153
FT                   /note="Thiamine pyrophosphate (TPP) family, Transketolase
FT                   (TK) subfamily, TPP-binding module; TK catalyzes the
FT                   transfer of a two-carbon unit from ketose phosphates to
FT                   aldose phosphates. In heterotrophic organisms, TK provides
FT                   a link between glycolysis and the...; Region: TPP_TK;
FT                   cd02012"
FT                   /db_xref="CDD:48175"
FT                   /locus_tag="Closa_0072"
FT   misc_feature    order(83524..83526,83671..83673,83677..83679,83794..83799,
FT                   83809..83811,83884..83886,83890..83892,83896..83898,
FT                   84112..84114)
FT                   /note="TPP-binding site; other site"
FT                   /db_xref="CDD:48175"
FT                   /locus_tag="Closa_0072"
FT   misc_feature    order(83602..83604,83626..83631,83635..83637,83674..83679,
FT                   83683..83685,83803..83814,83821..83826,83833..83835,
FT                   83845..83847,83893..83898,83941..83943)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48175"
FT                   /locus_tag="Closa_0072"
FT   misc_feature    84403..84891
FT                   /note="Pyrimidine (PYR) binding domain of
FT                   1-deoxy-D-xylulose-5-phosphate synthase (DXS),
FT                   transketolase (TK), and related proteins; Region:
FT                   TPP_PYR_DXS_TK_like; cd07033"
FT                   /db_xref="CDD:132916"
FT                   /locus_tag="Closa_0072"
FT   misc_feature    order(84445..84447,84451..84453,84469..84471,84538..84540,
FT                   84547..84549,84553..84570,84577..84582,84586..84594,
FT                   84649..84651,84658..84663,84736..84738,84745..84747,
FT                   84793..84798,84859..84861)
FT                   /note="PYR/PP interface; other site"
FT                   /db_xref="CDD:132916"
FT                   /locus_tag="Closa_0072"
FT   misc_feature    order(84469..84471,84547..84549,84556..84564,84646..84651,
FT                   84655..84657,84736..84738,84742..84744,84769..84774,
FT                   84778..84783,84787..84789)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:132916"
FT                   /locus_tag="Closa_0072"
FT   misc_feature    order(84556..84558,84562..84564,84640..84642,84649..84651)
FT                   /note="TPP binding site; other site"
FT                   /db_xref="CDD:132916"
FT                   /locus_tag="Closa_0072"
FT   misc_feature    84940..85281
FT                   /note="Transketolase, C-terminal domain; Region:
FT                   Transketolase_C; pfam02780"
FT                   /db_xref="CDD:145764"
FT                   /locus_tag="Closa_0072"
FT   gene            85677..86621
FT                   /db_xref="GeneID:9505321"
FT                   /locus_tag="Closa_0073"
FT   CDS_pept        85677..86621
FT                   /locus_tag="Closa_0073"
FT                   /gene_family="HOG000150087" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00744"
FT                   /codon_start="1"
FT                   /product="glucokinase, ROK family"
FT                   /transl_table="11"
FT                   /note="KEGG: cac:CAC2613 NagC/XylR family transcriptional
FT                   regulators; TIGRFAM: glucokinase, ROK family; PFAM: ROK
FT                   family protein"
FT                   /db_xref="GI:302384517"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR004654"
FT                   /db_xref="GeneID:9505321"
FT                   /translation="MGMKCVGVDVGGTSVKIGVFEVTGELLHKWEVPTRKEEGGKYILN
FT                   DTAASIRKTLEELGIPLEEVKGVGMGVPGPVMPSGYVEVCVNLGWRDMYPEKELSEMLD
FT                   GIPVKSGNDANVAALGEMWQGGGKGYDDIVMVTLGTGVGGGVIIDQKIVAGKHGLAGEI
FT                   GHIHIRDDETESCNCGGVGCVEQISSATGIAREARRKMAAVDTPSVLRTFGDKVTAKDV
FT                   LDAAKEGDSLACEVMDVVGHYLGLALAQISMVTDPEVFVIGGGVSKAGAFLIDVLYKHF
FT                   DKYTPISQNKSGIVLAKLGNDAGIYGAARLILD"
FT                   /protein_id="YP_003820339.1"
FT   misc_feature    85692..86612
FT                   /note="ROK family protein (putative glucokinase); Region:
FT                   ROK_glcA_fam; TIGR00744"
FT                   /db_xref="CDD:162017"
FT                   /locus_tag="Closa_0073"
FT   misc_feature    85695..86255
FT                   /note="ROK family; Region: ROK; cl09121"
FT                   /db_xref="CDD:175010"
FT                   /locus_tag="Closa_0073"
FT   gene            complement(86668..87864)
FT                   /db_xref="GeneID:9505322"
FT                   /locus_tag="Closa_0074"
FT   CDS_pept        complement(86668..87864)
FT                   /locus_tag="Closa_0074"
FT                   /gene_family="HOG000224529" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00258"
FT                   /codon_start="1"
FT                   /product="flavodoxin/nitric oxide synthase"
FT                   /transl_table="11"
FT                   /note="PFAM: flavodoxin/nitric oxide synthase; KEGG:
FT                   vpr:Vpar_0099 beta-lactamase domain protein"
FT                   /db_xref="GI:302384518"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="GeneID:9505322"
FT                   /translation="MKKLVKNNVYWVGFMDWELESFHGADYSINHGSSQNAYLIKEEKT
FT                   VLIDTVWRPHSTEFMDNLEREIDLKEIDFIVANHGEVDHSGSLPALMEKIPGTPIYCTA
FT                   NGVKSLTGQYHHPEWNYQVVKTGDSIDIGNGKKLVFVEMKMLHWPDSMATYLTGDNILF
FT                   SNDAFGQHYAVEELFNDKADQCRLWEEAIKYYANILTPFSPLVKKKIEEIQGLNLPIDI
FT                   IATSHGSIWRENPLQIVEKYYEWSQNYQEDQITIVYDTMWDGTKQLAHKISAEIARISP
FT                   DTRVKIYNISKTNKNDIMTEVFKSKAIALGSPTVGGSILSSVGGWLDFLKELKYKGKKA
FT                   AVFGCYGWSGEGNKVLRERLTEAGFSVVEAEAKCLWNPEEEDFNKAADIAGALCQKES"
FT                   /protein_id="YP_003820340.1"
FT   misc_feature    complement(86677..87852)
FT                   /note="metallo-beta-lactamase/flavodoxin domain-containing
FT                   protein; Provisional; Region: PRK11921"
FT                   /db_xref="CDD:171345"
FT                   /locus_tag="Closa_0074"
FT   misc_feature    complement(87286..87774)
FT                   /note="Metallo-beta-lactamase superfamily; Region:
FT                   Lactamase_B; cl00446"
FT                   /db_xref="CDD:174207"
FT                   /locus_tag="Closa_0074"
FT   misc_feature    complement(86686..87105)
FT                   /note="NADPH-dependent FMN reductase; Region: FMN_red;
FT                   cl00438"
FT                   /db_xref="CDD:174204"
FT                   /locus_tag="Closa_0074"
FT   gene            complement(87861..88565)
FT                   /db_xref="GeneID:9505323"
FT                   /locus_tag="Closa_0075"
FT   CDS_pept        complement(87861..88565)
FT                   /locus_tag="Closa_0075"
FT                   /gene_family="HOG000286324" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04405"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF542 ScdA domain
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF542 ScdA domain
FT                   protein; Hemerythrin HHE cation binding domain protein;
FT                   KEGG: afn:Acfer_0684 protein of unknown function DUF542
FT                   ScdA domain protein"
FT                   /db_xref="GI:302384519"
FT                   /db_xref="InterPro:IPR007500"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="GeneID:9505323"
FT                   /translation="MITGKMKVTDVVKAYPEAVELFNDFHIDYCCGGKDELEKALQQLG
FT                   IESKSFIEVLNKKIVNQPHKSNKGHVLAVERLAEMDIPVLIDYIIDTHHSKERVLLAEI
FT                   DELINKVLLVHYEHHQSQLVPLHRLFSDLRKELQEHFAKEEKLIFPFMKNSFTESKSTG
FT                   FVKELEDEHEGAGNLMKEITACTNDFTPPEDGCASYRMVFQKLEELVKDVYIHIFTENS
FT                   LLFPKYEGGIGQ"
FT                   /protein_id="YP_003820341.1"
FT   misc_feature    complement(88395..88550)
FT                   /note="Domain of Unknown function (DUF542); Region: ScdA_N;
FT                   pfam04405"
FT                   /db_xref="CDD:146842"
FT                   /locus_tag="Closa_0075"
FT   misc_feature    complement(87882..88544)
FT                   /note="iron-sulfur cluster repair di-iron protein; Region:
FT                   FeS_repair_RIC; TIGR03652"
FT                   /db_xref="CDD:163376"
FT                   /locus_tag="Closa_0075"
FT   gene            complement(88684..89373)
FT                   /db_xref="GeneID:9505324"
FT                   /locus_tag="Closa_0076"
FT   CDS_pept        complement(88684..89373)
FT                   /locus_tag="Closa_0076"
FT                   /gene_family="HOG000250566" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /transl_table="11"
FT                   /note="KEGG: aoe:Clos_2178 Crp/FNR family transcriptional
FT                   regulator; PFAM: cyclic nucleotide-binding; regulatory
FT                   protein Crp; SMART: cyclic nucleotide-binding; regulatory
FT                   protein Crp"
FT                   /db_xref="GI:302384520"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR001808"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="GeneID:9505324"
FT                   /translation="MELKCNFCSKLCTSKIPLFEPLSLEEQKELISKARHLDYKRGETI
FT                   FYDNDPADKILVIRYGKVKVNRYSLEGKESVLDILTEGDIYGEQNIFGGTDFDANAVAL
FT                   GKCGVCLISLTDIQELILKKPEIGVKLLNAVGQKLSAANELVQLLSVNDAKARVAGFLL
FT                   FRSSRIKGETIELTRDDISAYINVRRETISRKLGELRRDGAIELEGNRRIRVKNRDMLR
FT                   DSFENEA"
FT                   /protein_id="YP_003820342.1"
FT   misc_feature    complement(88720..89331)
FT                   /note="cAMP-binding proteins - catabolite gene activator
FT                   and regulatory subunit of cAMP-dependent protein kinases
FT                   [Signal transduction mechanisms]; Region: Crp; COG0664"
FT                   /db_xref="CDD:31008"
FT                   /locus_tag="Closa_0076"
FT   misc_feature    complement(88978..89322)
FT                   /note="effector domain of the CAP family of transcription
FT                   factors; members include CAP (or cAMP receptor protein
FT                   (CRP)), which binds cAMP, FNR (fumarate and nitrate
FT                   reduction), which uses an iron-sulfur cluster to sense
FT                   oxygen) and CooA, a heme containing CO...; Region: CAP_ED;
FT                   cd00038"
FT                   /db_xref="CDD:28920"
FT                   /locus_tag="Closa_0076"
FT   misc_feature    complement(order(89077..89085,89110..89115))
FT                   /note="ligand binding site; other site"
FT                   /db_xref="CDD:28920"
FT                   /locus_tag="Closa_0076"
FT   misc_feature    complement(order(88993..89001,89011..89019))
FT                   /note="flexible hinge region; other site"
FT                   /db_xref="CDD:28920"
FT                   /locus_tag="Closa_0076"
FT   misc_feature    complement(88729..88914)
FT                   /note="helix_turn_helix, cAMP Regulatory protein
FT                   C-terminus; DNA binding domain of prokaryotic regulatory
FT                   proteins belonging to the catabolite activator protein
FT                   family; Region: HTH_CRP; cd00092"
FT                   /db_xref="CDD:28976"
FT                   /locus_tag="Closa_0076"
FT   misc_feature    complement(88900..88905)
FT                   /note="putative switch regulator; other site"
FT                   /db_xref="CDD:28976"
FT                   /locus_tag="Closa_0076"
FT   misc_feature    complement(order(88810..88812,88837..88845,88849..88851))
FT                   /note="non-specific DNA interactions; other site"
FT                   /db_xref="CDD:28976"
FT                   /locus_tag="Closa_0076"
FT   misc_feature    complement(88792..88812)
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:28976"
FT                   /locus_tag="Closa_0076"
FT   misc_feature    complement(order(88792..88794,88804..88809))
FT                   /note="sequence specific DNA binding site; other site"
FT                   /db_xref="CDD:28976"
FT                   /locus_tag="Closa_0076"
FT   misc_feature    complement(88804..88809)
FT                   /note="putative cAMP binding site; other site"
FT                   /db_xref="CDD:28976"
FT                   /locus_tag="Closa_0076"
FT   gene            complement(89488..90585)
FT                   /db_xref="GeneID:9505325"
FT                   /locus_tag="Closa_0077"
FT   CDS_pept        complement(89488..90585)
FT                   /locus_tag="Closa_0077"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:5.1.3.3"
FT                   /codon_start="1"
FT                   /EC_number="5.1.3.3"
FT                   /transl_table="11"
FT                   /note="KEGG: aldose 1-epimerase; PFAM: Aldose 1-epimerase"
FT                   /db_xref="GI:302384521"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="GeneID:9505325"
FT                   /translation="MKIKTRELWNQEGTAYKVYDMVTSLGMTVTVTALGAAIQKVAIRD
FT                   ETGRELPVTLGFEDMGQYESCICYAGTTLGPNAGRIGEALLPVGSRIYRLSNNDGKNQL
FT                   HGGVNHLSSRLWQAESVASGLESASILLSAFQPDGLDGYPGNRTYHTRYTLEDTNWLTI
FT                   EYTAATDAPTYINMSNHTYWNLSGDFSVSGLEQEIQIFANNVCINNKEHLPADLIPVAD
FT                   TVFDFRYAGQLLSRIRSAKSPVCKEQLSIGRGYNNAYILNRNQTFRPLRFAKRPEELKK
FT                   ACILRDKRTGRTLKIMTDAPALVLYSGGFLSHGMALSGGAPSFPSCAVALEPQDIPDVM
FT                   HLLPESYRLTTPDHPFSRTIRYHIS"
FT                   /product="Aldose 1-epimerase"
FT                   /protein_id="YP_003820343.1"
FT   misc_feature    complement(89491..90558)
FT                   /note="Galactose mutarotase and related enzymes
FT                   [Carbohydrate transport and metabolism]; Region: GalM;
FT                   COG2017"
FT                   /db_xref="CDD:32200"
FT                   /locus_tag="Closa_0077"
FT   misc_feature    complement(89521..90549)
FT                   /note="Aldose 1-epimerase; Region: Aldose_epim; cl00476"
FT                   /db_xref="CDD:176583"
FT                   /locus_tag="Closa_0077"
FT   gene            90698..90841
FT                   /db_xref="GeneID:9505326"
FT                   /locus_tag="Closa_0078"
FT   CDS_pept        90698..90841
FT                   /locus_tag="Closa_0078"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:302384522"
FT                   /db_xref="GeneID:9505326"
FT                   /translation="MKINGLTEKTGMERKFRGRFKIKEVMNGKFLNEYQPFCCFGRRAG
FT                   IR"
FT                   /protein_id="YP_003820344.1"
FT   gene            90949..92454
FT                   /db_xref="GeneID:9505327"
FT                   /locus_tag="Closa_0079"
FT   CDS_pept        90949..92454
FT                   /locus_tag="Closa_0079"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: msu:MS0062 L-arabinose transporter ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="GI:302384523"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:9505327"
FT                   /translation="MGSVLEFQNISKYFPGVKALDQVSFQANSGEVLAFLGENGAGKST
FT                   LLKVLNGDYQPTGGKYLLDGVEKHFQSPHEAIEEGISVIYQERQILLELSVAENIYLGR
FT                   MPVTRLGFIDARKANEMTTKIIADFGLPISPTAKVKDLSIAYQQMVEIMKAYSRENLKV
FT                   ICFDEPTASLSDSEIESLFKVIGKLKEEGKIIIYVSHRMDELRRITDKAVIFKDGRYVA
FT                   TVETGKVPEAELIRMMVGRDLGDIYRNLDRNKVMGEVLLEVKNLSSDYVKENSFVLRRG
FT                   EVLGFSGLVGAGRTELMRAIIGADEAKSGEIYLEGKKIHNRSPHEAMEHGIVLVPEDRK
FT                   MQGILSNLSVSDNMNIAMLDVNSSKLGFVSREKEEKLALNGIRDFKIKTSSPDKKIVEL
FT                   SGGNQQKCIVARWISTNPKVLILDEPTKGIDVGAKSEFYHMICKFAREGLGIILISSEL
FT                   PEVIGLSDRIIVMKSLRITGEIAAAEATESKLLSLGMIGEVQE"
FT                   /protein_id="YP_003820345.1"
FT   misc_feature    90949..92433
FT                   /note="L-arabinose transporter ATP-binding protein;
FT                   Provisional; Region: araG; PRK11288"
FT                   /db_xref="CDD:171063"
FT                   /locus_tag="Closa_0079"
FT   misc_feature    90961..91617
FT                   /note="This family represents the domain I of the
FT                   carbohydrate uptake proteins that transport only
FT                   monosaccharides (Monos).  The Carb_Monos family is involved
FT                   in the uptake of monosaccharides, such as pentoses (such as
FT                   xylose, arabinose, and ribose) and...; Region:
FT                   ABC_Carb_Monos_I; cd03216"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="Closa_0079"
FT   misc_feature    91057..91080
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="Closa_0079"
FT   misc_feature    order(91066..91071,91075..91083,91204..91206,91447..91452,
FT                   91546..91548)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="Closa_0079"
FT   misc_feature    91195..91206
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="Closa_0079"
FT   misc_feature    order(91228..91242,91387..91401)
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="Closa_0079"
FT   misc_feature    91435..91452
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="Closa_0079"
FT   misc_feature    91459..91470
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="Closa_0079"
FT   misc_feature    91534..91554
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:72975"
FT                   /locus_tag="Closa_0079"
FT   misc_feature    91717..92364
FT                   /note="This family represents domain II of the carbohydrate
FT                   uptake proteins that transport only monosaccharides
FT                   (Monos).  The Carb_Monos family is involved in the uptake
FT                   of monosaccharides, such as pentoses (such as xylose,
FT                   arabinose, and ribose) and hexoses (; Region:
FT                   ABC_Carb_Monos_II; cd03215"
FT                   /db_xref="CDD:72974"
FT                   /locus_tag="Closa_0079"
FT   gene            92454..93440
FT                   /db_xref="GeneID:9505328"
FT                   /locus_tag="Closa_0080"
FT   CDS_pept        92454..93440
FT                   /locus_tag="Closa_0080"
FT                   /gene_family="HOG000212232" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /codon_start="1"
FT                   /product="inner-membrane translocator"
FT                   /transl_table="11"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   hor:Hore_22690 monosaccharide-transporting ATPase"
FT                   /db_xref="GI:302384524"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="GeneID:9505328"
FT                   /translation="MEKNIKNRIKINGDKIVLLAAIVVVFGLFTSLNRNFLSVTNLINI
FT                   LVAASLVGLVAVGHTYLIIAGQNDLSPGSVAAFSGVAAALLVGKGVPFGAAVLLTIAGG
FT                   VLMGLFNSFMVNRIHLEAFIATLVTQSIIRGFAYIICGGKPISISNKTFLILGKARILN
FT                   IPLSVWIMVICIIIFGIILSKTKFGRSVYAIGGSMEAARLAGLNPQRIIATCYVMMGVL
FT                   CSIGGIIFAARMNSGQPAANVNLEFDAITAVILGGVSFIGGVGNMGGTILGIILIQSFN
FT                   TGLTMVNVPSFWQFVAKGGLLLFALATDYMRKQKRERDLLAASMKNL"
FT                   /protein_id="YP_003820346.1"
FT   misc_feature    92631..93380
FT                   /note="Transmembrane subunit (TM) of Escherichia coli AraH
FT                   and related proteins. E. coli AraH is the TM of a
FT                   Periplasmic Binding Protein (PBP)-dependent ATP-Binding
FT                   Cassette (ABC) transporter involved in the uptake of the
FT                   monosaccharide arabinose. This group...; Region:
FT                   TM_PBP1_transp_AraH_like; cd06579"
FT                   /db_xref="CDD:119321"
FT                   /locus_tag="Closa_0080"
FT   misc_feature    93048..93104
FT                   /note="TM-ABC transporter signature motif; other site"
FT                   /db_xref="CDD:119321"
FT                   /locus_tag="Closa_0080"
FT   gene            93509..94585
FT                   /db_xref="GeneID:9505329"
FT                   /locus_tag="Closa_0081"
FT   CDS_pept        93509..94585
FT                   /locus_tag="Closa_0081"
FT                   /gene_family="HOG000292635" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /codon_start="1"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /transl_table="11"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: cbe:Cbei_1380 periplasmic
FT                   binding protein/LacI transcriptional regulator"
FT                   /db_xref="GI:302384525"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="GeneID:9505329"
FT                   /translation="MKKTAVIILAAAMAMGLTACSGFSAEEPAATTKAGTTETTAAGTQ
FT                   AEEKTQAQAGGKGVVYGIYKAGDQTWFIDEGAAAQKVVEEKGDEFIYVDAKMNPEEYLK
FT                   AIDNAIANKAKGIVTCIPDQTMSQAVVDKCKEAGIPIIAADDALQTEAGEKIAPWVGIN
FT                   AYVIGQANGQWLADYANKNNLAQDPDCGLLILTMDTVSSCVPRAEGEYDKFTEACPDFG
FT                   KEKIFKADYDGTTDKGNVAATSVFTAHPEIKKWLVTGANEEGTIGAVRALESAGLDANA
FT                   TVVGLGAYMAKDEWNNKGADGTCMKAAAYFSSDSVGAGSVNVLYDVVSGKEVPMETAVD
FT                   AVIVTPENYKEVMGKAAE"
FT                   /protein_id="YP_003820347.1"
FT   misc_feature    93695..94552
FT                   /note="Type 1 periplasmic binding fold superfamily; Region:
FT                   Periplasmic_Binding_Protein_Type_1; cl10011"
FT                   /db_xref="CDD:175057"
FT                   /locus_tag="Closa_0081"
FT   gene            complement(94639..95487)
FT                   /db_xref="GeneID:9505330"
FT                   /locus_tag="Closa_0082"
FT   CDS_pept        complement(94639..95487)
FT                   /locus_tag="Closa_0082"
FT                   /gene_family="HOG000087148" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, AraC family"
FT                   /transl_table="11"
FT                   /note="KEGG: dhd:Dhaf_2638 transcriptional regulator, AraC
FT                   family; PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: Helix-turn-helix, AraC domain"
FT                   /db_xref="GI:302384526"
FT                   /db_xref="InterPro:IPR000005"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="GeneID:9505330"
FT                   /translation="MLSTERGVISGSDYYVYTPSALAKKIFLYPINMGLFRYEPGYSLH
FT                   RNAYDSFLIMFIRRGECQVETGGRIYNAGPGQVVLLNCYEPHAYWTSKGWEAEWLHFDG
FT                   KGGAGYYEAILDGGPPVISLRDTYRLEKYLHKIYLQFRECISTKEAWLNNYIVNILTEL
FT                   LVNRDNEHSENVSSSIIEDTIAYISEHLTDPLTLKDMADQASLSPFYFSRLFKKESGFS
FT                   PHEYVIAARVNNAKFLLKSSDISIKDICFSTGFTSESSFCTTFKKETGITPSQYRFSIR
FT                   N"
FT                   /protein_id="YP_003820348.1"
FT   misc_feature    complement(95068..95388)
FT                   /note="Cupin domain; Region: Cupin_2; cl09118"
FT                   /db_xref="CDD:175009"
FT                   /locus_tag="Closa_0082"
FT   misc_feature    complement(94642..95013)
FT                   /note="AraC-type DNA-binding domain-containing proteins
FT                   [Transcription]; Region: AraC; COG2207"
FT                   /db_xref="CDD:32389"
FT                   /locus_tag="Closa_0082"
FT   misc_feature    complement(94810..94929)
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="Closa_0082"
FT   misc_feature    complement(94657..94767)
FT                   /note="Bacterial regulatory helix-turn-helix proteins, AraC
FT                   family; Region: HTH_AraC; pfam00165"
FT                   /db_xref="CDD:143933"
FT                   /locus_tag="Closa_0082"
FT   gene            95650..98925
FT                   /db_xref="GeneID:9505331"
FT                   /locus_tag="Closa_0083"
FT   CDS_pept        95650..98925
FT                   /locus_tag="Closa_0083"
FT                   /gene_family="HOG000123492" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /codon_start="1"
FT                   /product="TPR repeat-containing protein"
FT                   /transl_table="11"
FT                   /note="PFAM: TPR repeat-containing protein; KEGG:
FT                   gym:GYMC10_4394 tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="GI:302384527"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="GeneID:9505331"
FT                   /translation="MEAVKIWEESMVIPTYEVGEADKNPMFLESRVYQGSSGKIYPYPT
FT                   IEKIYDTRIDKAYQAVWLENEYLKVMILPELGGRIQRAFDKTNHYDFVYYNHVIKPALV
FT                   GLCGPWISGGIEFNWPQHHRPTTFSPVDYMLIENEDGSKTCRVCDVDQMYGTKGEASFT
FT                   LYPGKAYIEIKGQLYNPTPLPQTFLWWANPAVPVNDYTQSVFPPDVHAVMDHGKRDVSR
FT                   FPIATGVYYKHDYSQGVDISRYKNIPVPTSYMAEKSEFNFVGGYDYQVGAGILHVADHH
FT                   ISPGKKQWTWGCGDFGKAWDRNLTDEDGPYIELMTGVYTDNQPDFTWLKPMEEKTFTQY
FT                   FMPYKAVGPVKNASIHAVINLETRENEIHILAYGTQEYPHGRILLTYGKETLLDETTLL
FT                   SPVHTYEKTLHTYVEDETRLTLKVLSGGRELVSYTPLKKEVPELPSPAKAAGDPEKIMT
FT                   NEELYLTGLHIEQYRHATYRPDPYYIEGLKRDPGDMRINNAYGSLLLARGCFEEAEEHF
FT                   KKALKRAVWKNPNPYDSEPCYNLGLALLYQGKTEKAFDAFYKATWSGQQQEMGFYYLSC
FT                   IESMRGNYESALELVEKGLVRNTHNVKARALKAYLLRRLGRTAEARALIGENLKVDSFD
FT                   YVSRLESAYLEPDRQAEIRTKISRLARGFHENYLMAARHYGEFGAYEAAVQTLDQCSRK
FT                   WPMVYYYKAYYQELMGRDSTEALKQAEDCSTDYCFPNKLEDILVLKLATEKNPEGANAY
FT                   YYLGNLYYDKLQYRTALSYWEQSARLNPRFPTVWRNLSLAYYNKEKDRERAKTAMETAY
FT                   GLNPADARIFLELDQLYKKLDMPAAERLERYEAARDVFMKRDDLMIEYATLLNLLGRYG
FT                   EAYEFIMNHKFHPWEGGEGKVTAQYVVSLVELARQAMDEKEWDRAKEYLTKALKYPENL
FT                   GEGKLEGTKDNHINYYLGVVMENLGRAEEARAYFEMACVGTDEPSGMMYYNDQPADMIY
FT                   YQGLAKEKLGKPVEARARFDKLLDYGAKHMPDHMKIEYFAVSLPDFLIYEEDLDKKNKA
FT                   HCNYLIGLGKMGLGDMAEAREAFLETIRLDHTHLNAIRYLNMI"
FT                   /protein_id="YP_003820349.1"
FT   misc_feature    <97102..>98106
FT                   /note="putative PEP-CTERM system TPR-repeat lipoprotein;
FT                   Region: PEP_TPR_lipo; TIGR02917"
FT                   /db_xref="CDD:163072"
FT                   /locus_tag="Closa_0083"
FT   misc_feature    97150..97434
FT                   /note="Tetratricopeptide repeat domain; typically contains
FT                   34 amino acids
FT                   [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
FT                   X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a
FT                   variety of organisms including bacteria, cyanobacteria,
FT                   yeast, fungi...; Region: TPR; cd00189"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="Closa_0083"
FT   misc_feature    order(97150..97152,97186..97188,97198..97200,97207..97209,
FT                   97270..97272,97306..97308,97318..97320,97327..97329,
FT                   97372..97374,97408..97410,97420..97422,97429..97431)
FT                   /note="TPR motif; other site"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="Closa_0083"
FT   misc_feature    order(97153..97158,97261..97266,97270..97275,97282..97287,
FT                   97363..97368,97375..97380,97387..97392)
FT                   /note="binding surface"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="Closa_0083"
FT   misc_feature    97942..98154
FT                   /note="Tetratricopeptide repeat domain; typically contains
FT                   34 amino acids
FT                   [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
FT                   X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a
FT                   variety of organisms including bacteria, cyanobacteria,
FT                   yeast, fungi...; Region: TPR; cd00189"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="Closa_0083"
FT   misc_feature    order(97954..97956,97966..97968,97975..97977,98020..98022,
FT                   98059..98061,98071..98073,98080..98082,98125..98127)
FT                   /note="TPR motif; other site"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="Closa_0083"
FT   misc_feature    order(98011..98016,98020..98025,98032..98034,98038..98040,
FT                   98116..98121,98128..98133,98140..98145)
FT                   /note="binding surface"
FT                   /db_xref="CDD:29151"
FT                   /locus_tag="Closa_0083"
FT   gene            99207..99311
FT                   /db_xref="GeneID:9505332"
FT                   /locus_tag="Closa_0084"
FT   CDS_pept        99207..99311
FT                   /locus_tag="Closa_0084"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:302384528"
FT                   /db_xref="GeneID:9505332"
FT                   /translation="MASFLPFFLCILIFKFLKGQQQPFLLFTIYYIMI"
FT                   /protein_id="YP_003820350.1"
FT   gene            99511..101181
FT                   /db_xref="GeneID:9505333"
FT                   /locus_tag="Closa_0085"
FT   CDS_pept        99511..101181
FT                   /locus_tag="Closa_0085"
FT                   /gene_family="HOG000223999" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:3.6.1.1"
FT                   /codon_start="1"
FT                   /EC_number="3.6.1.1"
FT                   /transl_table="11"
FT                   /note="KEGG: cpy:Cphy_2864 putative manganese-dependent
FT                   inorganic pyrophosphatase; PFAM: DRTGG domain protein; CBS
FT                   domain containing protein; DHHA2 domain protein"
FT                   /db_xref="GI:302384529"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="GeneID:9505333"
FT                   /translation="MGENYKNRKTIVIGHKNPDTDSICSAICYANLKRVLTGEDYQPGR
FT                   AGHVNEETQFVLHYFGIEAPELVENVKTQVRDIEIRKTKGVKKNLSLKKAWNLMQEANV
FT                   VTIPAVTDDGMLEGLITVGDIARSYMNVYDSSILSKANTQYENIVETLEGAMVVGGKNE
FT                   YFNHGKVLIAAANPDMMEYYISKGDLVILGNRYESQLCAIEMEAACIIVCEGAAVSMTI
FT                   KKLAQERGCTVMTTPYDTYTAARLVNQSIPISYFMTTEGLISFEEEDYIDDIKDVMASK
FT                   RHRDFPILDKDGKYMGMISRRNLLGAKGKRLILVDHNEKTQAVEGMASAEILEIIDHHR
FT                   LGTVETIAPVFFRNQPVGCTATIVYQMYQENKVKIEPKIAGLLCSAIISDTLLFRSPTC
FT                   TESDKQAALTLSDIAGIQVEKYASSMFAAGSNLKGKTDAEIFYQDFKKFMVGKVSFGVG
FT                   QISSLNAKELEELKGRMLPYMKKAREEHGMDMMFFMLTNILTESTELLCEGQGAKQMIA
FT                   VAFRAEEEESGAEDHIVSLPGVVSRKKQLIPGIMLAVQE"
FT                   /product="Inorganic diphosphatase"
FT                   /protein_id="YP_003820351.1"
FT   misc_feature    99556..99894
FT                   /note="The CBS domain, named after human CBS, is a small
FT                   domain originally identified in cystathionine beta-synthase
FT                   and is subsequently found in a wide range of different
FT                   proteins. CBS domains usually occur in tandem repeats. They
FT                   associate to form a so-...; Region: CBS_pair; cl10010"
FT                   /db_xref="CDD:99705"
FT                   /locus_tag="Closa_0085"
FT   misc_feature    99949..100260
FT                   /note="DRTGG domain; Region: DRTGG; cl12147"
FT                   /db_xref="CDD:159807"
FT                   /locus_tag="Closa_0085"
FT   misc_feature    100267..100431
FT                   /note="TIM barrel proteins share a structurally conserved
FT                   phosphate binding motif and in general share an eight
FT                   beta/alpha closed barrel structure. Specific for this
FT                   family is the conserved phosphate binding site at the edges
FT                   of strands 7 and 8. The phosphate...; Region:
FT                   TIM_phosphate_binding; cl09108"
FT                   /db_xref="CDD:176427"
FT                   /locus_tag="Closa_0085"
FT   misc_feature    <100444..100674
FT                   /note="DHH family; Region: DHH; pfam01368"
FT                   /db_xref="CDD:144819"
FT                   /locus_tag="Closa_0085"
FT   misc_feature    100774..101154
FT                   /note="DHHA2 domain; Region: DHHA2; pfam02833"
FT                   /db_xref="CDD:145802"
FT                   /locus_tag="Closa_0085"
FT   gene            101197..101835
FT                   /db_xref="GeneID:9505334"
FT                   /locus_tag="Closa_0086"
FT   CDS_pept        101197..101835
FT                   /locus_tag="Closa_0086"
FT                   /gene_family="HOG000115784" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /codon_start="1"
FT                   /product="flavin reductase domain protein FMN-binding
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: ere:EUBREC_1480 nitrilotriacetate monooxygenase
FT                   component B"
FT                   /db_xref="GI:302384530"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="GeneID:9505334"
FT                   /translation="MKKKETIENKNSLKSSRTAWKPGNMLYPVPAVMVSCQREGEAPNI
FT                   ITVAWAGTICSSPAMLSISIRPERHSYGIIKETGEFAVNLVTKDLVRAADYCGVKSGRE
FT                   VDKFKEMKLTPCFLEHIKAPGIEESPVSLACRVVEIKHLGSHDLFLAEVTGVSVNSRYL
FT                   DEKGKFRLNEAGLIAYSHGEYFELGKKLGSFGYSVKKAEKRPSGRRKNK"
FT                   /protein_id="YP_003820352.1"
FT   misc_feature    101269..101769
FT                   /note="Flavin Reductases; Region: FlaRed; cl00801"
FT                   /db_xref="CDD:154006"
FT                   /locus_tag="Closa_0086"
FT   gene            101832..102359
FT                   /db_xref="GeneID:9505335"
FT                   /locus_tag="Closa_0087"
FT   CDS_pept        101832..102359
FT                   /locus_tag="Closa_0087"
FT                   /gene_family="HOG000032568" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01202"
FT                   /codon_start="1"
FT                   /product="shikimate kinase"
FT                   /transl_table="11"
FT                   /note="PFAM: shikimate kinase; KEGG: ere:EUBREC_0460
FT                   shikimate kinase"
FT                   /db_xref="GI:302384531"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="GeneID:9505335"
FT                   /translation="MISKLDNITLIGMPASGKSTVGVLLAKRLGYSFVDVDIVIQEQEG
FT                   RLLKEIIAEEGQEGFMAVENRINAGLKAHHSVIAPGGSVIYGKEAMEHLKKISTVVYLK
FT                   LSYESIEERLGNLVDRGVVLKDGMTLRDLYEERVPYYEKYADIIMDENGLDAGKTVDML
FT                   RSIMEEKFGLTT"
FT                   /protein_id="YP_003820353.1"
FT   misc_feature    101850..102320
FT                   /note="shikimate kinase; Reviewed; Region: aroK; PRK00131"
FT                   /db_xref="CDD:166809"
FT                   /locus_tag="Closa_0087"
FT   misc_feature    101850..102293
FT                   /note="Shikimate kinase (SK) is the fifth enzyme in the
FT                   shikimate pathway, a seven-step biosynthetic pathway which
FT                   converts erythrose-4-phosphate to chorismic acid, found in
FT                   bacteria, fungi and plants. Chorismic acid is a important
FT                   intermediate in the...; Region: SK; cd00464"
FT                   /db_xref="CDD:30188"
FT                   /locus_tag="Closa_0087"
FT   misc_feature    order(101874..101891,102168..102170,102189..102191)
FT                   /note="ADP binding site; other site"
FT                   /db_xref="CDD:30188"
FT                   /locus_tag="Closa_0087"
FT   misc_feature    order(101886..101888,101934..101936,101940..101942)
FT                   /note="magnesium binding site; other site"
FT                   /db_xref="CDD:30188"
FT                   /locus_tag="Closa_0087"
FT   misc_feature    order(101940..101942,102012..102014,102021..102023,
FT                   102072..102080,102240..102242)
FT                   /note="putative shikimate binding site; other site"
FT                   /db_xref="CDD:30188"
FT                   /locus_tag="Closa_0087"
FT   gene            complement(102443..104122)
FT                   /db_xref="GeneID:9505336"
FT                   /locus_tag="Closa_0088"
FT   CDS_pept        complement(102443..104122)
FT                   /locus_tag="Closa_0088"
FT                   /gene_family="HOG000148074" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /codon_start="1"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /transl_table="11"
FT                   /note="KEGG: cbk:CLL_A2996 methyl-accepting chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="GI:302384532"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="GeneID:9505336"
FT                   /translation="MLKKRKVGNRLLVAFLIVVLFAGLAGTIGILLIRTVNEEYHAELQ
FT                   DYGFAQGDIGSLGQAFQAHRATVLYIIFSEDDAETAKQKENLTKQIDVINEKMQLVQAR
FT                   MKTASEKELYSQLTEKMKSYEDIRSHTIELASKSPQESMEFFRSYAAPLAAEIANTINT
FT                   MLSDKSTAGDIKSAHLSRQTSVFIAIMGAIIFISIVTSVMIAIAITRGITRPIDELKKV
FT                   ADRMAQGDLKCRLEYRSKDELGHLADSMRTMMERLSYYMDYISSTTSQMAQGNFHIPHD
FT                   PEEFKGEFRSVQISIQNLTDSLNDVMAKITQSSDQVASGAEQVASSAQALSHGATEQAS
FT                   SIEELAATINDISNNINQNAENAKETNQQVSNTAAELEFGKTQMQELTNAMADISSASS
FT                   EIGKVIKTIEDIAFQTNILALNAAVEAARAGEAGKGFAVVADEVRNLANKSQEASKNTA
FT                   ALIQRALASIESGNHIAKETATSMDRIVQSSKIAADLAYQISTASKDQAFAVAQVTQGI
FT                   DQISSVIQTNSATSEESAAASQEMAGQAQMLKLLMKKFQLKI"
FT                   /protein_id="YP_003820354.1"
FT   misc_feature    complement(103352..103489)
FT                   /note="Methyl-accepting protein, and Phosphatase (HAMP)
FT                   domain. HAMP is a signaling domain which occurs in a wide
FT                   variety of signaling proteins, many of which are bacterial.
FT                   The HAMP domain consists of two alpha helices connected by
FT                   an extended linker. The...; Region: HAMP; cd06225"
FT                   /db_xref="CDD:100122"
FT                   /locus_tag="Closa_0088"
FT   misc_feature    complement(order(103352..103357,103364..103369,
FT                   103373..103378,103385..103390,103394..103399,
FT                   103445..103447,103451..103456,103463..103468,
FT                   103472..103477,103484..103489))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:100122"
FT                   /locus_tag="Closa_0088"
FT   misc_feature    complement(102899..>103237)
FT                   /note="Methyl-accepting chemotaxis-like domains (chemotaxis
FT                   sensory transducer); Region: MA; smart00283"
FT                   /db_xref="CDD:128579"
FT                   /locus_tag="Closa_0088"
FT   misc_feature    complement(102542..103036)
FT                   /note="Taxis toward Aspartate and Related amino acids and
FT                   Homologs (TarH). The Tar chemoreceptor of Escherichia coli
FT                   mediates attractant responses to aspartate, maltose, and
FT                   phenol, repellent responses to Ni2+ and Co2+, and
FT                   thermoresponses.  These...; Region: TarH; cl00144"
FT                   /db_xref="CDD:153541"
FT                   /locus_tag="Closa_0088"
FT   gene            complement(104441..106408)
FT                   /db_xref="GeneID:9505337"
FT                   /locus_tag="Closa_0089"
FT   CDS_pept        complement(104441..106408)
FT                   /locus_tag="Closa_0089"
FT                   /gene_family="HOG000164296" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /codon_start="1"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /transl_table="11"
FT                   /note="KEGG: pca:Pcar_2967 methyl-accepting chemotaxis
FT                   protein (MCP); PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="GI:302384533"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="GeneID:9505337"
FT                   /translation="MKSIKTKILLSMAMTVFLSLCAVGGTSIYLNYSSMIGTMNQTMTE
FT                   LARTASQRVSKELDIYTNIAYEVGSISRLSSSETSVEDKKNIIDQRARTHGFQRGNILG
FT                   TDGVSIFDGKDYSDRDYFQKSMKGETVISDPLISKVTGQLTIIISAPLWDKGIPDSKVV
FT                   GVVYFVPTETFLNDIVANINISKGSSSYILNRNGAVIADVDMEKVTNGINIQDTAKTDP
FT                   GLAALAALEKGMTEGKSGFGRYNRGSVREFLAYAPIEGTDGWSFGLKAPMSDFMGATMT
FT                   GIVISSVLLIAALLVAGVISVVLAGKIGNPVTACAERLKRLVQGDLDSPVPEITAQDET
FT                   GILAGATRELVDGLKMIIGDVDHILNEMADGSLTASSACESAYVGGFGGILQSMTQLRT
FT                   RLSETLLKISHSSGEVASGAEQVSAGAQALSQGATEQASSVEELLATISLISSHVDQTA
FT                   KNAEEAKLQAKETSSHLESGKEQMGRMTDAMNEINQTSGEISKIIKAIEDIAFQTNILA
FT                   LNAAVEAARAGEAGKGFAVVADEVRNLASKSAEASRNTAILIESSAHSVQKGTDIAGET
FT                   ADSLDRIAASSEKMASLIYGIATASQEQADSIAQVAQGIDQISSVVQTNSATAEESAAT
FT                   SEELSGQAQILKGLMDQFRF"
FT                   /protein_id="YP_003820355.1"
FT   misc_feature    complement(105764..106015)
FT                   /note="Cache domain; Region: Cache_1; pfam02743"
FT                   /db_xref="CDD:145738"
FT                   /locus_tag="Closa_0089"
FT   misc_feature    complement(104447..105190)
FT                   /note="Methyl-accepting chemotaxis-like domains (chemotaxis
FT                   sensory transducer); Region: MA; smart00283"
FT                   /db_xref="CDD:128579"
FT                   /locus_tag="Closa_0089"
FT   misc_feature    complement(104447..105028)
FT                   /note="Taxis toward Aspartate and Related amino acids and
FT                   Homologs (TarH). The Tar chemoreceptor of Escherichia coli
FT                   mediates attractant responses to aspartate, maltose, and
FT                   phenol, repellent responses to Ni2+ and Co2+, and
FT                   thermoresponses.  These...; Region: TarH; cl00144"
FT                   /db_xref="CDD:153541"
FT                   /locus_tag="Closa_0089"
FT   gene            106765..108258
FT                   /db_xref="GeneID:9505338"
FT                   /locus_tag="Closa_0090"
FT   CDS_pept        106765..108258
FT                   /locus_tag="Closa_0090"
FT                   /gene_family="HOG000250995" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00826"
FT                   /codon_start="1"
FT                   /EC_number="2.7.1.69"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: PTS system, glucose-like IIB subunint;
FT                   KEGG: aat:D11S_1163 pts system maltose- and
FT                   glucose-specific eiicb component; PFAM: phosphotransferase
FT                   system EIIC; Phosphotransferase system EIIB/cysteine,
FT                   phosphorylation site"
FT                   /db_xref="GI:302384534"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011535"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="GeneID:9505338"
FT                   /translation="MFKQLQKLGKAFMLPIAILPAAGLLLGIGGALSNPNTVAAYPFLN
FT                   IFALQALFTVMSKAGEVVFGNLALIMCIGLAVGLAKKDKGTAGLAAAVAFLVMNASIGA
FT                   LLSVFNPDGSAIDTGVVGSIVIGCMVTYFHNRYRNIQLPAFLGFFGGSRFIPIISSFAA
FT                   IFVGTVFFLIWPPFQKLLISSGQTIAGMGVFGTFLYGFLMRLCGAVGLHHMIYPMFWYT
FT                   ELGGVATVGGQQIAGAQKIFFAQLADPDFTGMYTEGTRFFAGRFDTMIFGLPAACLAMY
FT                   HSVPVKRRKMVFGLFFSAALTSFLTGITEPIEFMFLFVAPWLYVVHAFLDGLSFAIADL
FT                   LSVRIGNTFSGGIIDFTLFGVLQGNAKTHWIYVVVVGVFWAALYYVLFRFLITKFNIPT
FT                   PGREEGEDDEINVETKGTIAETAVRVLAALGGKENIEDCDACITRLRVAVKDISKVDKD
FT                   AIKREGAAAVLEVKGGIQAIFGAKADLIKSKINEIIGED"
FT                   /product="PTS system, glucose-like IIB subunint"
FT                   /protein_id="YP_003820356.1"
FT   misc_feature    106768..108246
FT                   /note="PTS system, glucose-specific IIBC component; Region:
FT                   PTS-II-BC-glcB; TIGR02002"
FT                   /db_xref="CDD:162654"
FT                   /locus_tag="Closa_0090"
FT   misc_feature    106891..107991
FT                   /note="Phosphotransferase system, EIIC; Region: PTS_EIIC;
FT                   cl00557"
FT                   /db_xref="CDD:174284"
FT                   /locus_tag="Closa_0090"
FT   misc_feature    108022..108246
FT                   /note="PTS_IIB, PTS system, glucose/sucrose specific IIB
FT                   subunit. The bacterial phosphoenolpyruvate: sugar
FT                   phosphotransferase system (PTS) is a multi-protein system
FT                   involved in the regulation of a variety of metabolic and
FT                   transcriptional processes. This...; Region: PTS_IIB_glc;
FT                   cd00212"
FT                   /db_xref="CDD:29267"
FT                   /locus_tag="Closa_0090"
FT   misc_feature    108082..108102
FT                   /note="active site turn"
FT                   /db_xref="CDD:29267"
FT                   /locus_tag="Closa_0090"
FT   misc_feature    108085..108087
FT                   /note="phosphorylation site"
FT                   /db_xref="CDD:29267"
FT                   /locus_tag="Closa_0090"
FT   gene            108274..108921
FT                   /db_xref="GeneID:9505339"
FT                   /locus_tag="Closa_0091"
FT   CDS_pept        108274..108921
FT                   /locus_tag="Closa_0091"
FT                   /gene_family="HOG000236669" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PRIAM:5.1.3.9"
FT                   /codon_start="1"
FT                   /EC_number="5.1.3.9"
FT                   /transl_table="11"
FT                   /note="KEGG: str:Sterm_2436 N-acylglucosamine-6-phosphate
FT                   2-epimerase; PFAM: putative N-acetylmannosamine-6-phosphate
FT                   epimerase"
FT                   /db_xref="GI:302384535"
FT                   /db_xref="InterPro:IPR007260"
FT                   /db_xref="GeneID:9505339"
FT                   /translation="MNRGLIVSCQALPEEPLHSSFIMGRMAVAAKEGGAIGIRANSVED
FT                   IEEIKKNVDLPIIGIIKKVYAEGKPFITPTMTEVDALVRTGVDVIAVDATISQDVDFLL
FT                   KLHDKYPRQKFMADISTEEEGLRADEMGFDFVGLTLLGYTPQSQGLDKFQVLQSLIEKC
FT                   KHPVIAEGNFNTPEQAAQAIRLGAYAVVVGTAITRPQCITQRFAQAVSKVSE"
FT                   /product="N-acylglucosamine-6-phosphate 2-epimerase"
FT                   /protein_id="YP_003820357.1"
FT   misc_feature    108274..108909
FT                   /note="N-acetylmannosamine-6-phosphate 2-epimerase;
FT                   Provisional; Region: PRK01130"
FT                   /db_xref="CDD:167164"
FT                   /locus_tag="Closa_0091"
FT   misc_feature    108274..108891
FT                   /note="N-acetylmannosamine-6-phosphate epimerase (NanE)
FT                   converts N-acetylmannosamine-6-phosphate to
FT                   N-acetylglucosamine-6-phosphate. This reaction is part of
FT                   the pathway that allows the usage of sialic acid as a
FT                   carbohydrate source. Sialic acids are a family...; Region:
FT                   NanE; cd04729"
FT                   /db_xref="CDD:73391"
FT                   /locus_tag="Closa_0091"
FT   misc_feature    order(108295..108297,108301..108303,108388..108390,
FT                   108451..108453,108457..108459,108550..108552,
FT                   108625..108627,108688..108690,108700..108702,
FT                   108781..108789,108850..108852)
FT                   /note="putative active site cavity; other site"
FT                   /db_xref="CDD:73391"
FT                   /locus_tag="Closa_0091"
FT   gene            109093..109905
FT                   /db_xref="GeneID:9505340"
FT                   /locus_tag="Closa_0092"
FT   CDS_pept        109093..109905
FT                   /locus_tag="Closa_0092"
FT                   /gene_family="HOG000085981" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01380"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, RpiR family"
FT                   /transl_table="11"
FT                   /note="PFAM: sugar isomerase (SIS); helix-turn-helix
FT                   protein RpiR; KEGG: lin:lin2927 hypothetical protein"
FT                   /db_xref="GI:302384536"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="GeneID:9505340"
FT                   /translation="MDILTSIQKEYQTFTDKERSIADYILQEGNNIRNMNISVLAATVG
FT                   VSDGTITRFCKKIGSASFAELKIQLGSAGAGNKIAHSNDLVTEVYDFYKTVIENSNKMM
FT                   DMNALGNLADQIVQAGNIYVFGVGSSGLTADEFMLRLSRMGFHVQSVTDSHLMLIYSSI
FT                   LGAGDLIIAISISGETAEVANSVRVAKQNGAKAICLTSFTNSTIAQCSDFCFPVVNPLF
FT                   VDQERFVNSQLSALYVIDLLCLVLLKDESRKKKMNITVETIIKQSHLK"
FT                   /protein_id="YP_003820358.1"
FT   misc_feature    109093..109419
FT                   /note="Helix-turn-helix domain, rpiR family; Region: HTH_6;
FT                   pfam01418"
FT                   /db_xref="CDD:110422"
FT                   /locus_tag="Closa_0092"
FT   misc_feature    109411..109797
FT                   /note="RpiR-like protein. RpiR contains a SIS (Sugar
FT                   ISomerase) domain, which is found in many phosphosugar
FT                   isomerases and phosphosugar binding proteins. In E. coli,
FT                   rpiR negatively regulates the expression of rpiB gene. Both
FT                   rpiB and rpiA are ribose...; Region: SIS_RpiR; cd05013"
FT                   /db_xref="CDD:88408"
FT                   /locus_tag="Closa_0092"
FT   misc_feature    order(109480..109482,109612..109614)
FT                   /note="putative active site; other site"
FT                   /db_xref="CDD:88408"
FT                   /locus_tag="Closa_0092"
FT   gene            109953..110102
FT                   /db_xref="GeneID:9505341"
FT                   /locus_tag="Closa_0093"
FT   CDS_pept        109953..110102
FT                   /locus_tag="Closa_0093"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:302384537"
FT                   /db_xref="GeneID:9505341"
FT                   /translation="MPRSAENSVFLRCFVFSVQCLAEQNIALHIDTGGKKEYNQSNYEF
FT                   DSYI"
FT                   /protein_id="YP_003820359.1"
FT   gene            110120..110875
FT                   /db_xref="GeneID:9505342"
FT                   /locus_tag="Closa_0094"
FT   CDS_pept        110120..110875
FT                   /locus_tag="Closa_0094"
FT                   /gene_family="HOG000107041" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01614"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, IclR family"
FT                   /transl_table="11"
FT                   /note="KEGG: amt:Amet_1260 transcriptional regulator
FT                   IclR-like protein; PFAM: Transcriptional regulator IclR ;
FT                   regulatory protein IclR; SMART: regulatory protein IclR"
FT                   /db_xref="GI:302384538"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="GeneID:9505342"
FT                   /translation="MNRTVERTFMILQLIADRKRGITLQEITNEMGMAKSSVFVIVQSL
FT                   LELNYITTLRENDKKYCLGIETFSLGMKYVDDMSLIKECTVNLQPIAEKYNKTAFVAVL
FT                   NGTKIVYVHKYVAQNARLASCAIGTRKDAYATSLGKAILAFLSKEEQSAILDKIDFKPL
FT                   TDYTITSKEQLLEELRRTKERGYSLDQRELEDITSCCGAPVFDYTGKVVAAVSLSDIYD
FT                   ETLDDEQVAKELKEAALHISKNLGYHPNP"
FT                   /protein_id="YP_003820360.1"
FT   misc_feature    110123..110398
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Closa_0094"
FT   misc_feature    110126..110860
FT                   /note="Transcriptional regulator [Transcription]; Region:
FT                   IclR; COG1414"
FT                   /db_xref="CDD:31604"
FT                   /locus_tag="Closa_0094"
FT   misc_feature    110495..110848
FT                   /note="Bacterial transcriptional regulator; Region: IclR;
FT                   pfam01614"
FT                   /db_xref="CDD:144993"
FT                   /locus_tag="Closa_0094"
FT   gene            111203..111781
FT                   /db_xref="GeneID:9505343"
FT                   /locus_tag="Closa_0095"
FT   CDS_pept        111203..111781
FT                   /locus_tag="Closa_0095"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: bfo:BRAFLDRAFT_95076 hypothetical protein"
FT                   /db_xref="GI:302384539"
FT                   /db_xref="GeneID:9505343"
FT                   /translation="MNKTKELFLFPYLDLLFFSILAAVSEIMSYETLKFWNSSFYFSFS
FT                   MALCLISMIRWGATGVVVAMIGGIPGILFSDMPLWSGILFYVLSNAFVGIPMLVYGDRN
FT                   RDKIADGHVFLLLYILLSHCSLSAGKGVMIFLLTGETTGAKDYFGATFFTLMINIIVCC
FT                   VLQMRKGLICDMRYYFTEMEGEGNGNGRD"
FT                   /protein_id="YP_003820361.1"
FT   gene            111762..112727
FT                   /db_xref="GeneID:9505344"
FT                   /locus_tag="Closa_0096"
FT   CDS_pept        111762..112727
FT                   /locus_tag="Closa_0096"
FT                   /gene_family="HOG000047980" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cpy:Cphy_0485
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:302384540"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9505344"
FT                   /translation="METEEIKMREPQTKKIWKALRKDWRLYVLLLPLVIWFAMWAYKPM
FT                   GGLLIAFKRFDPQFGVWGSEFKGIDNFINLVSGVNKVEFWQAFRNTFIISAYSLIFGFP
FT                   VPIILALLFAEIGNDTVRKLTQTATYLPHFLSEVTITGIALMLVYSGVRSTGIIASLLQ
FT                   QIGLIEPGVSIMQKSNYFRPLYIMVGIWKESGYNSIVYFAAIMGISPTLYEALKVDGGN
FT                   KFQEIRFITFPGMAPTLIIMIIMRIGSMLTIGYERVLLLYNANIYVTADVLSTFEQRIG
FT                   ILSGNYGIGAAVSLFNSLIAFALVIGANTISRNISETSLW"
FT                   /protein_id="YP_003820362.1"
FT   misc_feature    111777..112724
FT                   /note="ABC-type polysaccharide transport system, permease
FT                   component [Carbohydrate transport and metabolism]; Region:
FT                   LplB; COG4209"
FT                   /db_xref="CDD:33938"
FT                   /locus_tag="Closa_0096"
FT   misc_feature    111822..112679
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cl00427"
FT                   /db_xref="CDD:174197"
FT                   /locus_tag="Closa_0096"
FT   gene            112746..113609
FT                   /db_xref="GeneID:9505345"
FT                   /locus_tag="Closa_0097"
FT   CDS_pept        112746..113609
FT                   /locus_tag="Closa_0097"
FT                   /gene_family="HOG000220527" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /codon_start="1"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /transl_table="11"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cpy:Cphy_0486
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="GI:302384541"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="GeneID:9505345"
FT                   /translation="MERLNRSEKIFKVFSYTMIIIFALLALYPVLYAFSVSISGKVAYE
FT                   SGQIVLLPKEVTFQAYDMVLHNKGFWIAYTNTLFYTVLGTAWSMAISITGAYALQKTKL
FT                   MFRRQWNFLLVFTMWFSAGMIPLYLNYKTMHVDNRWGMIIAFGVQAYNIILLRNYFSSI
FT                   PKEIEEAAIMDGANEFQMLGKVYIPMSTASIATVTLFYAISRWNGYYWSRMLLANPYEQ
FT                   PLQVYLRQLIENYQKLYDESPVNLAYSADSLAYAIIICSIIPVLVIYPYIQKYFAKGVN
FT                   MGGVKG"
FT                   /protein_id="YP_003820363.1"
FT   misc_feature    112971..113414
FT                   /note="Transmembrane subunit (TM) found in Periplasmic
FT                   Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters which generally bind type 2 PBPs. These types
FT                   of transporters consist of a PBP, two TMs, and two
FT                   cytoplasmic ABC ATPase subunits...; Region: TM_PBP2;
FT                   cd06261"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Closa_0097"
FT   misc_feature    order(113013..113018,113025..113030,113043..113045,
FT                   113073..113084,113085..113090,113097..113102,
FT                   113106..113108,113181..113186,113190..113192,
FT                   113196..113198,113205..113210,113214..113216,
FT                   113226..113231,113238..113240,113289..113291,
FT                   113331..113336,113343..113345,113364..113375,
FT                   113382..113387)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Closa_0097"
FT   misc_feature    order(113085..113108,113364..113381)
FT                   /note="conserved gate region; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Closa_0097"
FT   misc_feature    order(113106..113108,113166..113168,113382..113384)
FT                   /note="putative PBP binding loops; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Closa_0097"
FT   misc_feature    order(113241..113279,113295..113300,113310..113312)
FT                   /note="ABC-ATPase subunit interface; other site"
FT                   /db_xref="CDD:119394"
FT                   /locus_tag="Closa_0097"
FT   gene            113646..115748
FT                   /db_xref="GeneID:9505346"
FT                   /locus_tag="Closa_0098"
FT   CDS_pept        113646..115748
FT                   /locus_tag="Closa_0098"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cpy:Cphy_0487 extracellular solute-binding
FT                   protein"
FT                   /db_xref="GI:302384542"
FT                   /db_xref="GeneID:9505346"
FT                   /translation="MRNKVAGGILCAAILASALTGCGTSVVDQASTRAAAETQQETSEA
FT                   AGDKTDLTETVELKFNVANGNKSRTMTYNQESPLTLPDGSVVTAGMLKPMWSYMEKELN
FT                   SKFSDVTVQDVKASDMIQTESTSNFSGANIFGGESIAERLMFYGTEGKFVNLTEMMKTG
FT                   YMPNFKEYLSKNPDVKTAITAYDGNIYHVPYIAELNQIARTFVIRESWVTGLLDAKDAV
FT                   YDKNPFDVHYQGFYVDNNRRTGENGGTVTPKEGIDIVKKTDQDIIEIQNALEVKNGETL
FT                   TRALIQYIKDNYDYSSPSELFLGEKAAYDMDEMIALMRCIKANPALLTKGKADVVWPLF
FT                   VRQSNYREDLLRLSTYFDGVKVHGADSYTARWYIDENGHIQYSYSEEGVYRVLQYLSMM
FT                   EAEGLIYSDAYDLTEKTNYRSTLWGTDDGEAPSFGFMTYDWIASSTSDSLNPDTVVILP
FT                   PVAKVNGAWQYYLDNGRAIKPDGWAISVAGSTEDQIHRACAVMDYLFTKEGSRLQNYGL
FT                   PMNLEEGKDYTGPDGLKYPLFTSWVYETSGKVAKGDLSTFLRDWMGCLIPIGYQKEIGF
FT                   EYQYTSERGFEGWALLQNSTTNFATYAGKGISGDNPNYYKMVPPFFSLTSRQKEMISDT
FT                   TSLDTEDIVEFMFNIIRYQAKGNAPQGAVVAKSYEEYAAEFKKRGLDIYEETYQAAYDV
FT                   MTLGKQ"
FT                   /protein_id="YP_003820364.1"
FT   gene            115802..116350
FT                   /db_xref="GeneID:9505347"
FT                   /locus_tag="Closa_0099"
FT   CDS_pept        115802..116350
FT                   /locus_tag="Closa_0099"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: mmp:MMP0529 sulfate transporter family
FT                   protein"
FT                   /db_xref="GI:302384543"
FT                   /db_xref="GeneID:9505347"
FT                   /translation="MQKYFKTQKLAAGIYTGTVILVFIYTLCFMTEYKDLFGLKLTQND
FT                   QISFFHDYILQIFNKQIFAFAVFGVLVILLSFLLEIFGKIPDKFALIIMGLSLLICCAC
FT                   SAYALFNLQAIESYYAGLDFQYLRLESAGDYKPHFATFRIGLGIYMTYILCCAFYIVAI
FT                   GRSHFKFQKNQKKRSTRNG"
FT                   /protein_id="YP_003820365.1"
FT   gene            116343..116792
FT                   /db_xref="GeneID:9505348"
FT                   /locus_tag="Closa_0100"
FT   CDS_pept        116343..116792
FT                   /locus_tag="Closa_0100"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cpc:Cpar_1339 zinc transporter ZupT"
FT                   /db_xref="GI:302384544"
FT                   /db_xref="GeneID:9505348"
FT                   /translation="MDNRLLEKEKKAYVSLYKKDVLPYSLILCAILAELIYNIMVLDVM
FT                   PVSYLMGATVMINIVILFVLFTCAVKVNIYHKIWAVIAVFLGIYMLVRMSVLVPLVLKP
FT                   YARHTEIMAANLLGGVMLLAAGFISLKHANRRQRLQEQLQQSEAS"
FT                   /protein_id="YP_003820366.1"
FT   gene            116808..117911
FT                   /db_xref="GeneID:9505349"
FT                   /locus_tag="Closa_0101"
FT   CDS_pept        116808..117911
FT                   /locus_tag="Closa_0101"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pmu:PM1763 hypothetical protein; PFAM: ABC
FT                   transporter related; Transport-associated OB domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="GI:302384545"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9505349"
FT                   /translation="MGKLLFKNISKAYPNGFCAVNNFNLEIQDGEFIVLVGPSGCGKST
FT                   LLRMIAGLEKISDGDLVLDDKVINKCPPVERDIAVVFQDYALYGNMSVYDNVGMSLRVR
FT                   HEKDTVIYDKVKEASGILGIGSLLKRLPGQLSGGQKQRVALARSVVRKPKVFLMDEPLS
FT                   NLDAKLRTSTRAEIVRLQRELKVTTVYVTHDQTEAMTMADRMVVLKDGIIQQAGTPNEI
FT                   YYEPCNLFVAGFIGAPQMNFIEGRVEGSRFVFGSHALFLPQKIADPLKQYSGRELILGI
FT                   RPEQFSISNGEDINVIAGELENKEFLGNCYILYVRIGESVLACQIESKEDSFGGQVNIR
FT                   FGMEHIYFYDKETTELLMHARAGENDE"
FT                   /protein_id="YP_003820367.1"
FT   misc_feature    116808..117866
FT                   /note="glycerol-3-phosphate transporter ATP-binding
FT                   subunit; Provisional; Region: ugpC; PRK11650"
FT                   /db_xref="CDD:171228"
FT                   /locus_tag="Closa_0101"
FT   misc_feature    116817..117458
FT                   /note="The N-terminal ATPase domain of the maltose
FT                   transporter, MalK.  ATP binding cassette (ABC) proteins
FT                   function from bacteria to human, mediating the
FT                   translocation of substances into and out of cells or
FT                   organelles.  ABC transporters contain two...; Region:
FT                   ABC_MalK_N; cd03301"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="Closa_0101"
FT   misc_feature    116916..116939
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="Closa_0101"
FT   misc_feature    order(116925..116930,116934..116942,117054..117056,
FT                   117282..117287,117384..117386)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="Closa_0101"
FT   misc_feature    117045..117056
FT                   /note="Q-loop/lid; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="Closa_0101"
FT   misc_feature    117210..117239
FT                   /note="ABC transporter signature motif; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="Closa_0101"
FT   misc_feature    117270..117287
FT                   /note="Walker B; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="Closa_0101"
FT   misc_feature    117294..117305
FT                   /note="D-loop; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="Closa_0101"
FT   misc_feature    117372..117392
FT                   /note="H-loop/switch region; other site"
FT                   /db_xref="CDD:73060"
FT                   /locus_tag="Closa_0101"
FT   misc_feature    117642..117845
FT                   /note="TOBE domain; Region: TOBE_2; cl01440"
FT                   /db_xref="CDD:163979"
FT                   /locus_tag="Closa_0101"
FT   gene            117904..118305
FT                   /db_xref="GeneID:9505350"
FT                   /locus_tag="Closa_0102"
FT   CDS_pept        117904..118305
FT                   /locus_tag="Closa_0102"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: fpl:Ferp_2490 Na+/solute symporter"
FT                   /db_xref="GI:302384546"
FT                   /db_xref="GeneID:9505350"
FT                   /translation="MSKQLTGIAKAMIMISSVVHLIFTNIHVKALLLLEHEMCGFVMFL
FT                   FVLMGLVAFFETTRIKNKETAERIFTALVCFVTAGLGSYLVMIYRDAISVQRSLNVGVV
FT                   NRAVVFSMAILLAYVISGLLLIADLIKNR"
FT                   /protein_id="YP_003820368.1"
FT   gene            118313..118825
FT                   /db_xref="GeneID:9505351"
FT                   /locus_tag="Closa_0103"
FT   CDS_pept        118313..118825
FT                   /locus_tag="Closa_0103"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cpb:Cphamn1_1120 Na+/solute symporter"
FT                   /db_xref="GI:302384547"
FT                   /db_xref="GeneID:9505351"
FT                   /translation="MTDRERKYGRKKISDNVKAGIFRWWIAGMCYFFVGFGTQSGVFAD
FT                   PLDMIFFLGLGLGLATLFLYNPVAYRMFDIVRKGRIYNQSYFERSGWQNAVLKLAEILK
FT                   NMVLAFLIYMTYQSVNLLLERLLHLPEGTVTIPGEPIGFAVIYTIYYYLLTGLMDTVAE
FT                   MRNKEEK"
FT                   /protein_id="YP_003820369.1"
FT   gene            118830..120806
FT                   /db_xref="GeneID:9505352"
FT                   /locus_tag="Closa_0104"
FT   CDS_pept        118830..120806
FT                   /locus_tag="Closa_0104"
FT                   /gene_family="HOG000147891" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:SCO3500"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: sco:SCO3500 hypothetical protein"
FT                   /db_xref="GI:302384548"
FT                   /db_xref="GeneID:9505352"
FT                   /translation="MSNLVFIGDLGPYKEQIRGVRKKQYQRLLQQADRYEAYQLPEHHP
FT                   KESTTYLGVAIMNLALAYSLSGEDKYLFQAKRFMGAVLSYEQWGNAHLVNVDLSASWIL
FT                   FGLSLGYDWLKPFLGEEEKEKILAKIRHHADLMYQYKLDTYGHGWSTSYYQNHNWINMT
FT                   GLAAAGYALSESYDKAVQYTEEAKKNFGRVFSLLADDGSNYEGVPYWRYGGMWLFVYAH
FT                   LLKVQEGLDYFQTSNYLKNTFYYRLYQSCGDLEQQMNFGDSHDRHSGHAPCVYYKAAAE
FT                   YGDGFAQTFANLVLDEFLMAEAEKSKIKPGILPEAAFEFLWYDPQVTEKPLSLLPKVRY
FT                   FEDLGLLSIREDWSRRSKVLTIKCGCPGGRKQWMNGWNLYRREGLDCLSLSHHHSDNLS
FT                   YIFARGSEYLTCEDGYNRNLMPDNHNVILVDNQYTDAENVNDIYMSSAQKRLEKDPFYP
FT                   MEEKYRGDVVFLELDDTMVIYKGETSGIYPEALGMKEVSRLLFTDQLFFFLFVDVCVSD
FT                   RDHIYRIISNTDMPAQKQNDHTYYYPMETGGITYTVFSDQEISSDQYTQEIVSVMTSQE
FT                   PDKLCRTFINTLSFQSAAPTKKQTLIQCFTFDGMNTEITFKGENLHIRHGDKDYQLIFG
FT                   NEMNVTIIEVCSNSGERKSYRVP"
FT                   /protein_id="YP_003820370.1"
FT   gene            120832..122736
FT                   /db_xref="GeneID:9505353"
FT                   /locus_tag="Closa_0105"
FT   CDS_pept        120832..122736
FT                   /locus_tag="Closa_0105"
FT                   /gene_family="HOG000027392" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07940"
FT                   /codon_start="1"
FT                   /product="Heparinase II/III family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Heparinase II/III family protein; KEGG:
FT                   cpy:Cphy_0489 heparinase II/III family protein"
FT                   /db_xref="GI:302384549"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="GeneID:9505353"
FT                   /translation="MKYVNERFYERMNGEARNRELIQEMKREVDEFLPDFSDSPDRLSR
FT                   WGHCYFCDDDGGRLIFDINSPDRHRCEVCKKVYESEILDGVWVYFYRNKAVIMALVSAF
FT                   VYKATKEKKYFDYSVSVMEYYAHHYKEFLLHNKENLTADSYDEMPWGCGRMMPQGLNES
FT                   IVAIRFIQTIEILRDELSPEFLDLVYHNMFREMYFLLAPQATRIHNISCWNLSAIGVMG
FT                   LAFQDQEMIDFAFTSEYNIRKQLETGVTKDFFWYEGSIHYNFFLLEGITYLLLFSKVYG
FT                   YDFGETGTEILQNMFVQAYNYAFDNQFLPNPNDGWPNLNLRTFSYIYHTAARAMGEDSP
FT                   IGNLVKNIEASGSVRTPLPLSEPYYCKNSVCLEQLLFNIDFDYEQFTPVKQQSNNFPES
FT                   NFVILRYDKWNGFMKYGLNGKSHAHPDIMNVELMYGNHRISRDLSNAGYRSRLCNEWHR
FT                   KTLSHNTVCWNGMDITSVSPGECLFFDKNKVTAAARDVYDGIHYTRTIQISGNTFTDDF
FT                   LVESGRNGTFDYVFHLESALHLEYDLDLEDGNLGFEKNGYQHILETKRVKTKENHVVLR
FT                   AGAEDVMWSIWIDLTGGHQLYLLKTLDNPVNQRRNTILLRNTGTSPHYHLKIMAEDKQ"
FT                   /protein_id="YP_003820371.1"
FT   misc_feature    122023..122370
FT                   /note="Heparinase II/III-like protein; Region:
FT                   Hepar_II_III; cl02215"
FT                   /db_xref="CDD:154804"
FT                   /locus_tag="Closa_0105"
FT   gene            122763..123497
FT                   /db_xref="GeneID:9505354"
FT                   /locus_tag="Closa_0106"
FT   CDS_pept        122763..123497
FT                   /locus_tag="Closa_0106"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /codon_start="1"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /transl_table="11"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   gfo:GFO_1160 short-chain dehydrogenase/reductase family
FT                   protein"
FT                   /db_xref="GI:302384550"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="GeneID:9505354"
FT                   /translation="MRAVITGGTSGIGLSAAIELGKAGYDIIITGISQEDGKSALETLK
FT                   SHGINSEFIYADSMNEEDVNRCFEKISQTYDSLDVLVNNVGGLGGRQRFEEMETSFMRK
FT                   VMALNFDSAFYASRAAIPLLKKGNHPSIINYSTIAVTSGGGPGAGIYAASKAAIEGLTR
FT                   ALAKDLADYGIRVNAVSPGTIDTAFHSATKREILESWKEGILMKRLGEPSEVAAVIGFL
FT                   VSEKASFITGEIIQINGGQVFI"
FT                   /protein_id="YP_003820372.1"
FT   misc_feature    122766..123485
FT                   /note="3-ketoacyl-(acyl-carrier-protein) reductase;
FT                   Validated; Region: fabG; PRK05653"
FT                   /db_xref="CDD:168154"
FT                   /locus_tag="Closa_0106"
FT   misc_feature    122769..123482
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="Closa_0106"
FT   gene            123521..123850
FT                   /db_xref="GeneID:9505355"
FT                   /locus_tag="Closa_0107"
FT   CDS_pept        123521..123850
FT                   /locus_tag="Closa_0107"
FT                   /gene_family="HOG000027068" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /codon_start="1"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   amt:Amet_3782 cupin 2 domain-containing protein"
FT                   /db_xref="GI:302384551"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="GeneID:9505355"
FT                   /translation="MVLKYEDIIPGNPEPGITRRILARGGSLMGVEASFIKGAVGSIHK
FT                   HPHEQVSYIVSGSFQYEADGVKYILKAGDSYYVEPESLHGATALEDSVILDIFTPQRED
FT                   FIGEK"
FT                   /protein_id="YP_003820373.1"
FT   misc_feature    <123593..123820
FT                   /note="Cupin domain; Region: Cupin_2; cl09118"
FT                   /db_xref="CDD:175009"
FT                   /locus_tag="Closa_0107"
FT   gene            124160..124948
FT                   /db_xref="GeneID:9505356"
FT                   /locus_tag="Closa_0108"
FT   CDS_pept        124160..124948
FT                   /locus_tag="Closa_0108"
FT                   /gene_family="HOG000027416" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF02522"
FT                   /codon_start="1"
FT                   /product="aminoglycoside 3-N-acetyltransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: aminoglycoside 3-N-acetyltransferase; KEGG:
FT                   eel:EUBELI_20580 aminoglycoside N3-acetyltransferase"
FT                   /db_xref="GI:302384552"
FT                   /db_xref="InterPro:IPR003679"
FT                   /db_xref="GeneID:9505356"
FT                   /translation="MFTKQNLKQNLKEMGIMPHDTLLLHSSMKAIGEVEGGADTVLDAF
FT                   MEYMSDGLLILPTHTWAAMSEYHNVYDPRIEPACVGILPNLFMKRKGVLRSLHPTHSVA
FT                   VYGKDGKAFIEGEEHRTTPCPPGGCYDRLKDRNGKILLLGVGHERNTFIHCVEEHLEVP
FT                   ERLTKEPTYFKIVMPGNQIKPSFMHCHENPVTDHISENYTKLEQAFYDRKAAVKATFGD
FT                   AACILCDANGVYEVTKDVLSHQINCLIELETIPKEWWRKE"
FT                   /protein_id="YP_003820374.1"
FT   misc_feature    124226..124888
FT                   /note="Aminoglycoside 3-N-acetyltransferase; Region:
FT                   Antibiotic_NAT; cl01051"
FT                   /db_xref="CDD:154168"
FT                   /locus_tag="Closa_0108"
FT   gene            125170..125679
FT                   /db_xref="GeneID:9505357"
FT                   /locus_tag="Closa_0109"
FT   CDS_pept        125170..125679
FT                   /locus_tag="Closa_0109"
FT                   /gene_family="HOG000268923" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06177"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF988"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF988; KEGG:
FT                   eel:EUBELI_01901 hypothetical protein"
FT                   /db_xref="GI:302384553"
FT                   /db_xref="InterPro:IPR010387"
FT                   /db_xref="GeneID:9505357"
FT                   /translation="MHYKTSERTYFMVFSAAIAAVYTVLTVIFAPVSFGPIQFRISEIL
FT                   CILPFFTPAAIPGLFIGCFLSNLLCGAATLDVVFGSLATLLGAIGSYKLRKSRWLVCVP
FT                   PILANTIIIPWVLRYAYGSEDMIWYAMITVGIGEILVIGILGNILIGVLNNYRHIIFGR
FT                   FLSDKE"
FT                   /protein_id="YP_003820375.1"
FT   misc_feature    125203..>125535
FT                   /note="QueT transporter; Region: QueT; cl01932"
FT                   /db_xref="CDD:154659"
FT                   /locus_tag="Closa_0109"
FT   gene            126051..126935
FT                   /db_xref="GeneID:9505358"
FT                   /locus_tag="Closa_0110"
FT   CDS_pept        126051..126935
FT                   /locus_tag="Closa_0110"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: msl:Msil_2716 glycosyl transferase group 1"
FT                   /db_xref="GI:302384554"
FT                   /db_xref="GeneID:9505358"
FT                   /translation="MAKGRMSVVRGTDRYITLAVDECDACGIKGIMFHCDDPQGIQYGS
FT                   TLEMILNMDRIFDSMSGPKQTFQMRHFPGTNPVDFETRTSDEEVRKGKLSTFRIYVQYR
FT                   YHASWQGLIQWEEGERQELFESTLQLILIMSRMLKGDFQAGQEGEALSFFHVAIDSYDY
FT                   GRIVGNYQSIPAVLTEQYDVPADLAGTLGNFMEAKALKEKYSAYGLNYGRLVSNEICSI
FT                   CRKSGQKATFTIKIMFCDHSTWQGIIHWREGRAEQTFRSFKEMLYLIVSVVGATTAGAE
FT                   SYEDEVSTIALGL"
FT                   /protein_id="YP_003820376.1"
FT   gene            127130..128509
FT                   /db_xref="GeneID:9505359"
FT                   /locus_tag="Closa_0111"
FT   CDS_pept        127130..128509
FT                   /locus_tag="Closa_0111"
FT                   /gene_family="HOG000256031" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01082"
FT                   /codon_start="1"
FT                   /product="UDP-N-acetylmuramate/alanine ligase"
FT                   /transl_table="11"
FT                   /note="KEGG: eel:EUBELI_01919 UDP-N-acetylmuramate--alanine
FT                   ligase; TIGRFAM: UDP-N-acetylmuramate/alanine ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein"
FT                   /db_xref="GI:302384555"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="GeneID:9505359"
FT                   /translation="MYQIHFHKPEAIHFIGIGGISMSGLAEILIDEGFTVTGSDSHESE
FT                   LTRHLEAKGAAIAYGQRAENIKEGIDVVVYTAAVHPDNPEYAEAKEKGLPILSRAELLG
FT                   QMMKNYENSIAVSGTHGKTTTTSMITEILLAAEADPTISVGGILNSIGGNIRVGGPGLF
FT                   VTEACEYTNSFLSFFPTMEVILNIEADHLDFFKDIKDIRHSFRLFAEKLPPNGSLVINN
FT                   DIESREEITEGLPCQVITYGKKPGSRYQAEAIRFDEYARATYDLKLDGNVVDTVTLGVP
FT                   GEHNVYNSLAAAAVCTELGIEFDLIKKGLKRFTGTNRRFEKKGELSGVTIIDDYAHHPQ
FT                   EIRATLETAKHYPHNKLWVAFQPHTYTRTKAFLEEFADALSLADEVILADIYAARETDD
FT                   LGISSGDIAERIGKRGVKAHYFSSFDEIETFILENCIHGDLLITMGAGDIVKVGEKLLG
FT                   L"
FT                   /protein_id="YP_003820377.1"
FT   misc_feature    127145..128506
FT                   /note="UDP-N-acetylmuramate--L-alanine ligase; Provisional;
FT                   Region: murC; PRK00421"
FT                   /db_xref="CDD:166954"
FT                   /locus_tag="Closa_0111"
FT   misc_feature    127163..127459
FT                   /note="Mur ligase family, catalytic domain; Region:
FT                   Mur_ligase; pfam01225"
FT                   /db_xref="CDD:144716"
FT                   /locus_tag="Closa_0111"
FT   misc_feature    127475..128017
FT                   /note="Mur ligase middle domain; Region: Mur_ligase_M;
FT                   pfam08245"
FT                   /db_xref="CDD:149357"
FT                   /locus_tag="Closa_0111"
FT   misc_feature    128081..128335
FT                   /note="Mur ligase family, glutamate ligase domain; Region:
FT                   Mur_ligase_C; pfam02875"
FT                   /db_xref="CDD:145824"
FT                   /locus_tag="Closa_0111"
FT   gene            128925..129962
FT                   /db_xref="GeneID:9505360"
FT                   /locus_tag="Closa_0112"
FT   CDS_pept        128925..129962
FT                   /locus_tag="Closa_0112"
FT                   /gene_family="HOG000027618" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01446"
FT                   /codon_start="1"
FT                   /product="primosome, DnaD subunit"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: primosome, DnaD subunit; KEGG:
FT                   eel:EUBELI_01920 hypothetical protein"
FT                   /db_xref="GI:302384556"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="GeneID:9505360"
FT                   /translation="MKIKSSFKISATVISNEFIDEYMAAANGEYIKEYIYLMRHEGEEI
FT                   TVSMIADALNHTEADVTRALSYWKNAGVLKESVPLKQTESPAVSETACSGIGREEQKKP
FT                   EAGGRRMVYPPEKISGLAGDEDFSQLLYIAQKYMNKVFTQRECEVFAYLYDGLHMSAEL
FT                   LEFVVEYCVQGGHSSIRYIETVAISWHEKGFRTVEDAKSYALTFTKDSFAVMKAFGLND
FT                   RKPGDMERDLIERWFRNYGFTRDLVVEACNRTLAATHTPSFQYADKILEGWKKSGVRSM
FT                   EEVRKLDEQYAGRMKSGDNKAGKSGEYKQTQAPKGRRGQNQFQNFPQREIDYDALVLRQ
FT                   LTEQK"
FT                   /protein_id="YP_003820378.1"
FT   misc_feature    129312..129536
FT                   /note="Replication initiation and membrane attachment
FT                   protein (DnaB); Region: DnaB_2; cl12121"
FT                   /db_xref="CDD:159781"
FT                   /locus_tag="Closa_0112"
FT   misc_feature    129591..129794
FT                   /note="Replication initiation and membrane attachment
FT                   protein (DnaB); Region: DnaB_2; cl12121"
FT                   /db_xref="CDD:159781"
FT                   /locus_tag="Closa_0112"
FT   gene            130018..131013
FT                   /db_xref="GeneID:9505361"
FT                   /locus_tag="Closa_0113"
FT   CDS_pept        130018..131013
FT                   /locus_tag="Closa_0113"
FT                   /gene_family="HOG000054734" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /codon_start="1"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ere:EUBREC_0448 hypothetical protein; PFAM:
FT                   IstB domain protein ATP-binding protein; SMART: AAA ATPase"
FT                   /db_xref="GI:302384557"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="GeneID:9505361"
FT                   /translation="MALSNSQYDAIMRAYGQQQFKNRHEQEKRIEEVYRKIPVIKELDD
FT                   FISTSAVASARRLLEGDRGALKDLRNEIADLREQKGVLLKAAGFSADYMEMRYRCQDCK
FT                   DTGYSDGTKCHCFRQFEMKYLYAQSNIEQIIAVENFNNFSYEYFDHTRVVPVLNRTVRQ
FT                   YMEQVVETCQCFVRGFSAEHGNLLFTGPTGVGKTFLTNCIAKELIDRYYSVIYLSANDL
FT                   FEVFSKNRFDYQDEEDMKGMYQYILDCDLLIIDDLGTELNNSFTSSELFYCINERLNSS
FT                   KSTIISTNHPINELRDRYTERVTSRLISRYTVIPLYGDDIRIRKKEKRVN"
FT                   /protein_id="YP_003820379.1"
FT   misc_feature    130024..130995
FT                   /note="DNA replication protein DnaC; Validated; Region:
FT                   PRK06835"
FT                   /db_xref="CDD:168695"
FT                   /locus_tag="Closa_0113"
FT   misc_feature    130555..>130743
FT                   /note="The AAA+ (ATPases Associated with a wide variety of
FT                   cellular Activities) superfamily represents an ancient
FT                   group of ATPases belonging to the ASCE (for additional
FT                   strand, catalytic E) division of the P-loop NTPase fold.
FT                   The ASCE division also includes...; Region: AAA; cd00009"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Closa_0113"
FT   misc_feature    130585..130608
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Closa_0113"
FT   misc_feature    130588..130611
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:99707"
FT                   /locus_tag="Closa_0113"
FT   gene            complement(131094..132767)
FT                   /db_xref="GeneID:9505362"
FT                   /locus_tag="Closa_0114"
FT   CDS_pept        complement(131094..132767)
FT                   /locus_tag="Closa_0114"
FT                   /gene_family="HOG000292557" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /codon_start="1"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /transl_table="11"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: cpy:Cphy_2817 peptidase S8/S53 subtilisin
FT                   kexin sedolisin"
FT                   /db_xref="GI:302384558"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR017310"
FT                   /db_xref="GeneID:9505362"
FT                   /translation="MSKILDNNYYDLIISNTLAPSYDTGDNITYLDIRDSLLHVPVSTV
FT                   NPCDLGRHPYNNFPFLYTLTSTTSLEKSGISTVQRNPFLALFGSGVLVAVIDTGIDYQH
FT                   PAFKYNDGTTRILTMWDQTDQSGTPPETFTYGTQYTRDQINTALSAENPLSVVPTTDSI
FT                   GHGTAIASVLAGSPNTAESFSGVVPQAELVIIKLKEAKQNLKQLFFVPENALCYQESDI
FT                   ILGIRYAFQASQQFNRPLVVCIALGSSQGGHDGRGAMDSYIDYLSLLPGIGICVSAGNE
FT                   GNNQRHYFNSTTGAPYYNDFELRVGSNDKMFSMEIWSYAPARLSVDISSPNRESTQPVF
FT                   PSFNQCRRFSFIFNQTTIYVNNTIFEEESGDQLILLRFNNLLPGIWYLRVQSIENEPFA
FT                   FHSWLPSGDLITRETYFLNSNPDTTLTSPGNGRHQLTVAGYNDANNSILPESSRGFTRI
FT                   GEIKPDLAAPGYQLTCAVPGNMYGTVTGTGASAAQATGIVAMVLEWAIVRGNYPRMTGN
FT                   NVNRLLINGAARSSSNIYPNNIWGHGQIDVNNLFERLASI"
FT                   /protein_id="YP_003820380.1"
FT   misc_feature    complement(131139..132512)
FT                   /note="Peptidase S8 family domain in CspA-like proteins;
FT                   Region: Peptidases_S8_CspA-like; cd07478"
FT                   /db_xref="CDD:173804"
FT                   /locus_tag="Closa_0114"
FT   misc_feature    complement(order(131304..131306,131928..131930,
FT                   132030..132032,132102..132104,132273..132275,
FT                   132477..132479))
FT                   /note="active site"
FT                   /db_xref="CDD:173804"
FT                   /locus_tag="Closa_0114"
FT   misc_feature    complement(order(131304..131306,132273..132275,
FT                   132477..132479))
FT                   /note="catalytic triad; other site"
FT                   /db_xref="CDD:173804"
FT                   /locus_tag="Closa_0114"
FT   gene            133064..134242
FT                   /db_xref="GeneID:9505363"
FT                   /locus_tag="Closa_0115"
FT   CDS_pept        133064..134242
FT                   /locus_tag="Closa_0115"
FT                   /gene_family="HOG000292765" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /codon_start="1"
FT                   /EC_number="2.7.6.1"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: ribose-phosphate pyrophosphokinase; KEGG:
FT                   cpy:Cphy_0104 phosphoribosylpyrophosphate synthetase; PFAM:
FT                   phosphoribosyltransferase"
FT                   /db_xref="GI:302384559"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="GeneID:9505363"
FT                   /translation="MLYEEKTIETIPVGPLGLIPLKSCKELGDKVNDYLVSWRQERESE
FT                   HKSTIAFSGYQRDSYIIGASTPRFGTGEAKGTLQESVRGDDLYFMVDVCNYSLTYSLCG
FT                   MTNHMSPDDHFQDLKRLIAASAGKARRINVIMPFLYESRQHKRSSRESLDCALALRELV
FT                   NMGVENIITFDAHDPRVQNAIPLKGFETVQPIYQFIKYLLREEKELDIDSEHMMVISPD
FT                   EGGMGRAVFFANVLGLDMGMFYKRRDYTQIVNGRNPIVAHEFLGSSVEGKDVIIVDDMI
FT                   SSGESMLDVAKELKRRKARKVFVCSTFGLFTNGLAKFDEYYENGFIDRILTTNLVYQTP
FT                   DLLSRPYYINVDMSKYIALIIDNLNHDASLSELLNPTTRINRLLERYRAGYR"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /protein_id="YP_003820381.1"
FT   misc_feature    133088..134224
FT                   /note="phosphoribosylpyrophosphate synthetase; Provisional;
FT                   Region: PRK06827"
FT                   /db_xref="CDD:168691"
FT                   /locus_tag="Closa_0115"
FT   misc_feature    133265..134188
FT                   /note="Phosphoribosyl transferase domain; Region:
FT                   Pribosyltran; cl00309"
FT                   /db_xref="CDD:174099"
FT                   /locus_tag="Closa_0115"
FT   gene            134252..135574
FT                   /db_xref="GeneID:9505364"
FT                   /locus_tag="Closa_0116"
FT   CDS_pept        134252..135574
FT                   /locus_tag="Closa_0116"
FT                   /gene_family="HOG000270688" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00796"
FT                   /codon_start="1"
FT                   /product="branched-chain amino acid transport system II
FT                   carrier protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cpr:CPR_0388 branched-chain amino acid
FT                   transport system II carrier protein; TIGRFAM:
FT                   branched-chain amino acid transport system II carrier
FT                   protein; PFAM: branched-chain amino acid transport system
FT                   II carrier protein"
FT                   /db_xref="GI:302384560"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="GeneID:9505364"
FT                   /translation="MEKLSKQKLILVGLTLFSMFFGAGNLIFPPYLGALAGTSTWTAMT
FT                   GFAVTAIGFPVLGVVAVARSGGLARLAGRVHPKFAFIFTLLIYLSIGPCLAIPRTASTS
FT                   FEMAVVPFLKEGSSGAFIQFLYSAFFFAAAFAVSLKPDRLTDRLGKILTPCLLALIVVI
FT                   FAGCMVHPAGSYGTPEKAYGSNPFVKGFLEGYLTMDTIAALNFGIIISLNVQAMGVKQE
FT                   ASVVRETIKAGFIAGGVLLLVYSALAHVGAVTGGTLGLGENGAQTLNQAVRFLYGNVGL
FT                   VMLAAVFFIACLNTCIGLISCCSRYFSTIIPRVGYSAWAFLFAMVSLVVSNIGLNKILE
FT                   VSVPVLNAIYPVAIVLILLSFAFRDGRRWKAVYVCSIGFTGTASVLLALEQAGFVFLNA
FT                   GLSRLPLYNVGLGWMGPAFAGIAAGALAGIGGKRYGQEGSR"
FT                   /protein_id="YP_003820382.1"
FT   misc_feature    134264..135490
FT                   /note="Branched-chain amino acid transport protein; Region:
FT                   Branch_AA_trans; cl00547"
FT                   /db_xref="CDD:163870"
FT                   /locus_tag="Closa_0116"
FT   gene            complement(135942..137804)
FT                   /db_xref="GeneID:9505365"
FT                   /locus_tag="Closa_0117"
FT   CDS_pept        complement(135942..137804)
FT                   /locus_tag="Closa_0117"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:COG:COG4717"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cpy:Cphy_0103 hypothetical protein"
FT                   /db_xref="GI:302384561"
FT                   /db_xref="GeneID:9505365"
FT                   /translation="MKIIDLYINGFGKFHGRNLTFRDGLNIVYGKNEAGKSTIHTFIRG
FT                   MLFGIERQRGRASRNDLYTKYEPWENSGTYEGQIRLEHKDHIYRIERTFQKNKKEFKIV
FT                   DETAGREIEPTKAFLDDLLCGLSEAAYINTVSIGQLKSATDEGMVSELKNYIANLNTTG
FT                   NLSLNITKAAAFLKSQRKDLESQMVPEAARTYTSLLSEIRNTEKEISSPEYENQIQEYQ
FT                   KLRSHIKSSIEEQQKEKEELLQKAARGRQVLSSNQFSDQSSINACLAKAQESYEEYREA
FT                   KESCNRKPRKILSVLSLFIATLLLCGTGVLYYLGEANYFTAYYGLDLILLLGIFIGTAT
FT                   IFYLIGLILFLRLRHSQKDMEMSAKILQEILSRHLGTTDISPEALRAFQTRMAEFTRLC
FT                   SAVSKSEAVIAQKAAELEDLSKKQENCGESIEKQQKSQWELEKKLEHLSSCKTQAEGLK
FT                   HILTENDRIREEISAIDLALETMTSLSTSIRDSFGLYLNKTASDLIAGITGGIYTSMSV
FT                   DENLNVFLNTKTKLVPLEQVSSGTMDQVYLALRLAAATLIQEGTERMPFIFDDSFVLYD
FT                   DDRLKTALKWLVNAYSDQVIIFTCHQREAQMLTANLIPYHLVEI"
FT                   /protein_id="YP_003820383.1"
FT   misc_feature    complement(<137127..137804)
FT                   /note="ATPase involved in DNA repair [DNA replication,
FT                   recombination, and repair]; Region: SbcC; COG0419"
FT                   /db_xref="CDD:30768"
FT                   /locus_tag="Closa_0117"
FT   misc_feature    complement(<137499..137804)
FT                   /note="P-loop containing Nucleoside Triphosphate
FT                   Hydrolases; Region: P-loop NTPase; cl09099"
FT                   /db_xref="CDD:158411"
FT                   /locus_tag="Closa_0117"
FT   misc_feature    complement(137694..137717)
FT                   /note="Walker A/P-loop; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Closa_0117"
FT   misc_feature    complement(order(137691..137699,137703..137708))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:72971"
FT                   /locus_tag="Closa_0117"
FT   misc_feature    complement(135999..>136604)
FT                   /note="Uncharacterized conserved protein [Function
FT                   unknown]; Region: COG4717"
FT                   /db_xref="CDD:34333"
FT                   /locus_tag="Closa_0117"
FT   gene            complement(137808..138878)
FT                   /db_xref="GeneID:9505366"
FT                   /locus_tag="Closa_0118"
FT   CDS_pept        complement(137808..138878)
FT                   /locus_tag="Closa_0118"
FT                   /gene_family="HOG000027617" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /codon_start="1"
FT                   /product="metallophosphoesterase"
FT                   /transl_table="11"
FT                   /note="PFAM: metallophosphoesterase; KEGG: cpy:Cphy_0102
FT                   metallophosphoesterase"
FT                   /db_xref="GI:302384562"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="GeneID:9505366"
FT                   /translation="MKFIHIADVHWGMSPDSDKPWSKERYQDIRDTFAKAVSQAKSLEA
FT                   NCLFISGDLFHRQPLARDLKEVNYLFSTIPEVHVVIIAGNHDRIRSNSALLSFSWAPNV
FT                   SYLMGKELESVYFKEINTEVYGFSYHTPEIPENRLDHLKVPNNGRIHVLLGHGGDANHI
FT                   PFDKGAMANLDFSYIAMGHIHRPEILLENRMAFAGSLEPLDKTESGQHGMMVGEINEVT
FT                   RMVTSLKFIPMAKLQYISLAVNVTTATTNTELAMKITQEIQNRGPENIFRFRIRGMRDP
FT                   DISFDLEMLSTRFKIMEIIDESEPQYDFSALFAEHPSDMIGFYIQALQKPEMSPVEKKA
FT                   LHYGINALLRTTDERS"
FT                   /protein_id="YP_003820384.1"
FT   misc_feature    complement(137880..138878)
FT                   /note="DNA repair exonuclease [DNA replication,
FT                   recombination, and repair]; Region: SbcD; COG0420"
FT                   /db_xref="CDD:30769"
FT                   /locus_tag="Closa_0118"
FT   misc_feature    complement(138267..138875)
FT                   /note="Mre11 nuclease, N-terminal metallophosphatase
FT                   domain; Region: MPP_Mre11_N; cd00840"
FT                   /db_xref="CDD:163616"
FT                   /locus_tag="Closa_0118"
FT   misc_feature    complement(order(138327..138335,138411..138413,
FT                   138621..138626,138720..138722,138849..138851,
FT                   138855..138857))
FT                   /note="active site"
FT                   /db_xref="CDD:163616"
FT                   /locus_tag="Closa_0118"
FT   misc_feature    complement(order(138327..138329,138333..138335,
FT                   138411..138413,138624..138626,138720..138722,
FT                   138849..138851,138855..138857))
FT                   /note="metal-binding site"
FT                   /db_xref="CDD:163616"
FT                   /locus_tag="Closa_0118"
FT   misc_feature    complement(order(138486..138491,138606..138611,
FT                   138615..138617,138711..138713,138825..138845))
FT                   /note="DNA binding site"
FT                   /db_xref="CDD:163616"
FT                   /locus_tag="Closa_0118"
FT   gene            complement(138985..140376)
FT                   /db_xref="GeneID:9505367"
FT                   /locus_tag="Closa_0119"
FT   CDS_pept        complement(138985..140376)
FT                   /locus_tag="Closa_0119"
FT                   /gene_family="HOG000226033" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00457"
FT                   /codon_start="1"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /transl_table="11"
FT                   /note="KEGG: cpy:Cphy_0095 asparaginyl-tRNA synthetase;
FT                   TIGRFAM: asparaginyl-tRNA synthetase; PFAM: tRNA synthetase
FT                   class II (D K and N); nucleic acid binding OB-fold
FT                   tRNA/helicase-type"
FT                   /db_xref="GI:302384563"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="GeneID:9505367"
FT                   /translation="MDLITVRQIYKNKESLLNSQVTVGGWVRSLRDSKAFGFIVLNDGT
FT                   YFETLQIVYHNTMDNFSEISKLNVGAAIIVTGTLVATPDAKQPFEIQAEKITVEGASAP
FT                   DYPLQKKRHSFEYLRTISHLRPRTNTFQAVFRVRSLIAYAIHQFFQERDFVYVHTPIIT
FT                   GSDCEGAGEMFQVTTLDLTNIPKTEEGAVDFTQDFFGKPTNLTVSGQLNGETYAMAFRN
FT                   IYTFGPTFRAENSNTTRHAAEFWMIEPEMAFADLSDNMELAESMLKYVIRYVLEHAPEE
FT                   MNFFNQFVDKELLNRLNHVLNSEFAHVTYTEAIALLEKHNDEFDYKVFWGCDLQTEHER
FT                   YLTEQLYKKPVFVTDYPKEIKAFYMKMNPDNKTVAAVDCLVPGIGEIIGGSQREDDYDK
FT                   LVARMDELGLRKEDYDFYLDLRKFGSTRHAGFGLGFERCVMYLTGMSNIRDVVPFPRTV
FT                   NNCEL"
FT                   /protein_id="YP_003820385.1"
FT   misc_feature    complement(138991..140376)
FT                   /note="asparaginyl-tRNA synthetase; Validated; Region:
FT                   asnC; PRK03932"
FT                   /db_xref="CDD:167640"
FT                   /locus_tag="Closa_0119"
FT   misc_feature    complement(140077..140319)
FT                   /note="EcAsnRS_like_N: N-terminal, anticodon recognition
FT                   domain of the type found in Escherichia coli
FT                   asparaginyl-tRNA synthetase (AsnRS) and, in Arabidopsis
FT                   thaliana and Saccharomyces cerevisiae mitochondrial (mt)
FT                   AsnRS. This domain is a beta-barrel domain (...; Region:
FT                   EcAsnRS_like_N; cd04318"
FT                   /db_xref="CDD:58588"
FT                   /locus_tag="Closa_0119"
FT   misc_feature    complement(order(140077..140079,140161..140163,
FT                   140245..140247,140299..140301))
FT                   /note="putative dimer interface; other site"
FT                   /db_xref="CDD:58588"
FT                   /locus_tag="Closa_0119"
FT   misc_feature    complement(order(140107..140109,140131..140133,
FT                   140173..140175,140218..140220,140224..140226,
FT                   140263..140265,140281..140286,140290..140292))
FT                   /note="putative anticodon binding site; other site"
FT                   /db_xref="CDD:58588"
FT                   /locus_tag="Closa_0119"
FT   misc_feature    complement(139006..140043)
FT                   /note="Asx tRNA synthetase (AspRS/AsnRS) class II core
FT                   domain.  Assignment to class II aminoacyl-tRNA synthetases
FT                   (aaRS) based upon its structure and the presence of three
FT                   characteristic sequence motifs in the core domain. This
FT                   family includes AsnRS as well...; Region: AsxRS_core;
FT                   cd00776"
FT                   /db_xref="CDD:29821"
FT                   /locus_tag="Closa_0119"
FT   misc_feature    complement(order(139006..139011,139102..139113,
FT                   139120..139122,139603..139605,139618..139623,
FT                   139648..139653,139714..139725,139732..139734,
FT                   139741..139743,139777..139785,139789..139794,
FT                   139885..139887,139891..139899,139903..139905,
FT                   139909..139911,139918..139920,139939..139941,
FT                   139951..139953,139960..139965,139981..139983,
FT                   139996..139998,140008..140010,140014..140016))
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:29821"
FT                   /locus_tag="Closa_0119"
FT   misc_feature    complement(139885..139899)
FT                   /note="motif 1; other site"
FT                   /db_xref="CDD:29821"
FT                   /locus_tag="Closa_0119"
FT   misc_feature    complement(139678..139689)
FT                   /note="motif 2; other site"
FT                   /db_xref="CDD:29821"
FT                   /locus_tag="Closa_0119"
FT   misc_feature    complement(order(139066..139068,139075..139077,
FT                   139210..139212,139219..139221,139657..139662,
FT                   139678..139680,139684..139686))
FT                   /note="active site"
FT                   /db_xref="CDD:29821"
FT                   /locus_tag="Closa_0119"
FT   misc_feature    complement(139066..139077)
FT                   /note="motif 3; other site"
FT                   /db_xref="CDD:29821"
FT                   /locus_tag="Closa_0119"
FT   gene            140622..141896
FT                   /db_xref="GeneID:9505368"
FT                   /locus_tag="Closa_0120"
FT   CDS_pept        140622..141896
FT                   /locus_tag="Closa_0120"
FT                   /gene_family="HOG000278603" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02091"
FT                   /codon_start="1"
FT                   /product="glucose-1-phosphate adenylyltransferase"
FT                   /transl_table="11"
FT                   /note="KEGG: eel:EUBELI_01918 glucose-1-phosphate
FT                   adenylyltransferase; TIGRFAM: glucose-1-phosphate
FT                   adenylyltransferase; PFAM: Nucleotidyl transferase;
FT                   transferase hexapeptide repeat containing protein"
FT                   /db_xref="GI:302384564"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="InterPro:IPR011831"
FT                   /db_xref="GeneID:9505368"
FT                   /translation="MIKKEMIAMLLAGGQGSRLGVLTQKVAKPAVSFGGKYRIIDFPLS
FT                   NCINSGVDTVGVLTQYQPLRLNTHIGIGIPWDLDRNVGGVTILPPYEKSKGSDWYTGTA
FT                   NAIYQNLEYMETYNPDYVLILSGDHIYKMDYEVMLEYHKANNADITIAAMPVPIEDASR
FT                   FGILITDENNRITEFEEKPVNPRSNLASMGIYIFSWKVLKEALIRMSEVPGCDFGKHII
FT                   PYCFESGDRVFAYEYNGYWKDVGTLSSYWEANMELIDIIPEFNLYEEYWKIYTKSDIIP
FT                   PQYVAEEAVIDRSIIGEGSEIYGEIRNSVIGAGVTIKHGAVIKDSIIMRECVIGENVKI
FT                   QKAIIAENVKIGANSELGFGEFVTSKYDPKVYQSDLVTVGENSIIPENVKVGKNTAIAG
FT                   ETTAEDYADGELAGGDYIIKAGGIR"
FT                   /protein_id="YP_003820386.1"
FT   misc_feature    140628..141797
FT                   /note="glucose-1-phosphate adenylyltransferase;
FT                   Provisional; Region: glgC; PRK05293"
FT                   /db_xref="CDD:167963"
FT                   /locus_tag="Closa_0120"
FT   misc_feature    140643..141353
FT                   /note="ADP-glucose pyrophosphorylase is involved in the
FT                   biosynthesis of glycogen or starch; Region: ADP_Glucose_PP;
FT                   cd02508"
FT                   /db_xref="CDD:133002"
FT                   /locus_tag="Closa_0120"
FT   misc_feature    order(140652..140654,140658..140663,140922..140924,
FT                   140928..140930,141000..141005,141267..141269,
FT                   141273..141278)
FT                   /note="ligand binding site; other site"
FT                   /db_xref="CDD:133002"
FT                   /locus_tag="Closa_0120"
FT   misc_feature    order(140811..140813,140820..140822,140877..140879,
FT                   140886..140888,140895..140897,140949..140951,
FT                   140955..140957,140967..140972)
FT                   /note="oligomer interface; other site"
FT                   /db_xref="CDD:133002"
FT                   /locus_tag="Closa_0120"
FT   misc_feature    <141540..141776
FT                   /note="Glucose-1-phosphate adenylyltransferase, C-terminal
FT                   Left-handed parallel beta helix (LbH) domain:
FT                   Glucose-1-phosphate adenylyltransferase is also known as
FT                   ADP-glucose synthase or ADP-glucose pyrophosphorylase. It
FT                   catalyzes the first committed and rate-...; Region:
FT                   LbH_G1P_AT_C; cd04651"
FT                   /db_xref="CDD:100056"
FT                   /locus_tag="Closa_0120"
FT   misc_feature    order(141543..141545,141549..141551,141558..141560,
FT                   141657..141659,141765..141767)
FT                   /note="N-terminal domain interface; other site"
FT                   /db_xref="CDD:100056"
FT                   /locus_tag="Closa_0120"
FT   misc_feature    order(141657..141662,141762..141764)
FT                   /note="sulfate 1 binding site; other site"
FT                   /db_xref="CDD:100056"
FT                   /locus_tag="Closa_0120"
FT   gene            141893..143014
FT                   /db_xref="GeneID:9505369"
FT                   /locus_tag="Closa_0121"
FT   CDS_pept        141893..143014
FT                   /locus_tag="Closa_0121"
FT                   /gene_family="HOG000278603" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00483"
FT                   /codon_start="1"
FT                   /product="Nucleotidyl transferase"
FT                   /transl_table="11"
FT                   /note="PFAM: Nucleotidyl transferase; KEGG:
FT                   eel:EUBELI_01917 glucose-1-phosphate adenylyltransferase"
FT                   /db_xref="GI:302384565"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005836"
FT                   /db_xref="GeneID:9505369"
FT                   /translation="MRAIGIVLAGGNSKRMRELSNKRAISAMPIAGNYRSIDFALSNMT
FT                   NSHIQNVAVLTQYNSRSLHLHLSSSKWWDFGRKQGGLFVFTPTITAESSDWYRGTADAL
FT                   YQNLTFLKNSHEPYVVIAAGDGIYKLDYGKVLEYHIEKKADITVVCTELPGGEDITRFG
FT                   LVRTNEDGRITDFEEKPMVASSNIVSCGIYVIRRRQLIELIERCAMEDRYDFVNDILIR
FT                   YRNLKRIYAYKMNTYWRNIASVESYFKTNMDFLKSEVRDYFFRQYPDVYSKIDDLPPAK
FT                   YNPGAAVKNSLISSGSIVNGVVEHSVLFKKAYVGNNCVIKNSIILNDVYIGDNTVIENC
FT                   IVESRDTIRANTTHIGTPDNIKVVLEKNERYTL"
FT                   /protein_id="YP_003820387.1"
FT   misc_feature    141893..142966
FT                   /note="ADP-glucose pyrophosphorylase [Carbohydrate
FT                   transport and metabolism]; Region: GlgC; COG0448"
FT                   /db_xref="CDD:30797"
FT                   /locus_tag="Closa_0121"
FT   misc_feature    141905..142615
FT                   /note="ADP-glucose pyrophosphorylase is involved in the
FT                   biosynthesis of glycogen or starch; Region: ADP_Glucose_PP;
FT                   cd02508"
FT                   /db_xref="CDD:133002"
FT                   /locus_tag="Closa_0121"
FT   misc_feature    order(141914..141916,141920..141925,142184..142186,
FT                   142190..142192,142262..142267,142532..142534,
FT                   142538..142543)
FT                   /note="ligand binding site; other site"
FT                   /db_xref="CDD:133002"
FT                   /locus_tag="Closa_0121"
FT   misc_feature    order(142073..142075,142082..142084,142139..142141,
FT                   142148..142150,142157..142159,142211..142213,
FT                   142217..142219,142229..142234)
FT                   /note="oligomer interface; other site"
FT                   /db_xref="CDD:133002"
FT                   /locus_tag="Closa_0121"
FT   misc_feature    142727..>142969
FT                   /note="Glucose-1-phosphate adenylyltransferase, C-terminal
FT                   Left-handed parallel beta helix (LbH) domain:
FT                   Glucose-1-phosphate adenylyltransferase is also known as
FT                   ADP-glucose synthase or ADP-glucose pyrophosphorylase. It
FT                   catalyzes the first committed and rate-...; Region:
FT                   LbH_G1P_AT_C; cd04651"
FT                   /db_xref="CDD:100056"
FT                   /locus_tag="Closa_0121"
FT   misc_feature    order(142727..142729,142733..142771)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:100056"
FT                   /locus_tag="Closa_0121"
FT   misc_feature    order(142760..142762,142772..142777,142805..142807,
FT                   142811..142813,142820..142822,142919..142921)
FT                   /note="N-terminal domain interface; other site"
FT                   /db_xref="CDD:100056"
FT                   /locus_tag="Closa_0121"
FT   misc_feature    142919..142924
FT                   /note="sulfate 1 binding site; other site"
FT                   /db_xref="CDD:100056"
FT                   /locus_tag="Closa_0121"
FT   gene            143040..143324
FT                   /db_xref="GeneID:9505370"
FT                   /locus_tag="Closa_0122"
FT   CDS_pept        143040..143324
FT                   /locus_tag="Closa_0122"
FT                   /gene_family="HOG000209336" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04026"
FT                   /codon_start="1"
FT                   /product="SpoVG family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: SpoVG family protein; KEGG: cpy:Cphy_0109
FT                   SpoVG family protein"
FT                   /db_xref="GI:302384566"
FT                   /db_xref="InterPro:IPR007170"
FT                   /db_xref="GeneID:9505370"
FT                   /translation="MQITDVRVRRIEKEGKMKAIVSITLDNEFVIHDIKVIEGEKGLFI
FT                   AMPSRKAADGEYRDIAHPINSDTRDMIQKVILDKYETTALEMPEVEAFA"
FT                   /protein_id="YP_003820388.1"
FT   misc_feature    143040..143315
FT                   /note="SpoVG; Region: SpoVG; cl00915"
FT                   /db_xref="CDD:174457"
FT                   /locus_tag="Closa_0122"
FT   gene            143474..144460
FT                   /db_xref="GeneID:9505371"
FT                   /locus_tag="Closa_0123"
FT   CDS_pept        143474..144460
FT                   /locus_tag="Closa_0123"
FT                   /gene_family="HOG000059861" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01921"
FT                   /codon_start="1"
FT                   /EC_number="1.4.1.16"
FT                   /transl_table="11"
FT                   /note="KEGG: cpy:Cphy_2659 diaminopimelate dehydrogenase;
FT                   TIGRFAM: diaminopimelate dehydrogenase"
FT                   /db_xref="GI:302384567"
FT                   /db_xref="InterPro:IPR010190"
FT                   /db_xref="GeneID:9505371"
FT                   /translation="MTMKIGIAGYGNLGKGVECAIRHNPDLELSAVFTRREPASVTLLT
FT                   PGVKVYSMNEAVSKKDSIDVMILCGGSAVDLPEQTPLLARYFNVVDSFDTHARIPRHYE
FT                   AVDEAAKKGNKVGIISVGWDPGMFSLNRLYADAVLPGGHDDTFWGRGVSQGHSDAIRRI
FT                   QGVKDARQYTIPVEAALEAVRSGKYTELSAREKHTRECFVVAEENADLNRIREEIVSMP
FT                   YYFADYNTTVHFISEEELNRDHKGIPHGGFVIRSGKTGWEDEHSHVIEYSLKLDSNPEF
FT                   TASVLTAYARAAYRLNQEGQSGCKTVFDIAPAYLSALSGDQLRGHLL"
FT                   /product="diaminopimelate dehydrogenase"
FT                   /protein_id="YP_003820389.1"
FT   misc_feature    143480..144457
FT                   /note="diaminopimelate dehydrogenase; Region: DAP-DH;
FT                   TIGR01921"
FT                   /db_xref="CDD:162603"
FT                   /locus_tag="Closa_0123"
FT   misc_feature    143480..>143674
FT                   /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
FT                   NADB_Rossmann; cl09931"
FT                   /db_xref="CDD:176608"
FT                   /locus_tag="Closa_0123"
FT   gene            144485..144895
FT                   /db_xref="GeneID:9505372"
FT                   /locus_tag="Closa_0124"
FT   CDS_pept        144485..144895
FT                   /locus_tag="Closa_0124"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ere:EUBREC_0207 hypothetical protein"
FT                   /db_xref="GI:302384568"
FT                   /db_xref="GeneID:9505372"
FT                   /translation="MAVRKEMVLYYQPEKERQSGNDTKTAKLKAVLVRMGIRIKNITPD
FT                   QVNQTVGYLAGFNGFEESEQEDCPSVEEEILVMKNFSNQRIDELLLNLRRAGVPKILLK
FT                   AVITDTNCKWKFYDLYLELKKEHDTMSGTGGS"
FT                   /protein_id="YP_003820390.1"
FT   gene            complement(145008..145757)
FT                   /db_xref="GeneID:9505373"
FT                   /locus_tag="Closa_0125"
FT   CDS_pept        complement(145008..145757)
FT                   /locus_tag="Closa_0125"
FT                   /gene_family="HOG000245360" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /codon_start="1"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /transl_table="11"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   cpy:Cphy_3927 Mn2+-dependent serine/threonine protein
FT                   kinase"
FT                   /db_xref="GI:302384569"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="GeneID:9505373"
FT                   /translation="MAAELIATTATKSVFRDGEKAIKVFNADFPKADVLNEALITARVE
FT                   EVGGINVPKVLEVGVFEGKWSITFDFIEGKTLQQLMEENPDKLPDYMEHMVDLHLNILS
FT                   KQCPLLNKLKDKMSRQILDTEELGDITRYDMRTQLDSMPKHTKLCHGDFNPSNIIVKED
FT                   GTMYVLDWVHATQGNASADVARTYLLFCLEDQNKADMYMNLFCKKTGTAKKYVQSWLPI
FT                   VAAAQLSKKRPEEADLLQQWANVCDYQ"
FT                   /protein_id="YP_003820391.1"
FT   misc_feature    complement(145179..145748)
FT                   /note="Aminoglycoside 3'-phosphotransferase (APH) and
FT                   Choline Kinase (ChoK) family. The APH/ChoK family is part
FT                   of a larger superfamily that includes the catalytic domains
FT                   of other kinases, such as the typical
FT                   serine/threonine/tyrosine protein kinases (PKs)...; Region:
FT                   APH_ChoK_like; cd05120"
FT                   /db_xref="CDD:88612"
FT                   /locus_tag="Closa_0125"
FT   misc_feature    complement(order(145191..145193,145248..145253,
FT                   145281..145283,145287..145292,145302..145304,
FT                   145542..145553,145599..145601,145689..145691,
FT                   145695..145697,145716..145718,145728..145730))
FT                   /note="active site"
FT                   /db_xref="CDD:88612"
FT                   /locus_tag="Closa_0125"
FT   misc_feature    complement(order(145191..145193,145302..145304,
FT                   145728..145730))
FT                   /note="substrate binding site; other site"
FT                   /db_xref="CDD:88612"
FT                   /locus_tag="Closa_0125"
FT   misc_feature    complement(order(145248..145253,145281..145283,
FT                   145287..145292,145302..145304,145542..145553,
FT                   145599..145601,145689..145691,145695..145697,
FT                   145716..145718))
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:88612"
FT                   /locus_tag="Closa_0125"
FT   gene            complement(145897..147807)
FT                   /db_xref="GeneID:9505374"
FT                   /locus_tag="Closa_0126"
FT   CDS_pept        complement(145897..147807)
FT                   /locus_tag="Closa_0126"
FT                   /gene_family="HOG000283037" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01515"
FT                   /codon_start="1"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /transl_table="11"
FT                   /note="TIGRFAM: 1,4-alpha-glucan branching enzyme; PFAM:
FT                   glycoside hydrolase family 13 domain protein; alpha amylase
FT                   catalytic region; alpha amylase all-beta; KEGG:
FT                   eel:EUBELI_02045 glycoside hydrolase family 13 candidate
FT                   1,4-A-glucan branching enzyme; N-terminal CBM48 module;
FT                   SMART: alpha amylase catalytic sub domain"
FT                   /db_xref="GI:302384570"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="GeneID:9505374"
FT                   /translation="MEIDRAEIGTGFITEVDRYLYNNGRHYEIYEKLGAHPEKYEGNDG
FT                   MYFAVWAPHGSQVSVVGDFNGWDPEANLMSSLSDSGIWETFVPGLGIGELYKYAITTRS
FT                   GKILFKSDPYAFQAEYRPQTASVTADLSVFQWKDRSWMEKRMTKDPLHEPLSIYEVHLG
FT                   SWRKKNRAEKDGFYTYTEAAHELADYILEMGYTHVELMGIAEHPYDGSWGYQVTGYFAP
FT                   TSRYGTPEEFMYFVDYLHRKGIGVILDWVPAHFPKDAHGLADFDGEPCYEYGDPRKGEH
FT                   PDWGTKVFDYSKYEVDNFLIANALYWVDKFHVDGLRVDAVASMLYLDYGRNNGEWVPNQ
FT                   YGGNENLEAIEFFKHLNSVIKNRGNGAMVIAEESTAWPRVTGNQEQAGLGFTFKWNMGW
FT                   MHDFLEYMKLDPYFRKYNHHKMTFGLSYFTSENYILVLSHDEVVHLKCSMIHKMPGLLE
FT                   DKFSNLKLGYTFMLGHPGKKLLFMGQDFGQFHEWDEKSALDWYLSEEPLGKDLKDYVRD
FT                   LLHLYKKYPALYEKDFDWEGFSWVNANDKERSIFSFIRYSKDHKRSLLFVLNFTPVERP
FT                   DYRVGVPKRGAYTLVLDEKHGLYKRGEKAPSFRSVKTEWDGQEHSFSYPLPAYGAAVFR
FT                   F"
FT                   /protein_id="YP_003820392.1"
FT   misc_feature    complement(145903..147771)
FT                   /note="glycogen branching enzyme; Provisional; Region:
FT                   PRK05402"
FT                   /db_xref="CDD:168023"
FT                   /locus_tag="Closa_0126"
FT   misc_feature    complement(147421..147738)
FT                   /note="Glycogen branching enzyme N-terminus domain.
FT                   Glycogen branching enzyme (AKA 1,4 alpha glucan branching
FT                   enzyme) catalyzes the formation of alpha-1,6 branch points
FT                   in either glycogen or starch by cleavage of the alpha-1,4
FT                   glucosidic linkage yielding a...; Region:
FT                   Glycogen_branching_enzyme_N_term; cd02855"
FT                   /db_xref="CDD:30342"
FT                   /locus_tag="Closa_0126"
FT   misc_feature    complement(<147046..147246)
FT                   /note="Alpha amylase, catalytic domain; Region:
FT                   Alpha-amylase; cl07893"
FT                   /db_xref="CDD:164103"
FT                   /locus_tag="Closa_0126"
FT   misc_feature    complement(145900..146190)
FT                   /note="Alpha amylase, C-terminal all-beta domain; Region:
FT                   Alpha-amylase_C; cl02706"
FT                   /db_xref="CDD:155067"
FT                   /locus_tag="Closa_0126"
FT   gene            complement(147812..149146)
FT                   /db_xref="GeneID:9505375"
FT                   /locus_tag="Closa_0127"
FT   CDS_pept        complement(147812..149146)
FT                   /locus_tag="Closa_0127"
FT                   /gene_family="HOG000251727" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /codon_start="1"
FT                   /product="alpha amylase catalytic region"
FT                   /transl_table="11"
FT                   /note="KEGG: eel:EUBELI_01193 glycoside hydrolase family 13
FT                   candidate A-glycosidase (amylase-related); PFAM: alpha
FT                   amylase catalytic region; SMART: alpha amylase catalytic
FT                   sub domain"
FT                   /db_xref="GI:302384571"
FT                   /db_xref="InterPro:IPR006046"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006589"
FT                   /db_xref="GeneID:9505375"
FT                   /translation="MSKWYERGVFYHLYPLGLVGAPKENRESSVTDRFGELCQWIPHIR
FT                   SLGCNAIYIGPLFESSTHGYDTRDYRMVDRRLGGFENFREFVSRCHETGIKVVVDGVFN
FT                   HTGREFFAFQDILEHRENSPYRDWYRGINFAAGSPLGDSFGYEGWQGHFQLPCLNLLNP
FT                   EVKQYLFDTVRFWIHTFGIDGIRLDCANVLDFGFMKELREHTRDMKEDFWLMGEVIHGE
FT                   YGRWVNQEMLHSVTNYELHKSIYSGHNDHNYFEIAHNVKRLESIGSQLYTFVDNHDENR
FT                   IASKLHDLRHLPLTYLLLYTLPGIPSIYYGSELGLEGKRTNTDDSMLRPAISITEIREF
FT                   SSPLKDLISKLGHIHEENPEFHGGRYQELLLTNRQYAFARFHDGHTIIIGANNDESGAF
FT                   VSIPCPCEGNTAVNLLNGEVFPVTDRRIGLTLPANQGVILKIMEG"
FT                   /protein_id="YP_003820393.1"
FT   misc_feature    complement(147851..149137)
FT                   /note="trehalose synthase; Region: treS_nterm; TIGR02456"
FT                   /db_xref="CDD:162863"
FT                   /locus_tag="Closa_0127"
FT   misc_feature    complement(148187..149026)
FT                   /note="Alpha amylase, catalytic domain; Region:
FT                   Alpha-amylase; cl07893"
FT                   /db_xref="CDD:164103"
FT                   /locus_tag="Closa_0127"
FT   gene            complement(149173..149391)
FT                   /db_xref="GeneID:9505376"
FT                   /locus_tag="Closa_0128"
FT   CDS_pept        complement(149173..149391)
FT                   /locus_tag="Closa_0128"
FT                   /gene_family="HOG000276914" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:EUBELI_01989"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: eel:EUBELI_01989 hypothetical protein"
FT                   /db_xref="GI:302384572"
FT                   /db_xref="GeneID:9505376"
FT                   /translation="MKHVQLKKHLAPSEEERNLRREIERSKTAIDAARNHFEQVVDPTL
FT                   IDCYIYELNAAQLRYQFLLRRFKSREV"
FT                   /protein_id="YP_003820394.1"
FT   gene            complement(149492..149869)
FT                   /db_xref="GeneID:9505377"
FT                   /locus_tag="Closa_0129"
FT   CDS_pept        complement(149492..149869)
FT                   /locus_tag="Closa_0129"
FT                   /gene_family="HOG000144508" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /transl_table="11"
FT                   /note="KEGG: cdl:CDR20291_2966 ArsR-family transcriptional
FT                   regulator; PFAM: regulatory protein ArsR; SMART: regulatory
FT                   protein ArsR"
FT                   /db_xref="GI:302384573"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="GeneID:9505377"
FT                   /translation="MQAQEFNELFQSCMPIFIALGDEVRFSIIEGLARTGFYGKPENDV
FT                   TNKDGLYIRPGQGMNVKEITEMTRLSRPAVSHHLKILKEAGLVSVRQEGTANYYYLTIG
FT                   DSTKKLCSLGQYLQQLLSQVS"
FT                   /protein_id="YP_003820395.1"
FT   misc_feature    complement(149555..149821)
FT                   /note="Arsenical Resistance Operon Repressor and similar
FT                   prokaryotic, metal regulated homodimeric repressors. ARSR
FT                   subfamily of helix-turn-helix bacterial transcription
FT                   regulatory proteins (winged helix topology). Includes
FT                   several proteins that appear to...; Region: HTH_ARSR;
FT                   cd00090"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Closa_0129"
FT   misc_feature    complement(order(149612..149614,149768..149770,
FT                   149777..149782,149789..149794,149801..149803,
FT                   149810..149812,149816..149821))
FT                   /note="dimerization interface; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Closa_0129"
FT   misc_feature    complement(order(149573..149581,149594..149602,
FT                   149618..149623,149627..149632,149639..149644,
FT                   149648..149659,149684..149692,149795..149803,
FT                   149813..149818))
FT                   /note="putative DNA binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Closa_0129"
FT   misc_feature    complement(order(149681..149683,149690..149692))
FT                   /note="putative Zn2+ binding site; other site"
FT                   /db_xref="CDD:28974"
FT                   /locus_tag="Closa_0129"
FT   gene            150256..150771
FT                   /db_xref="GeneID:9505378"
FT                   /locus_tag="Closa_0130"
FT   CDS_pept        150256..150771
FT                   /locus_tag="Closa_0130"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01478"
FT                   /codon_start="1"
FT                   /product="peptidase A24A prepilin type IV"
FT                   /transl_table="11"
FT                   /note="KEGG: ere:EUBREC_0040 hypothetical protein; manually
FT                   curated; PFAM: peptidase A24A prepilin type IV"
FT                   /db_xref="GI:302384574"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="GeneID:9505378"
FT                   /translation="MVSYVVLLLILGTGAFFDAQEHRIPNGLVLWGVIIGFLLEIAGSG
FT                   KPLAGLLFLLRLLIVTMVFFLLFLCRMIGAGDIKLAALICGFLGLRAGALAVGFGFLIG
FT                   AIWSFIKMTVRGSLFIRFSCLFAYIRRVFQTGKLTTYYDPVQDGYDVVIPLGLCLFLGT
FT                   IGSMIFVK"
FT                   /protein_id="YP_003820396.1"
FT   misc_feature    150268..150579
FT                   /note="Type IV leader peptidase family; Region:
FT                   Peptidase_A24; cl02077"
FT                   /db_xref="CDD:154734"
FT                   /locus_tag="Closa_0130"
FT   gene            150867..151868
FT                   /db_xref="GeneID:9505379"
FT                   /locus_tag="Closa_0131"
FT   CDS_pept        150867..151868
FT                   /locus_tag="Closa_0131"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: eel:EUBELI_01987 hypothetical protein"
FT                   /db_xref="GI:302384575"
FT                   /db_xref="GeneID:9505379"
FT                   /translation="MAKRVMAVYDEDPLYAERLAEYVNQKEQVPFSVLGFTALERLTDY
FT                   GADHRIELLLVDSSVSREDIEKIGAAFVILLADGEVAPLEEPYPRVYKYQAADRIMREV
FT                   MGFYCNNSGEPGYAMVSRSGRVMGVYSPINRCLKTSFALTMGQLLARDLKVLYMNFEDC
FT                   SGFGRLMGEEYKGGLSDLLYYYGQEGFHWGRLGAVVHTWGDLDYVPPVQYPEDLCQVTG
FT                   QMMAELVGHIARESTYGSIILDLGQFGKKGAELLEVCDVVYMPVKDDCVSAAKVEEFEE
FT                   YLTSSGHEALISRIQKIKPPYHSSFGRRDNYLEQLLWGELGDYTRQLLRKFP"
FT                   /protein_id="YP_003820397.1"
FT   gene            151952..153169
FT                   /db_xref="GeneID:9505380"
FT                   /locus_tag="Closa_0132"
FT   CDS_pept        151952..153169
FT                   /locus_tag="Closa_0132"
FT                   /gene_family="HOG000119936" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /codon_start="1"
FT                   /product="type II secretion system protein E"
FT                   /transl_table="11"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   cth:Cthe_1339 type II secretion system protein E"
FT                   /db_xref="GI:302384576"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="GeneID:9505380"
FT                   /translation="MEEQRRKLREEILRELDERQQVADEELCDIIDSRILEYGKNNFLP
FT                   LKDKMELRSRLFDSFRRLGALQELVDDQDVTEIMVNGADRVFVERNGRMEPWVRAFDSP
FT                   EQLEDTIQQIVSRVNRTVNVSRPIADARLSDGSRVHVVLPPIALDGPAVTIRKFPKPIT
FT                   MARLLKLGSITEEASDFLKCIVEAGYNIFISGGTNSGKSTFLNALSACIPKDERIVTIE
FT                   DSAELKITHLPNLVRLETRQANGEGDGEVTIGDLIRAALRMNPSRIIVGEVRGKEALDM
FT                   ISAMNTGHDGSLSTGHGNSPRDMLSRLETMVLMGADIPLAAVRSQVAAAIDILIHLGRL
FT                   RDKSRRVLSIVEVVGYENGEIRLNPLYRFEEDYEDREGSQTVRGSLKKVGCIQNTEKLK
FT                   AAGIEI"
FT                   /protein_id="YP_003820398.1"
FT   misc_feature    152141..153019
FT                   /note="Type IV secretory pathway, VirB11 components, and
FT                   related ATPases involved in archaeal flagella biosynthesis
FT                   [Cell motility and secretion / Intracellular trafficking
FT                   and secretion]; Region: VirB11; COG0630"
FT                   /db_xref="CDD:30975"
FT                   /locus_tag="Closa_0132"
FT   misc_feature    152441..152998
FT                   /note="Type IV secretory pathway component VirB11, and
FT                   related ATPases. The homohexamer, VirB11 is one of eleven
FT                   Vir proteins, which are required for T-pilus biogenesis and
FT                   virulence in the transfer of T-DNA from the Ti
FT                   (tumor-inducing) plasmid of bacterial...; Region:
FT                   VirB11-like_ATPase; cd01130"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Closa_0132"
FT   misc_feature    order(152450..152452,152543..152560,152975..152977)
FT                   /note="ATP binding site; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Closa_0132"
FT   misc_feature    order(152534..152539,152549..152557)
FT                   /note="Walker A motif; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Closa_0132"
FT   misc_feature    order(152540..152545,152600..152602,152624..152626,
FT                   152648..152659,152663..152668,152735..152743,
FT                   152747..152749,152786..152788,152798..152800,
FT                   152807..152812,152840..152848,152858..152860,
FT                   152867..152869,152966..152968)
FT                   /note="hexamer interface; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Closa_0132"
FT   misc_feature    152750..152767
FT                   /note="Walker B motif; other site"
FT                   /db_xref="CDD:29996"
FT                   /locus_tag="Closa_0132"
FT   gene            153159..153896
FT                   /db_xref="GeneID:9505381"
FT                   /locus_tag="Closa_0133"
FT   CDS_pept        153159..153896
FT                   /locus_tag="Closa_0133"
FT                   /gene_family="HOG000027611" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /codon_start="1"
FT                   /product="Type II secretion system F domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Type II secretion system F domain; KEGG:
FT                   cpy:Cphy_0033 Flp pilus assembly protein TadB-like protein"
FT                   /db_xref="GI:302384577"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="GeneID:9505381"
FT                   /translation="MRYDNYVLTPAQWFLYGFQGLAAAGIFSYVFYRSVASFLLFLPMI
FT                   FIFPHIKKSELKKKRLQQLNLEFKEGILLLASFLSAGYSVENAFSASVKELVILYGEEG
FT                   MVSMEFGHIVSQIRINRSVEQALSEFAGRSGLDDVKNFAEVFAAAKRSGGELVSIISHT
FT                   AAVIRDKMQVRQEILTMTASKQFEQKIMTMIPFFIVLYIDMTSPGFFNIMYNTGIGRIL
FT                   MTLCLAVYIGAIAIARHIMKIEI"
FT                   /protein_id="YP_003820399.1"
FT   misc_feature    <153324..153893
FT                   /note="Bacterial type II secretion system protein F domain;
FT                   Region: GSPII_F; cl00906"
FT                   /db_xref="CDD:154078"
FT                   /locus_tag="Closa_0133"
FT   gene            153911..155173
FT                   /db_xref="GeneID:9505382"
FT                   /locus_tag="Closa_0134"
FT   CDS_pept        153911..155173
FT                   /locus_tag="Closa_0134"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:EUBREC_0044"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ere:EUBREC_0044 hypothetical protein"
FT                   /db_xref="GI:302384578"
FT                   /db_xref="GeneID:9505382"
FT                   /translation="MVRKSEKKWIFPFTRVQAVCAVSGFVFYIAMKLVFGSGGRELSEG
FT                   AGLKRAGPGQGESTYDVLVSGLDKDNEDKRVPVKIPVRERKYSEEEARELFQKIQPELT
FT                   EQMLGENESLEDVRGNLNLKGSLGEYGLRIIWESENPQVIDAFGIVHNEDIPEEGKSVW
FT                   LRARVTDGSYERQFEFKVTVYPASLTREQRAADDFVRWIGQIDLKQQTEDRLSLPPVYM
FT                   GERLTYFQPEETDYRILPVLGILLAALLPLKGEFDRKNQARVRERQLLFDYSEVVSKLV
FT                   VYMGAGLTVRGAWERITAGYKDGVKQGKRSVRPAYEEMVKTAAQLGSGLSEGKAYSEFG
FT                   RRCGVQVYIKLSALLEQSQKNGSRQLRPALELEMVSAFEQRKNLAKKLGEEAGTKLLLP
FT                   LLMMLGVVMVMIVVPAFLSFY"
FT                   /protein_id="YP_003820400.1"
FT   gene            155189..155374
FT                   /db_xref="GeneID:9505383"
FT                   /locus_tag="Closa_0135"
FT   CDS_pept        155189..155374
FT                   /locus_tag="Closa_0135"
FT                   /gene_family="HOG000065477" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:EUBREC_0045"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ere:EUBREC_0045 hypothetical protein"
FT                   /db_xref="GI:302384579"
FT                   /db_xref="GeneID:9505383"
FT                   /translation="MLDWIKDQIGDFLREEDGVGVIEVVLILVVLIGLVIIFKKQITTL
FT                   LDNIFKEINNQSKEVY"
FT                   /protein_id="YP_003820401.1"
FT   gene            155374..157266
FT                   /db_xref="GeneID:9505384"
FT                   /locus_tag="Closa_0136"
FT   CDS_pept        155374..157266
FT                   /locus_tag="Closa_0136"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: eel:EUBELI_01982 hypothetical protein"
FT                   /db_xref="GI:302384580"
FT                   /db_xref="GeneID:9505384"
FT                   /translation="MRKKGQITVFFSLALLCVFSLMCGLLESARTAGARCYLKLAADSS
FT                   MDSVFSRYHKEAWEKYRLFLLECENGDELAKVWKGYMEPYMDTSGWYSMNMEQADTMQL
FT                   ISITDGGGHYLNQEILDYMKYGIFENITDEKGGEVLLENLKEARAVKQLSSSFRSHERE
FT                   AVRLERALEDINISLKQQKAFWQAAKEGIADFDGPEFRREADRLKRETDRIPSLVKAYE
FT                   KRADDLKSSITETNKALSEAKEELSQKVNEAFMSDTSCYESYVNQDGDRRKEIQVLPEK
FT                   MELVRQVAERAKERSYEVESIIDQWDSDDEEDDGPDLTSLWGSVGEIWHEADIPVLSYS
FT                   NGVKDPEKQKLLEQVEGFLQTGLLALVLPEGKEISKGIISDNSFPSVTCMKEQGPGVDA
FT                   GIMDRILFGEYCSRFLTNFLSEEDKEVRYEMEYLISGKHTDEENLKQTVADVLMVREGL
FT                   NLIHILSDGQKREEARALAGLITGAVGMAPLTGIVAFFVMSVWALGEAITDVKMLLEGK
FT                   KVVLLKTRDTWRLSLTGLMELGKTGTCTGGSGDETGIDYTAYLKLLLFLGEIRRQYYRV
FT                   MDVIQMNLCREQEDFRMIHCVYQAEIRGRVKSRHMFFGGIDPFFPVEVRTEKAY"
FT                   /protein_id="YP_003820402.1"
FT   gene            157286..158209
FT                   /db_xref="GeneID:9505385"
FT                   /locus_tag="Closa_0137"
FT   CDS_pept        157286..158209
FT                   /locus_tag="Closa_0137"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: eel:EUBELI_01981 hypothetical protein"
FT                   /db_xref="GI:302384581"
FT                   /db_xref="GeneID:9505385"
FT                   /translation="MLFFKEFQGKNIKKKVTLQVQIPFIIQGFLAKRALSSASFSRIKG
FT                   SLTVEAAFVLPLFLFFMAILMLPMTAMKEGRRIQTALEAAGEEVSQYAYVLHRLELGEG
FT                   LESTGPGGLSEELSDRLTEEGMLLFVRKRMEGRAGSKRIEAISFARSSVLRDGETIDLI
FT                   MDYRVRVPFSVFGLSSIPMTARSSRRAWIGQEGGKGKKAGQEDALVYVGRTGTKYHRQR
FT                   TCHYLYNDLEQIPFIQLENARNSSGGKYKPCSRCGRFAEENGSVFIMPSGERYHSDRNC
FT                   SSILAYVEAVPLSEVRHMGACSYCSQ"
FT                   /protein_id="YP_003820403.1"
FT   gene            158224..158655
FT                   /db_xref="GeneID:9505386"
FT                   /locus_tag="Closa_0138"
FT   CDS_pept        158224..158655
FT                   /locus_tag="Closa_0138"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cce:Ccel_0510 peptidase A24A prepilin type IV"
FT                   /db_xref="GI:302384582"
FT                   /db_xref="GeneID:9505386"
FT                   /translation="MEGVYKSLFGIFLLAAAWEDVREKAVSVWVFEGAAIAGAIMALLQ
FT                   GEMGAERLLSCMVGAGLLLLSRLTSEAIGIGDGCFFAVSGLYLSAVMNLKLLIFGSLLN
FT                   GIFCGGMYVFGLLRGKDVKKKTVPFLPFLVPVWIGLEIL"
FT                   /protein_id="YP_003820404.1"
FT   gene            158652..159041
FT                   /db_xref="GeneID:9505387"
FT                   /locus_tag="Closa_0139"
FT   CDS_pept        158652..159041
FT                   /locus_tag="Closa_0139"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: pen:PSEEN3130 hypothetical protein"
FT                   /db_xref="GI:302384583"
FT                   /db_xref="GeneID:9505387"
FT                   /translation="MRGKLRGSYTVEAAFVMAIVLWALVVSIQAAYRLRDEVVGSMALE
FT                   ESAQRLRHNETELPEEAERWAARRAGSPFSWKQYDFQIKMTGNPVTGRKVKARGAGGTW
FT                   KLELEQGVFDPENFLRVLSFVNQEE"
FT                   /protein_id="YP_003820405.1"
FT   gene            159043..160356
FT                   /db_xref="GeneID:9505388"
FT                   /locus_tag="Closa_0140"
FT   CDS_pept        159043..160356
FT                   /locus_tag="Closa_0140"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /codon_start="1"
FT                   /product="FHA domain containing protein"
FT                   /transl_table="11"
FT                   /note="KEGG: eel:EUBELI_01978 hypothetical protein; PFAM:
FT                   Forkhead-associated protein; SMART: Forkhead-associated
FT                   protein"
FT                   /db_xref="GI:302384584"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="GeneID:9505388"
FT                   /translation="MKAAYRREMRHNYLIIELEETGYDGYEILMLASNGIEGLLKFRAK
FT                   QMDDRVLYYYEITSKQPLSRVLEYHSLGGEELKRLIGDIGQTLGRLELYLLKEKQILLE
FT                   PEYIYVEPEQFKVFLCLVPGRHVDFPGEMTGLLRYLLGKVNHQDKECVVMAYGLYQESL
FT                   KENYGMKDLLEIAGKNCSGTKGSDENIPQPDDTKAPEESQMSPLPYGLRDLNEEMEERI
FT                   SLSDVRKKGLLFVIPFSAMIGITLVLWLLSGLEGILKFWYAVPFAGIFTAFTALTAWRR
FT                   YSGQQNEAMVKGEEGGRQPVERDDWKMAFVEEIKEKAPKFEAGDEEIIQTTLLTDPGAD
FT                   KNIRYLRALGPDTEDILITYVPFLIGKQEGMVDCVLSGDAVSRIHARIDRDGEEYRISD
FT                   LNSTNGTTVNGRVLETNETVGLKKGDEVLIANFAYIFT"
FT                   /protein_id="YP_003820406.1"
FT   misc_feature    <160126..160353
FT                   /note="Forkhead associated domain (FHA); found in
FT                   eukaryotic and prokaryotic proteins. Putative nuclear
FT                   signalling domain. FHA domains may bind phosphothreonine,
FT                   phosphoserine and sometimes phosphotyrosine. In eukaryotes,
FT                   many FHA domain-containing proteins...; Region: FHA;
FT                   cd00060"
FT                   /db_xref="CDD:28942"
FT                   /locus_tag="Closa_0140"
FT   misc_feature    order(160141..160143,160180..160182,160186..160191,
FT                   160249..160257)
FT                   /note="phosphopeptide binding site; other site"
FT                   /db_xref="CDD:28942"
FT                   /locus_tag="Closa_0140"
FT   gene            complement(160424..161080)
FT                   /db_xref="GeneID:9505389"
FT                   /locus_tag="Closa_0141"
FT   CDS_pept        complement(160424..161080)
FT                   /locus_tag="Closa_0141"
FT                   /gene_family="HOG000027365" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Cphy_0441"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cpy:Cphy_0441 hypothetical protein"
FT                   /db_xref="GI:302384585"
FT                   /db_xref="GeneID:9505389"
FT                   /translation="MKHIRKIMLLLMACIILTGCKKVTGASSGLSFPQGNAAESGQSEG
FT                   NSPPKYDMADSGPNDPENPEVAGSNPYPPDFAGPAPKQPPENDGNSPQEGPADSSGNSA
FT                   VDIDLSKLSSTMVFSEVYYMMTSPEQYMGKSVKAEGTFQVYQDPGTKKNYYAVVIADAT
FT                   ACCQQGLEFIWNGEHTYPDDYPEQESEIEITGVFQSYQEEGSTYYYLLVDEVKPV"
FT                   /protein_id="YP_003820407.1"
FT   gene            complement(161077..161931)
FT                   /db_xref="GeneID:9505390"
FT                   /locus_tag="Closa_0142"
FT   CDS_pept        complement(161077..161931)
FT                   /locus_tag="Closa_0142"
FT                   /gene_family="HOG000181429" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00950"
FT                   /codon_start="1"
FT                   /product="ABC-3 protein"
FT                   /transl_table="11"
FT                   /note="PFAM: ABC-3 protein; KEGG: fsu:Fisuc_1194 ABC-3
FT                   protein"
FT                   /db_xref="GI:302384586"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="GeneID:9505390"
FT                   /translation="MNGLMEKLILYFEYPFVRYALIVGILIALCSSLLGVTLVLKRFSF
FT                   IGDGLSHVAFGGMAIATVIKMTNHMLLILPVTIVCAILLLRTGQNAKIRGDAAVAMISV
FT                   GALALGYLLINIFSASANLAGDVCSTLFGSTSILTLTKTEVWLCAALSLVVIAVFLLFY
FT                   HKIFAVTFDEEFAKAAGINAGQYNLLIAVIIAIIIVLAMNLVGSLLISALVIFPALSAM
FT                   RLFKNFKTVIICSAILSVFCAVLGILTSILAGTPVGSTIVAVDIAAFALCSLIGRISGG
FT                   VRR"
FT                   /protein_id="YP_003820408.1"
FT   misc_feature    complement(161116..161874)
FT                   /note="Transmembrane subunit (TM), of Periplasmic Binding
FT                   Protein (PBP)-dependent ATP-Binding Cassette (ABC)
FT                   transporters involved in the uptake of siderophores, heme,
FT                   vitamin B12, or the divalent cations Mg2+ and Zn2+.
FT                   PBP-dependent ABC transporters consist...; Region:
FT                   TM_ABC_iron-siderophores_like; cd06550"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="Closa_0142"
FT   misc_feature    complement(order(161248..161250,161269..161271,
FT                   161395..161403,161407..161424,161428..161433,
FT                   161437..161445,161449..161454,161809..161817,
FT                   161827..161829))
FT                   /note="ABC-ATPase subunit  interface; other site"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="Closa_0142"
FT   misc_feature    complement(order(161122..161127,161134..161136,
FT                   161143..161148,161155..161157,161302..161304,
FT                   161536..161538,161545..161550,161587..161589,
FT                   161593..161598,161605..161607,161614..161619,
FT                   161626..161631,161638..161643,161647..161649,
FT                   161791..161793,161806..161808,161812..161814))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="Closa_0142"
FT   misc_feature    complement(order(161164..161166,161314..161316,
FT                   161326..161328,161500..161502,161587..161589))
FT                   /note="putative PBP binding regions; other site"
FT                   /db_xref="CDD:119348"
FT                   /locus_tag="Closa_0142"
FT   gene            complement(161928..162638)
FT                   /db_xref="GeneID:9505391"
FT                   /locus_tag="Closa_0143"
FT   CDS_pept        complement(161928..162638)
FT                   /locus_tag="Closa_0143"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /codon_start="1"
FT                   /product="ABC transporter related protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cpy:Cphy_0439 ABC transporter related; PFAM:
FT                   ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="GI:302384587"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="GeneID:9505391"
FT                   /translation="MAQLTCNSLTLGYDGKTVLEGLDFSVNSGDYLCIIGENGSGKTTL
FT                   MKAILRLHSPMEGSIVMENGFQSAGIGYLPQQTVVQKDFPASVWEIVLSGCLNRCGLRP
FT                   YYNHKEKQLARSNMEKMGISHLSGRCYRELSGGQQQRVLLARALCAAGKMLLLDEPVSG
FT                   LDPKVTAEMYGLIRKLNEEGITILMISHDISAAVKYASHILHIGNPHFFGTRDEYLDND
FT                   TGKAFLSRDGSSNA"
FT                   /protein_id="YP_003820409.1"
FT   misc_feature    complement(161970..162638)
FT                   /note="ABC-type Mn/Zn transport systems, ATPase component
FT                   [Inorganic ion transport and metabolism]; Region: ZnuC;
FT                   COG1121"
FT                   /db_xref="CDD:31318"
FT                   /locus_tag="Closa_0143"
FT   misc_feature    complement(162000..162623)
FT                   /note="ABC component of the metal-type transporters.  This
FT                   family includes transporters involved in the uptake of
FT                   various metallic cations such as iron, manganese, and zinc.
FT                   The ATPases of this group of transporters are very similar
FT                   to members of iron-...; Region: ABC_Metallic_Cations;
FT                   cd03235"
FT                   /db_xref="CDD:72994"
FT                   /locus_tag="Closa_0143"
FT   gene            complement(162654..163643)
FT                   /db_xref="GeneID:9505392"
FT                   /locus_tag="Closa_0144"
FT   CDS_pept        complement(162654..163643)
FT                   /locus_tag="Closa_0144"
FT                   /gene_family="HOG000180308" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01297"
FT                   /codon_start="1"
FT                   /product="periplasmic solute binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: periplasmic solute binding protein; KEGG:
FT                   shi:Shel_18230 ABC-type metal ion transport system,
FT                   periplasmic component/surface adhesin"
FT                   /db_xref="GI:302384588"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="GeneID:9505392"
FT                   /translation="MKKLFMACLLTGLLLIGALTACSSTNAKTSENDKLRVVCTIFPEY
FT                   DWVREILGSHAGDVEITMLLDNGVDLHSYQPTAEDIIKISNCDMFIYVGGESDQWVEDA
FT                   LKEAANKNMTVINLLEVLGDTVKEEEMMEGMEPEEEEHDQEGVGEGPEYDEHVWLSLKN
FT                   AKTFCNYIASKLGEIDSANAGDYSVNADTYEKKLDELDKGYQQTVDSAQLNTVLFGDRF
FT                   PFRYLADDYGLSYYAAFAGCSAETEASFETIAFLSKKVDELGLKSVLTIEGTKHKIAET
FT                   IIQNTKDKNQTVRSMDSMQSTTSKDMEHGATYLSIMQTNLDVLKEALK"
FT                   /protein_id="YP_003820410.1"
FT   misc_feature    complement(162657..163550)
FT                   /note="Helical backbone metal receptor (TroA-like domain).
FT                   These proteins have been shown to function in the ABC
FT                   transport of ferric siderophores and metal ions such as
FT                   Mn2+, Fe3+, Cu2+ and/or Zn2+.  Their ligand binding site is
FT                   formed in the interface...; Region: TroA-like; cl00262"
FT                   /db_xref="CDD:174075"
FT                   /locus_tag="Closa_0144"
FT   misc_feature    complement(order(163125..163127,163326..163328,
FT                   163335..163340))
FT                   /note="intersubunit interface; other site"
FT                   /db_xref="CDD:29734"
FT                   /locus_tag="Closa_0144"
FT   gene            complement(163765..164061)
FT                   /db_xref="GeneID:9505393"
FT                   /locus_tag="Closa_0145"
FT   CDS_pept        complement(163765..164061)
FT                   /locus_tag="Closa_0145"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: shi:Shel_18220 hypothetical protein"
FT                   /db_xref="GI:302384589"
FT                   /db_xref="GeneID:9505393"
FT                   /translation="MVKNRKLLARLMTLAVIFMLLFSVLFITAESRHNCIGENCPICLE
FT                   VQACIQVLNNLGTGLFTVAAVFAATQFFIICTNPVIHRNPSHTLVSLKVKLTN"
FT                   /protein_id="YP_003820411.1"
FT   gene            complement(164092..164481)
FT                   /db_xref="GeneID:9505394"
FT                   /locus_tag="Closa_0146"
FT   CDS_pept        complement(164092..164481)
FT                   /locus_tag="Closa_0146"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /codon_start="1"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /transl_table="11"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: fsu:Fisuc_1190
FT                   ferric uptake regulator, Fur family"
FT                   /db_xref="GI:302384590"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="GeneID:9505394"
FT                   /translation="MANYKTEQRKQLVAFLQENPDKQFSAKQIADCLSDSSVSLSAVYR
FT                   NLTYLQDKGRINRFTKEGSREFFYQYIHLDDCRNCIHMNCIKCGETVHMNAGIADRMLD
FT                   DILRIDGFQIKKEKSVIYGICKNCI"
FT                   /protein_id="YP_003820412.1"
FT   misc_feature    complement(164107..164460)
FT                   /note="Ferric uptake regulator(Fur) and related
FT                   metalloregulatory proteins; typically iron-dependent,
FT                   DNA-binding repressors and activators; Region: Fur_like;
FT                   cd07153"
FT                   /db_xref="CDD:133478"
FT                   /locus_tag="Closa_0146"
FT   misc_feature    complement(order(164203..164205,164236..164238,
FT                   164242..164244,164263..164265,164413..164415))
FT                   /note="metal binding site 2; metal-binding site"
FT                   /db_xref="CDD:133478"
FT                   /locus_tag="Closa_0146"
FT   misc_feature    complement(164323..164367)
FT                   /note="putative DNA binding helix; other site"
FT                   /db_xref="CDD:133478"
FT                   /locus_tag="Closa_0146"
FT   misc_feature    complement(order(164131..164133,164182..164184,
FT                   164239..164241,164245..164247))
FT                   /note="metal binding site 1; metal-binding site"
FT                   /db_xref="CDD:133478"
FT                   /locus_tag="Closa_0146"
FT   misc_feature    complement(order(164110..164136,164140..164148,
FT                   164173..164178,164224..164232))
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:133478"
FT                   /locus_tag="Closa_0146"
FT   misc_feature    complement(order(164107..164109,164218..164220,
FT                   164227..164229))
FT                   /note="structural Zn2+ binding site; other site"
FT                   /db_xref="CDD:133478"
FT                   /locus_tag="Closa_0146"
FT   gene            164694..165314
FT                   /db_xref="GeneID:9505395"
FT                   /locus_tag="Closa_0147"
FT   CDS_pept        164694..165314
FT                   /locus_tag="Closa_0147"
FT                   /gene_family="HOG000229238" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /codon_start="1"
FT                   /product="Rhomboid family protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Rhomboid family protein; KEGG: ere:EUBREC_0051
FT                   hypothetical protein"
FT                   /db_xref="GI:302384591"
FT                   /db_xref="InterPro:IPR002610"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="GeneID:9505395"
FT                   /translation="MKDVYRRKRAFINIGLIAMNVIYFLYLEMAGSTVNTQFMVNHGAM
FT                   YAPLVLEEGEYFRLLTSVFMHFGINHIMNNMLILFILGDNLERALGHIKYLLFYLLCGV
FT                   GANVISIILNLGDYRSVVSAGASGAIFGVIGGLLYAVFINRGRLEDLSARQLIIMIACS
FT                   LYFGFTSTGVDNAAHIGGLFFGIVLGILLYRKPRKRCDMKKWG"
FT                   /protein_id="YP_003820413.1"
FT   misc_feature    164841..165227
FT                   /note="Rhomboid family; Region: Rhomboid; cl11446"
FT                   /db_xref="CDD:175259"
FT                   /locus_tag="Closa_0147"
FT   gene            165338..165775
FT                   /db_xref="GeneID:9505396"
FT                   /locus_tag="Closa_0148"
FT   CDS_pept        165338..165775
FT                   /locus_tag="Closa_0148"
FT                   /gene_family="HOG000061063" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01230"
FT                   /codon_start="1"
FT                   /product="histidine triad (HIT) protein"
FT                   /transl_table="11"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   ere:EUBREC_0053 cell cycle regulation histidine triad (HIT)
FT                   protein"
FT                   /db_xref="GI:302384592"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR019808"
FT                   /db_xref="GeneID:9505396"
FT                   /translation="MREDNCIFCKIANGGIPSETIYEDNSFRVILDLGPASRGHALILP
FT                   KQHYRDLCELDEETAKKVLPLAAKIGNAMKKSLGCAGFNVVQNNGEEAGQTVFHFHVHL
FT                   IPRYEDGPVMVSWVPGEAGPKELTETGAAIRSALQSEGHNR"
FT                   /protein_id="YP_003820414.1"
FT   misc_feature    165350..165658
FT                   /note="HINT (histidine triad nucleotide-binding protein)
FT                   subgroup: Members of this CD belong to the superfamily of
FT                   histidine triad hydrolases that act on alpha-phosphate of
FT                   ribonucleotides. This subgroup includes members from all
FT                   three forms of cellular life...; Region: HINT_subgroup;
FT                   cd01277"
FT                   /db_xref="CDD:29590"
FT                   /locus_tag="Closa_0148"
FT   misc_feature    order(165632..165634,165638..165640,165644..165652)
FT                   /note="HIT family signature motif; other site"
FT                   /db_xref="CDD:29590"
FT                   /locus_tag="Closa_0148"
FT   misc_feature    165638..165640
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:29590"
FT                   /locus_tag="Closa_0148"
FT   gene            165772..166314
FT                   /db_xref="GeneID:9505397"
FT                   /locus_tag="Closa_0149"
FT   CDS_pept        165772..166314
FT                   /locus_tag="Closa_0149"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /codon_start="1"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /transl_table="11"
FT                   /note="KEGG: ctc:CTC00665 RNA polymerase sigma factor;
FT                   TIGRFAM: RNA polymerase sigma factor, sigma-70 family;
FT                   PFAM: sigma-70 region 2 domain protein"
FT                   /db_xref="GI:302384593"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="GeneID:9505397"
FT                   /translation="MSIHEDENLLLQSIYGEYQGLLRRIAKTLHVPDMELDDVVQETFI
FT                   AYFENYSLSWSDTRKKGMLIKILKRKSIDCLRKNGHYEKVSLDEDDAVNEVAMLTRYVV
FT                   TDPLDVILGEEALLKITREISNMRDEWKEMAVLYFLEQLTIPEICEILKIPGTVCRSRI
FT                   YRTRVCLKKILGPNFDI"
FT                   /protein_id="YP_003820415.1"
FT   misc_feature    165802..166293
FT                   /note="RNA polymerase sigma factor, sigma-70 family;
FT                   Region: sigma70-ECF; TIGR02937"
FT                   /db_xref="CDD:163078"
FT                   /locus_tag="Closa_0149"
FT   misc_feature    165811..166011
FT                   /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
FT                   /db_xref="CDD:146937"
FT                   /locus_tag="Closa_0149"
FT   gene            complement(166318..167385)
FT                   /db_xref="GeneID:9505398"
FT                   /locus_tag="Closa_0150"
FT   CDS_pept        complement(166318..167385)
FT                   /locus_tag="Closa_0150"
FT                   /gene_family="HOG000218322" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR01133"
FT                   /codon_start="1"
FT                   /EC_number="2.4.1.227"
FT                   /transl_table="11"
FT                   /note="TIGRFAM:
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; KEGG: cpy:Cphy_3727
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; PFAM: glycosyl transferase family 28;
FT                   Glycosyltransferase 28 domain"
FT                   /db_xref="GI:302384594"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="GeneID:9505398"
FT                   /translation="MKKIILTGGGTAGHVTPNLALIPSLKERNYDIHYIGSHQGIERKL
FT                   IEGAGIPYDGISSGKFRRYFDLKNFSDPFRVLKGYWEAMKLIKNHKPDVVFSKGGFVAV
FT                   PVVMAAKHCKVPVIIHESDMTPGLANKLCIPAAVKVCCNFPETLPYLPKDKAVLTGSPI
FT                   RKELLKGDRTTGLNYARLSSSRPVILIIGGSLGSVTVNTALRGILPKLLKNYQVIHICG
FT                   KGNLDESLTGMEGYVQYEYVDAPLKHLFAAADLMISRAGANSICEILALRKPNILIPLS
FT                   AAASRGDQILNARSFAKQGFSYLLEEENLTGDSLLKAITETFANRQTFISKMEQSELYN
FT                   AIDTIIDMIESQIKK"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-
FT                   (pentapeptide) pyrophosphoryl-undecaprenol
FT                   N-acetylglucosamine transferase"
FT                   /protein_id="YP_003820416.1"
FT   misc_feature    complement(166339..167385)
FT                   /note="undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase; Reviewed; Region:
FT                   PRK12446"
FT                   /db_xref="CDD:171505"
FT                   /locus_tag="Closa_0150"
FT   misc_feature    complement(166342..167379)
FT                   /note="MurG is an N-acetylglucosaminyltransferase, the last
FT                   enzyme involved in the intracellular phase of peptidoglycan
FT                   biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc)
FT                   from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked
FT                   N-acetylmuramoyl...; Region: GT1_MurG; cd03785"
FT                   /db_xref="CDD:99961"
FT                   /locus_tag="Closa_0150"
FT   misc_feature    complement(order(166510..166512,166519..166524,
FT                   166546..166548,166585..166587,166594..166605,
FT                   166648..166650,166663..166665,166726..166728,
FT                   166804..166806,167017..167019,167347..167349))
FT                   /note="active site"
FT                   /db_xref="CDD:99961"
FT                   /locus_tag="Closa_0150"
FT   misc_feature    complement(order(166975..166977,167050..167052,
FT                   167134..167136,167167..167169,167176..167178))
FT                   /note="homodimer interface; other site"
FT                   /db_xref="CDD:99961"
FT                   /locus_tag="Closa_0150"
FT   gene            167498..167986
FT                   /db_xref="GeneID:9505399"
FT                   /locus_tag="Closa_0151"
FT   CDS_pept        167498..167986
FT                   /locus_tag="Closa_0151"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: abu:Abu_0826 hypothetical protein"
FT                   /db_xref="GI:302384595"
FT                   /db_xref="GeneID:9505399"
FT                   /translation="MVKERNHGKKNSILKRMNVYDSSQEKLEAHLLDYMQKHPELTPEP
FT                   PSPPPGEFQKIMAELNRRGAKTVVRKQLKVLRYGHRFVNSLQKPLLVVMVVLIILAASA
FT                   IGASAKKANDYRMREQNAGKSKSEVLRANKLSNAYEKIKQQPGISIQMINGVSHELHL"
FT                   /protein_id="YP_003820417.1"
FT   gene            complement(168092..168451)
FT                   /db_xref="GeneID:9505400"
FT                   /locus_tag="Closa_0152"
FT   CDS_pept        complement(168092..168451)
FT                   /locus_tag="Closa_0152"
FT                   /gene_family="HOG000059716" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF03960"
FT                   /codon_start="1"
FT                   /product="arsenate reductase-like protein"
FT                   /transl_table="11"
FT                   /note="PFAM: arsenate reductase and related; KEGG:
FT                   ele:Elen_2504 arsenate reductase and related"
FT                   /db_xref="GI:302384596"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="GeneID:9505400"
FT                   /translation="MSILFLQYPPCSTCKNAKKWLDAHEISYDSRNIKEENPTAEELAA
FT                   WIKKSSLPIKRFFNTSGILYKEKNIKNLLPDMSEDEQITLLASDGMLVRRPLIIGDHFV
FT                   LAGFKKKEWETALLP"
FT                   /protein_id="YP_003820418.1"
FT   misc_feature    complement(168113..168445)
FT                   /note="Arsenate Reductase (ArsC) family, unknown subfamily;
FT                   uncharacterized proteins containing a CXXC motif with
FT                   similarity to thioredoxin (TRX)-fold arsenic reductases,
FT                   ArsC. Proteins containing a redox active CXXC motif like
FT                   TRX and glutaredoxin (GRX)...; Region: ArsC_like; cd03036"
FT                   /db_xref="CDD:48585"
FT                   /locus_tag="Closa_0152"
FT   misc_feature    complement(order(168128..168130,168167..168169,
FT                   168275..168277,168419..168421))
FT                   /note="putative ArsC-like catalytic residues; other site"
FT                   /db_xref="CDD:48585"
FT                   /locus_tag="Closa_0152"
FT   misc_feature    complement(order(168410..168412,168419..168421))
FT                   /note="putative TRX-like catalytic residues; other site"
FT                   /db_xref="CDD:48585"
FT                   /locus_tag="Closa_0152"
FT   gene            168593..169120
FT                   /db_xref="GeneID:9505401"
FT                   /locus_tag="Closa_0153"
FT   CDS_pept        168593..169120
FT                   /locus_tag="Closa_0153"
FT                   /gene_family="HOG000060593" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:Cphy_3907"
FT                   /codon_start="1"
FT                   /product="nucleoside recognition domain-containing protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cpy:Cphy_3907 nucleoside recognition
FT                   domain-containing protein"
FT                   /db_xref="GI:302384597"
FT                   /db_xref="GeneID:9505401"
FT                   /translation="MKFLLFLSEAAVPLIIFYMVGFGILSKRPVFDDFMDGAKEGMKTV
FT                   AGIMPTLIGLMTAVGVLRASGFLDFLAKCLTKPAALLFLPAPVVPVILIRLVSNSAATG
FT                   LVLDIFKRYGTDSYIGMLTSVLMSCTETVFYCLSIYFGTVKIKKTRYTLGGALAATAAG
FT                   VAASVILSRFLV"
FT                   /protein_id="YP_003820419.1"
FT   misc_feature    168665..169045
FT                   /note="Nucleoside recognition; Region: Gate; cl00486"
FT                   /db_xref="CDD:174236"
FT                   /locus_tag="Closa_0153"
FT   gene            169224..169673
FT                   /db_xref="GeneID:9505402"
FT                   /locus_tag="Closa_0154"
FT   CDS_pept        169224..169673
FT                   /locus_tag="Closa_0154"
FT                   /gene_family="HOG000221452" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, MarR family"
FT                   /transl_table="11"
FT                   /note="KEGG: eel:EUBELI_00035 MarR family transcriptional
FT                   regulator; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="GI:302384598"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="GeneID:9505402"
FT                   /translation="MKGINVDTYGTLNEVLVRLFRDIMDIEQQAIITQEFSNLTNNDMH
FT                   VIEAIGIGEPKNMSAIARELSVTVGTLTIAMNSLVKKGYVTRQRGKEDRRVVYISLSEK
FT                   GKEAYEHHARFHQEMIAGVVAGLSENEIEVLIKALTKLNQWFRSL"
FT                   /protein_id="YP_003820420.1"
FT   misc_feature    169275..169649
FT                   /note="Transcriptional regulators [Transcription]; Region:
FT                   MarR; COG1846"
FT                   /db_xref="CDD:32031"
FT                   /locus_tag="Closa_0154"
FT   misc_feature    169335..169619
FT                   /note="Winged helix-turn-helix (WHTH) DNA-binding domain of
FT                   the GntR family of transcriptional regulators; Region:
FT                   WHTH_GntR; cl00088"
FT                   /db_xref="CDD:173998"
FT                   /locus_tag="Closa_0154"
FT   gene            169701..170237
FT                   /db_xref="GeneID:9505403"
FT                   /locus_tag="Closa_0155"
FT   CDS_pept        169701..170237
FT                   /locus_tag="Closa_0155"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF10646"
FT                   /codon_start="1"
FT                   /product="Lipoprotein LpqB, GerMN domain protein"
FT                   /transl_table="11"
FT                   /note="PFAM: Lipoprotein LpqB, GerMN domain; KEGG:
FT                   cdl:CDR20291_3529 hypothetical protein"
FT                   /db_xref="GI:302384599"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="GeneID:9505403"
FT                   /translation="MKKFIVFLMSAMMMMSLAACTPTQPKMETTAPDPQVMASTGGASD
FT                   KVPDPNAEPMEIISIYSKNDDATGLNQAMDAVSELTAEAMVDKLIEYGVLEEGTKVLKF
FT                   DKGDGTATLDLSKVPEKSSDGDIIMLTAIGNTFTENFELNKLKLLVNGKNFSGGQIKQG
FT                   DNDYLEYDKNYKKLK"
FT                   /protein_id="YP_003820421.1"
FT   gene            complement(170289..172109)
FT                   /db_xref="GeneID:9505404"
FT                   /locus_tag="Closa_0156"
FT   CDS_pept        complement(170289..172109)
FT                   /locus_tag="Closa_0156"
FT                   /gene_family="HOG000027488" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF05960"
FT                   /codon_start="1"
FT                   /product="protein of unknown function DUF885"
FT                   /transl_table="11"
FT                   /note="PFAM: protein of unknown function DUF885; KEGG:
FT                   cpy:Cphy_3852 hypothetical protein"
FT                   /db_xref="GI:302384600"
FT                   /db_xref="InterPro:IPR010281"
FT                   /db_xref="GeneID:9505404"
FT                   /translation="MKNKVFKQGRRFLSLILSVTLLCACAPMKQPPASPSWAEYEQYHA
FT                   KNLSAQNKFDQLTNDLFRKEISESGISFHFSIADPASRGLDTVPLTLGDYSMEKMKEGT
FT                   KELLELKKNLDGFNQRQLTDEQRFTWQILRSYIDTELSSDGLELYAQPLTNTIGIQAQL
FT                   PILFSEYAFYTRNDVDHYLALLSTIDDYYGQIMEFEKKKSEAGLFMSDTSADNVLKSCE
FT                   AYLIQPDHSFLAETFNTRIDALTDLTPEEKAAYKEKNLKVLEEHFIPAYKNLATGITSL
FT                   MGTGTNDKGLSWYPKGKEYFEYLVKSNTGTSYGSIRSLTKAIEKQLNSDIQAIGQITKE
FT                   HPEVLNALDNYSFHYTKPAEILESLKSLISNDFPELPDCSYTVKYVPSSLESSLSPAFY
FT                   LVPPLDRYEDNVIYINGNPRFQNEDLFTTLAHEGYPGHLYQNVYFLSRKPNDIRSLLSF
FT                   PSYSEGWATYVEFYSYTLDNGLNPELGKLLAHNTAVTLGLYAYLDICINYEGWDKDQTA
FT                   KYLGTFYNIEKTDIVDSIYTSLIDNPTNYMEYYVGYMEIMEMLNTSKKILKDDFNLKDF
FT                   HTFLLDVGPAPFTVIQPAFRNWLAKQLRSH"
FT                   /protein_id="YP_003820422.1"
FT   misc_feature    complement(170316..171869)
FT                   /note="Bacterial protein of unknown function (DUF885);
FT                   Region: DUF885; pfam05960"
FT                   /db_xref="CDD:147876"
FT                   /locus_tag="Closa_0156"
FT   gene            172627..174606
FT                   /db_xref="GeneID:9505405"
FT                   /locus_tag="Closa_0157"
FT   CDS_pept        172627..174606
FT                   /locus_tag="Closa_0157"
FT                   /gene_family="HOG000200401" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00398"
FT                   /codon_start="1"
FT                   /product="methionyl-tRNA synthetase"
FT                   /transl_table="11"
FT                   /note="KEGG: cpy:Cphy_0025 methionyl-tRNA synthetase;
FT                   TIGRFAM: methionyl-tRNA synthetase; methionyl-tRNA
FT                   synthetase, beta subunit; PFAM: tRNA synthetase class I
FT                   (M); t-RNA-binding domain protein"
FT                   /db_xref="GI:302384601"
FT                   /db_xref="InterPro:IPR002304"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="GeneID:9505405"
FT                   /translation="MCKDSNKKPYYITTAIAYASGKPHIGNTYEAVLADAIARYKRAEG
FT                   YDVFFQTGTDEHGQKIEEKAEAAGITPKEFVDRAAGEIRKIWDLMNTSYDKFIRTTDKD
FT                   HEEQVQKIFKKLYEQDDIYKGYYEGLYCTPCESFFTESQLVDGKCPDCGREVKPAKEEA
FT                   YFFRMSKYADRLIKHINENPDFIQPVSRKNEMMNNFLLPGLQDLCVSRTTFQWGIPVSF
FT                   DPRHVTYVWLDALTNYITGIGYDCDGQSREQFSKLWPADLHLIGKDIIRFHTIYWPIFL
FT                   MALDIPLPKQVFGHPWLLQGDGKMSKSKGNVLYADTLVDFFGVDAVRYFVLHEMPFDND
FT                   GIISWELMVERMNSDLANILGNLVNRTISMSNKYFEGIVKDGKAAEAVDEDLKAVVLEE
FT                   VKKVQEKMEKLRVADAMTSIFNIFRRSNKYIDETTPWTLAKDEASKERLETVLYNLTEA
FT                   IAIGASLLDSFMPDTSKKILSQLNTSKRELSQMNEFGLYPSGNKVTDKPEILFARMDMK
FT                   EVMEKVEAMFGNKKEESAGSAREAATDGIDIEAKAEIEYGDFAKLQFQVGEIIACEAVP
FT                   KSKKLLCSQVRIGSQVKQIVSGIKAHYSPEEMVGKKVMVVVNLKPAKLAGVMSEGMLLC
FT                   AEDAEGNLSLMVPEKSMPSGAEIC"
FT                   /protein_id="YP_003820423.1"
FT   misc_feature    172639..174600
FT                   /note="methionyl-tRNA synthetase; Reviewed; Region:
FT                   PRK12267"
FT                   /db_xref="CDD:171353"
FT                   /locus_tag="Closa_0157"
FT   misc_feature    172651..173649
FT                   /note="catalytic core domain of methioninyl-tRNA
FT                   synthetases; Region: MetRS_core; cd00814"
FT                   /db_xref="CDD:173907"
FT                   /locus_tag="Closa_0157"
FT   misc_feature    order(172672..172674,172678..172680,172705..172707,
FT                   172789..172791,173317..173319,173326..173331,
FT                   173338..173340,173431..173433,173443..173445,
FT                   173455..173457,173539..173541,173545..173547)
FT                   /note="active site"
FT                   /db_xref="CDD:173907"
FT                   /locus_tag="Closa_0157"
FT   misc_feature    172696..172707
FT                   /note="HIGH motif; other site"
FT                   /db_xref="CDD:173907"
FT                   /locus_tag="Closa_0157"
FT   misc_feature    173536..173550
FT                   /note="KMSKS motif; other site"
FT                   /db_xref="CDD:173907"
FT                   /locus_tag="Closa_0157"
FT   misc_feature    173683..174069
FT                   /note="Anticodon-binding domain of methionyl tRNA
FT                   synthetases; Region: Anticodon_Ia_Met; cd07957"
FT                   /db_xref="CDD:153411"
FT                   /locus_tag="Closa_0157"
FT   misc_feature    order(173683..173685,173704..173709,173716..173721,
FT                   173728..173733,173740..173745,173752..173757,
FT                   173905..173910,173914..173919,173932..173934)
FT                   /note="tRNA binding surface; other site"
FT                   /db_xref="CDD:153411"
FT                   /locus_tag="Closa_0157"
FT   misc_feature    order(173704..173706,173716..173721,173728..173733,
FT                   173740..173745,173752..173757,173914..173916,
FT                   173932..173934)
FT                   /note="anticodon binding site; other site"
FT                   /db_xref="CDD:153411"
FT                   /locus_tag="Closa_0157"
FT   misc_feature    174286..174603
FT                   /note="tRNA-binding-domain-containing Escherichia coli
FT                   methionyl-tRNA synthetase (EcMetRS)-like proteins.  This
FT                   family includes EcMetRS and Aquifex aeolicus Trbp111
FT                   (AaTrbp111). This domain has general tRNA binding
FT                   properties.  MetRS aminoacylates methionine...; Region:
FT                   tRNA_bind_EcMetRS_like; cd02800"
FT                   /db_xref="CDD:48402"
FT                   /locus_tag="Closa_0157"
FT   misc_feature    order(174289..174291,174430..174432,174478..174486,
FT                   174493..174495,174529..174540,174559..174561,
FT                   174565..174567,174571..174573,174580..174582,
FT                   174592..174603)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:48402"
FT                   /locus_tag="Closa_0157"
FT   misc_feature    order(174364..174366,174400..174402,174478..174480,
FT                   174490..174492,174511..174513,174520..174522)
FT                   /note="putative tRNA-binding site; other site"
FT                   /db_xref="CDD:48402"
FT                   /locus_tag="Closa_0157"
FT   gene            174794..175549
FT                   /db_xref="GeneID:9505406"
FT                   /locus_tag="Closa_0158"
FT   CDS_pept        174794..175549
FT                   /locus_tag="Closa_0158"
FT                   /gene_family="HOG000291547" [ FAMILY / ALN / TREE ]
FT                   /inference="similar to AA sequence:KEGG:EUBREC_1055"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: ere:EUBREC_1055 hypothetical protein"
FT                   /db_xref="GI:302384602"
FT                   /db_xref="GeneID:9505406"
FT                   /translation="MKEPISARTRGLSGNTLKMIAIVTMLIDHIGVAVIENGVLRYQTV
FT                   RPAYEAFGMPGGSMWTVMDLALRTMGRIAFPIFCFLLVEGFFHTRDIKKYGTRLFLFAL
FT                   ISEIPFDLALFGKWYYPDYQNVYVTLFIGLCVLYWYEKFSGDLVRRTLIFFAGCVAAVL
FT                   LKCDYNIIGIAMILLFYIYYGNKKMQTIFAGILAAYESLGCFGAAILAFIPIRMYNGTR
FT                   GKGNFKYFFYWFYPAHLILLYILRLFIIQ"
FT                   /protein_id="YP_003820424.1"
FT   misc_feature    174827..175507
FT                   /note="TraX protein; Region: TraX; cl05434"
FT                   /db_xref="CDD:174842"
FT                   /locus_tag="Closa_0158"
FT   gene            175601..176365
FT                   /db_xref="GeneID:9505407"
FT                   /locus_tag="Closa_0159"
FT   CDS_pept        175601..176365
FT                   /locus_tag="Closa_0159"
FT                   /gene_family="HOG000201526" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00010"
FT                   /codon_start="1"
FT                   /product="hydrolase, TatD family"
FT                   /transl_table="11"
FT                   /note="KEGG: cpy:Cphy_3900 TatD family hydrolase; TIGRFAM:
FT                   hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease"
FT                   /db_xref="GI:302384603"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR012278"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="GeneID:9505407"
FT                   /translation="MIFDTHAHYDDEAFDEDREELFASLFAHGIEAVTNVGASMKTSRS
FT                   TLELAENYPYIYGAIGVHPNETGEMTEEDMQWLKEQSSHKKIVAIGEIGLDYYWDEPDH
FT                   ETQKTWFIRQLGLAKEVKLPVVIHSRDAAKDTLDMMKAEGGKDIGGVIHCFSYGKEIAR
FT                   EYLNMGYYLGIGGVLTFKNARKLKEVVEYMPMEQLVLETDCPYLAPAPNRGKRNSSLYL
FT                   PYVVQEISTIKGIPEDAVIEITNQNAKRLYNL"
FT                   /protein_id="YP_003820425.1"
FT   misc_feature    175604..176359
FT                   /note="TatD like proteins;  E.coli TatD is a cytoplasmic
FT                   protein, shown to have magnesium dependent DNase activity;
FT                   Region: TatD_DNAse; cd01310"
FT                   /db_xref="CDD:30053"
FT                   /locus_tag="Closa_0159"
FT   misc_feature    175610..176362
FT                   /note="putative deoxyribonuclease YjjV; Provisional;
FT                   Region: PRK11449"
FT                   /db_xref="CDD:171118"
FT                   /locus_tag="Closa_0159"
FT   misc_feature    order(175616..175618,175622..175624,175982..175984,
FT                   176057..176059,176207..176209)
FT                   /note="active site"
FT                   /db_xref="CDD:30053"
FT                   /locus_tag="Closa_0159"
FT   gene            176397..177266
FT                   /db_xref="GeneID:9505408"
FT                   /locus_tag="Closa_0160"
FT   CDS_pept        176397..177266
FT                   /locus_tag="Closa_0160"
FT                   /gene_family="HOG000227962" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00755"
FT                   /codon_start="1"
FT                   /EC_number="2.1.1.48"
FT                   /transl_table="11"
FT                   /note="SMART: Ribosomal RNA adenine methylase
FT                   transferase-like; TIGRFAM: dimethyladenosine transferase;
FT                   KEGG: cpy:Cphy_3899 dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase"
FT                   /db_xref="GI:302384604"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR019825"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="GeneID:9505408"
FT                   /translation="MATLGNPQKTIEIIQKYEFAFQKKFGQNFLIDTHVLDKIITAAGV
FT                   TKDDCVLEIGPGIGTMTQYLAENARHVVAVEIDSNLIPILKETLTDYENVTVIHDDILK
FT                   VDINQIAEQYNGGRPIKVVANLPYYITTPIIMGLFENNVPIDNITVMVQKEVADRMQVG
FT                   PGSKDYGALSLAVQYYAQPYIVANVPPNCFMPRPNVGSAVIRLTRHKEPAVKAEDAGLM
FT                   FRLIRASFNQRRKTLQNGLNNSPEIPYSREQIAEAVESLGLGPSIRGEALTLEQFASLS
FT                   NYFTKMKD"
FT                   /product="dimethyladenosine transferase"
FT                   /protein_id="YP_003820426.1"
FT   misc_feature    176412..177254
FT                   /note="S-adenosylmethionine-dependent methyltransferases
FT                   (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
FT                   that use S-adenosyl-L-methionine (SAM or AdoMet) as a
FT                   substrate for methyltransfer, creating the product
FT                   S-adenosyl-L-homocysteine (AdoHcy)...; Region:
FT                   AdoMet_MTases; cl12011"
FT                   /db_xref="CDD:176836"
FT                   /locus_tag="Closa_0160"
FT   gene            177282..177845
FT                   /db_xref="GeneID:9505409"
FT                   /locus_tag="Closa_0161"
FT   CDS_pept        177282..177845
FT                   /locus_tag="Closa_0161"
FT                   /gene_family="HOG000237283" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /codon_start="1"
FT                   /product="transcriptional regulator, TetR family"
FT                   /transl_table="11"
FT                   /note="PFAM: regulatory protein TetR; KEGG: cpy:Cphy_0610
FT                   TetR family transcriptional regulator"
FT                   /db_xref="GI:302384605"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="GeneID:9505409"
FT                   /translation="MSDSLITKRAIAEALKQVCREKPFDKISISNITSVWGLNRQTFYY
FT                   HFQDKYELLSWIYYHENFAKIAEDITLRNWDQKIYELLLNMKKEKAFYMNTIKEQEHTF
FT                   ESYLFEMAKALFTEAIVSLDEKKKLTKEERDFDAEFFAYGICGIIVDWAEKGMKMEPRL
FT                   VAERLKSLARAAERIAYLRGQAEL"
FT                   /protein_id="YP_003820427.1"
FT   misc_feature    177291..177803
FT                   /note="probable dihydroxyacetone kinase regulator; Region:
FT                   DHAK_reg; TIGR02366"
FT                   /db_xref="CDD:162826"
FT                   /locus_tag="Closa_0161"
FT   gene            complement(177842..178075)
FT                   /db_xref="GeneID:9505410"
FT                   /locus_tag="Closa_0162"
FT   CDS_pept        complement(177842..178075)
FT                   /locus_tag="Closa_0162"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /db_xref="GI:302384606"
FT                   /db_xref="GeneID:9505410"
FT                   /translation="MSAIIHKHIRESVLKTALVHQLKNGQKSPERTARNLEELLQRFSP
FT                   KSGELFSYSDLVALIKSCSLEECLDIIMHKLS"
FT                   /protein_id="YP_003820428.1"
FT   gene            178294..180021
FT                   /db_xref="GeneID:9505411"
FT                   /locus_tag="Closa_0163"
FT   CDS_pept        178294..180021
FT                   /locus_tag="Closa_0163"
FT                   /gene_family="HOG000237402" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF06100"
FT                   /codon_start="1"
FT                   /product="67 kDa myosin-cross-reactive antigen family
FT                   protein"
FT                   /transl_table="11"
FT                   /note="PFAM: 67 kDa myosin-cross-reactive antigen family
FT                   protein; KEGG: cbt:CLH_2556 myosin-cross-reactive antigen"
FT                   /db_xref="GI:302384607"
FT                   /db_xref="InterPro:IPR010354"
FT                   /db_xref="GeneID:9505411"
FT                   /translation="MKGKNNFGKMLAWGAAATAAGMAAKKAYDYSKKQKDLKDEGTMMS
FT                   PNMGRTSGKAYFVGGGLGSMAGAAYLIRDCSMPGEQITIFEGMHILGGSNDGIGTPEKG
FT                   FVCRGGRMLNEETYENFWELFGSIPSLNNPARSVTEEILSFDHAHPTHAKARLVDKDGT
FT                   ILDVKSMGFTQNERMALLRLMNTPEEKLDDMTIEEWFADMPHFFTTNFWYMWQTTFAFQ
FT                   KWSSLFEFRRYMRRMILEFSRIETLAGVTRTPLNQYDSVIRPLETYLRKQGVVFAENCT
FT                   VTDIDFAEGDGITAKVLHLKDNGIERQIQLEDGDICIMTNACMTDSATLGDLHTPAPEP
FT                   VLRPISGELWSKVSAKKAGLGNPYPFFGDVHETNWESFTVTSRGNKLLKLIENYSGNVP
FT                   GSGALMTFKDSSWLMSIVVAAQPHFINQPMDQTIFWGYGLYTDRVGDYIKKPMKDCTGE
FT                   EMLIELLHHLHMENRKDEILADVVNVIPCMMPYVDAQFQPRKMTDRPKVVPAGSTNFAM
FT                   VSQFVEIPEDMVFTEEYSVRAARMAVYTLMGVNKKICPVTPYVKDPKVLMKAVQTSYR"
FT                   /protein_id="YP_003820429.1"
FT   misc_feature    178429..180018
FT                   /note="Streptococcal 67 kDa myosin-cross-reactive antigen
FT                   like family; Region: Strep_67kDa_ant; cl01939"
FT                   /db_xref="CDD:176594"
FT                   /locus_tag="Closa_0163"
FT   gene            180224..181897
FT                   /db_xref="GeneID:9505412"
FT                   /locus_tag="Closa_0164"
FT   CDS_pept        180224..181897
FT                   /locus_tag="Closa_0164"
FT                   /gene_family="HOG000179191" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /codon_start="1"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /transl_table="11"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: cpy:Cphy_2000 extracellular solute-binding protein"
FT                   /db_xref="GI:302384608"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="GeneID:9505412"
FT                   /translation="MKKMALVLAAVLASGMILTACGGSGKSGTAGGETQKTEAAGNTTA
FT                   GGLDLAVQIGPDPETIDPALNSTADAANMILHAFETLMTFDKDNQVIPGQAESYDVSDD
FT                   GLTYTFHLREGLKWSDGSDLTAEDFVYSWKRLADPATAAPYGADMLSMVKGYEEAADGN
FT                   LDALAVTAPDAKTFVVELASPCVYFDKIITHATMVPVKKDVVEAKGDQWSLTPDTYVSN
FT                   GPLKMIEWVPGSHITFAKNENYWDAQKVTLNTLKFVLMEDANAAYSAYQTGEVQMIKDI
FT                   PTDEIPSLQGTPDYHLDPRMATSYTIFNVTKAPFDNALVRRALSLAIDRDYVANTVMAG
FT                   TVVPATNFVGPGISDEESGSSFEEITRKLNGGDFFHVSNYEEDLTKAKELLAEAGYPNG
FT                   EGFPMIEYMTNEAGYNKPIAEYLQSAWSELGVRMDIKIVEWSTFAPTRRAGDFQTARGG
FT                   WVYDYDDPSNMLNLFTTESGNNDGKYSNPEVDSLLKQARDTADKTEHYEKLHKAETMIL
FT                   EDAPISPLVYSSDYYLQRPELKGTWHSPYGFWFFTQATME"
FT                   /protein_id="YP_003820430.1"
FT   misc_feature    180332..181867
FT                   /note="ABC-type oligopeptide transport system, periplasmic
FT                   component [Amino acid transport and metabolism]; Region:
FT                   OppA; COG4166"
FT                   /db_xref="CDD:33908"
FT                   /locus_tag="Closa_0164"
FT   misc_feature    180371..181876
FT                   /note="The substrate-binding component of an ABC-type
FT                   oligopetide import system contains the type 2 periplasmic
FT                   binding fold; Region: PBP2_OppA; cd08504"
FT                   /db_xref="CDD:173869"
FT                   /locus_tag="Closa_0164"
FT   misc_feature    order(180437..180439,181058..181060,181121..181123,
FT                   181541..181543,181589..181591,181595..181609,
FT                   181805..181807)
FT                   /note="peptide binding site; other site"
FT                   /db_xref="CDD:173869"
FT                   /locus_tag="Closa_0164"
FT   gene            complement(182052..182603)
FT                   /db_xref="GeneID:9505413"
FT                   /locus_tag="Closa_0165"
FT   CDS_pept        complement(182052..182603)
FT                   /locus_tag="Closa_0165"
FT                   /gene_family="HOG000099651" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF04260"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   fsu:Fisuc_3075 hypothetical protein"
FT                   /db_xref="GI:302384609"
FT                   /db_xref="InterPro:IPR006340"
FT                   /db_xref="GeneID:9505413"
FT                   /translation="MLDEIRTQAATAAKELLEAAHLNEKDLVVIGCSSSEISDHRIGSH
FT                   SSAEIGQAVFSAIYEVFQAQGIYVAAQCCEHLNRALIMEKEAARLYGYEPVNVVPQLKA
FT                   GGSLATAACQTFQCPVAVESIKAHAGIDIGDTLIGMHLKTVAVPVRIKTRYIGSAHVVT
FT                   ARTRPKFIGGARACYDDTLG"
FT                   /protein_id="YP_003820431.1"
FT   misc_feature    complement(182067..182603)
FT                   /note="Protein of unknown function (DUF436); Region:
FT                   DUF436; cl01860"
FT                   /db_xref="CDD:174678"
FT                   /locus_tag="Closa_0165"
FT   gene            complement(182641..183066)
FT                   /db_xref="GeneID:9505414"
FT                   /locus_tag="Closa_0166"
FT   CDS_pept        complement(182641..183066)
FT                   /locus_tag="Closa_0166"
FT                   /gene_family="HOG000061066" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF01230"
FT                   /codon_start="1"
FT                   /product="histidine triad (HIT) protein"
FT                   /transl_table="11"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   cpy:Cphy_0406 histidine triad (HIT) protein"
FT                   /db_xref="GI:302384610"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="GeneID:9505414"
FT                   /translation="MIMKDPNCAYCMKGELVAKFGYPICEMETGFLYLFKEQSKRGRVI
FT                   LAYKDHVSELVDIEDVERNAFFSDVARVSRAVHKVFQPDKVNYGAYGDTGCHLHMHIVP
FT                   KYNGEDEWGSTFAMNPDKVYLSDKEYEEMAAAIRAAL"
FT                   /protein_id="YP_003820432.1"
FT   misc_feature    complement(182752..183048)
FT                   /note="HIT family: HIT (Histidine triad) proteins, named
FT                   for a motif related to the sequence HxHxH/Qxx (x, a
FT                   hydrophobic amino acid), are a superfamily of nucleotide
FT                   hydrolases and transferases, which act on the
FT                   alpha-phosphate of ribonucleotides. On the...; Region:
FT                   HIT_like; cl00228"
FT                   /db_xref="CDD:174049"
FT                   /locus_tag="Closa_0166"
FT   misc_feature    complement(order(182764..182766,182770..182772,
FT                   182782..182784,182932..182934,182938..182940,
FT                   182962..182964,182968..182970))
FT                   /note="nucleotide binding site/active site; other site"
FT                   /db_xref="CDD:29586"
FT                   /locus_tag="Closa_0166"
FT   misc_feature    complement(order(182758..182766,182770..182772,
FT                   182776..182778))
FT                   /note="HIT family signature motif; other site"
FT                   /db_xref="CDD:29586"
FT                   /locus_tag="Closa_0166"
FT   misc_feature    complement(182770..182772)
FT                   /note="catalytic residue; other site"
FT                   /db_xref="CDD:29586"
FT                   /locus_tag="Closa_0166"
FT   gene            complement(183092..183496)
FT                   /db_xref="GeneID:9505415"
FT                   /locus_tag="Closa_0167"
FT   CDS_pept        complement(183092..183496)
FT                   /locus_tag="Closa_0167"
FT                   /gene_family="HOG000132927" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02481"
FT                   /codon_start="1"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /transl_table="11"
FT                   /note="KEGG: tit:Thit_0220 hemerythrin-like metal-binding
FT                   protein; TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: Hemerythrin HHE cation binding domain protein"
FT                   /db_xref="GI:302384611"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="GeneID:9505415"
FT                   /translation="MAYTFTKELETGNQLIDSEHRQLIDAINNLLAACSTGKGRAELAN
FT                   TAKFLQDYTARHFGNEEKLQVQYQYPDYVNHKRYHEEFKKVVAGICSKLDKEGPTIALV
FT                   GEVNSAIAGWLINHIKREDAKVAAHIKGRS"
FT                   /protein_id="YP_003820433.1"
FT   misc_feature    complement(183122..183490)
FT                   /note="Hemerythrin (Hr) is a non-heme diiron oxygen
FT                   transport protein found in four marine invertebrate phyla
FT                   including priapulida, brachiopoda, sipunculida, and
FT                   annelida, as well as in protozoa. Myohemerythrin (Mhr), a
FT                   hemerythrin homolog, is found in the...; Region:
FT                   Hemerythrin; cl11605"
FT                   /db_xref="CDD:159574"
FT                   /locus_tag="Closa_0167"
FT   misc_feature    complement(183107..183487)
FT                   /note="hemerythrin-like metal-binding domain; Region:
FT                   hemeryth_dom; TIGR02481"
FT                   /db_xref="CDD:162878"
FT                   /locus_tag="Closa_0167"
FT   misc_feature    complement(order(183233..183235,183245..183247,
FT                   183287..183289,183293..183301,183311..183313,
FT                   183317..183322,183329..183346,183350..183355,
FT                   183410..183415,183422..183427,183431..183436,
FT                   183443..183448,183455..183457,183467..183469,
FT                   183476..183487))
FT                   /note="octamerization interface; other site"
FT                   /db_xref="CDD:29622"
FT                   /locus_tag="Closa_0167"
FT   misc_feature    complement(order(183128..183130,183143..183145,
FT                   183257..183259,183269..183271,183314..183316,
FT                   183326..183328,183437..183439))
FT                   /note="diferric-oxygen binding site; other site"
FT                   /db_xref="CDD:29622"
FT                   /locus_tag="Closa_0167"
FT   gene            complement(183532..183747)
FT                   /db_xref="GeneID:9505416"
FT                   /locus_tag="Closa_0168"
FT   CDS_pept        complement(183532..183747)
FT                   /locus_tag="Closa_0168"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: gsu:GSU2603 30S ribosomal protein S1"
FT                   /db_xref="GI:302384612"
FT                   /db_xref="GeneID:9505416"
FT                   /translation="MECFTPLMSNNRFVLARLLRRAFSDTFLKMESTRGIRTANTRIQA
FT                   EIKKAWNVPWLITAEKLPVGFLLEMV"
FT                   /protein_id="YP_003820434.1"
FT   gene            complement(183747..184481)
FT                   /db_xref="GeneID:9505417"
FT                   /locus_tag="Closa_0169"
FT   CDS_pept        complement(183747..184481)
FT                   /locus_tag="Closa_0169"
FT                   /gene_family="HOG000064978" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR00502"
FT                   /codon_start="1"
FT                   /product="glucosamine-6-phosphate isomerase"
FT                   /transl_table="11"
FT                   /note="KEGG: ere:EUBREC_2927 glucosamine-6-phosphate
FT                   deaminase; TIGRFAM: glucosamine-6-phosphate isomerase;
FT                   PFAM: glucosamine/galactosamine-6-phosphate isomerase"
FT                   /db_xref="GI:302384613"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR018321"
FT                   /db_xref="InterPro:IPR018322"
FT                   /db_xref="GeneID:9505417"
FT                   /translation="MKLYRAKDYNDMSRKAANIISAQIIMKPNCVLGLATGSTPVGTYK
FT                   QLVEWYNKGDLDFSQVKTANLDEYKGLTRNNDQSYYYFMRENLFRHVNIDEANTNIPDG
FT                   TETDASKEAARYEDIIRSLGGVDLQLLGLGHNGHIGFNEPSDIFPKDTHIVDLQESTIE
FT                   ANKRFFSSIDEVPRQAYTMGIGTIMRAKKILLIISGADKADILHDVICGPVTSRVPASI
FT                   LQLHPDVIIVADEAALSKVKNI"
FT                   /protein_id="YP_003820435.1"
FT   misc_feature    complement(183759..184451)
FT                   /note="GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P)
FT                   deaminase subfamily; GlcN6P deaminase catalyzes the
FT                   reversible conversion of GlcN6P to D-fructose-6-phosphate
FT                   (Fru6P) and ammonium. The reaction is an aldo-keto
FT                   isomerization coupled with an amination...; Region:
FT                   GlcN6P_deaminase; cd01399"
FT                   /db_xref="CDD:73165"
FT                   /locus_tag="Closa_0169"
FT   misc_feature    complement(order(183876..183878,183981..183983,
FT                   184062..184064,184068..184070,184083..184088,
FT                   184281..184286,184365..184376))
FT                   /note="active site"
FT                   /db_xref="CDD:73165"
FT                   /locus_tag="Closa_0169"
FT   misc_feature    complement(order(183804..183812,183834..183854,
FT                   184014..184016,184038..184043,184047..184049))
FT                   /note="trimer interface; other site"
FT                   /db_xref="CDD:73165"
FT                   /locus_tag="Closa_0169"
FT   misc_feature    complement(order(184014..184025,184041..184046))
FT                   /note="allosteric site; other site"
FT                   /db_xref="CDD:73165"
FT                   /locus_tag="Closa_0169"
FT   misc_feature    complement(order(183954..183962,183969..184001,
FT                   184008..184010))
FT                   /note="active site lid"
FT                   /db_xref="CDD:73165"
FT                   /locus_tag="Closa_0169"
FT   misc_feature    complement(order(183759..183770,183777..183779,
FT                   183870..183872,183882..183884,183993..183995))
FT                   /note="hexamer (dimer of trimers) interface; other site"
FT                   /db_xref="CDD:73165"
FT                   /locus_tag="Closa_0169"
FT   gene            184600..186285
FT                   /db_xref="GeneID:9505418"
FT                   /locus_tag="Closa_0170"
FT   CDS_pept        184600..186285
FT                   /locus_tag="Closa_0170"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /codon_start="1"
FT                   /product="hypothetical protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cpy:Cphy_3896 hypothetical protein"
FT                   /db_xref="GI:302384614"
FT                   /db_xref="GeneID:9505418"
FT                   /translation="MPNYRRLISYIYAYEGAVKGKNIGFAKIETRGVQCKITVSVKRIY
FT                   VGGNDIGVFLLAAADQEIFLGNIFIRGGSGEFRTVVSASDIEHSGINVDQCYGLTIHDV
FT                   KNTWRSYTTIWEDAVAHAAEVDLGSMAAAISGKEQAVISEEQIKRAVREIEEEFPLKSD
FT                   ESQEALQTDVSHADEALGASSKDQEDEMAAPASEIQEQPEENDLQAENLDAEAEEPDEE
FT                   TGAMAAPDDKELVNAESENVEQIMSDETETEIETEEEVQYDGTEEIRLEEAAESDTEPD
FT                   ASAAMNARQQEYWDQAEEPIPEALQEELQSAEEPIPEALQEELQSAEEPMPEALQEELQ
FT                   SAEEPVSEERQSAGQEDIPDELQGEELENREAVDVQEREAVFSEPYPCSGQDMTEDHTL
FT                   CYRADAVIKEDRSDPEVRPELGNPDELERLRQNEDMELSSHEMIWEKLKREHTRILAFD
FT                   YEDGCEILTIKPQDIGLLPRDAWVYGNNSFLLHGYYNYRYLILAKLLNPSGMPRYLLGI
FT                   PGHYYSNERYMASMFGFPNFVLSKDQPMEDGRFGFWYTDVKLGG"
FT                   /protein_id="YP_003820436.1"
FT   misc_feature    <184957..185319
FT                   /note="prolipoprotein diacylglyceryl transferase; Reviewed;
FT                   Region: PRK13108"
FT                   /db_xref="CDD:171865"
FT                   /locus_tag="Closa_0170"
FT   gene            complement(186310..187005)
FT                   /db_xref="GeneID:9505419"
FT                   /locus_tag="Closa_0171"
FT   CDS_pept        complement(186310..187005)
FT                   /locus_tag="Closa_0171"
FT                   /gene_family="HOG000228031" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:TFAM:TIGR02495"
FT                   /codon_start="1"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /transl_table="11"
FT                   /note="KEGG: cpy:Cphy_3894 anaerobic
FT                   ribonucleoside-triphosphate reductase activating protein;
FT                   TIGRFAM: anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein; PFAM: Radical SAM domain protein"
FT                   /db_xref="GI:302384615"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012840"
FT                   /db_xref="GeneID:9505419"
FT                   /translation="MKVCGLQKTTLLDFPGHVAATVFLGGCNFRCPFCHNSGLIGSEAK
FT                   SEYSKEELLNFLSRRKGILEGVCITGGEPTLSEDLESFIRNIRELGYLIKLDTNGYRPD
FT                   VLKRLAANGLLDYVAMDIKAGRDNYSAAAGVKDIKISEIEESAEFLLEGSVPYEFRTTA
FT                   VKGIHSIRDFMDIGEWLAGCSHYYLQNYADSGQVLCSGFQPFSKGELDQFFNVLKPLIP
FT                   NALLRGIDN"
FT                   /protein_id="YP_003820437.1"
FT   misc_feature    complement(186433..187002)
FT                   /note="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein; Region: NrdG2; TIGR02495"
FT                   /db_xref="CDD:162888"
FT                   /locus_tag="Closa_0171"
FT   misc_feature    complement(186460..186942)
FT                   /note="Radical SAM superfamily. Enzymes of this family
FT                   generate radicals by combining a 4Fe-4S cluster and
FT                   S-adenosylmethionine (SAM) in close proximity. They are
FT                   characterized by a conserved CxxxCxxC motif, which
FT                   coordinates the conserved iron-sulfur cluster...; Region:
FT                   Radical_SAM; cd01335"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="Closa_0171"
FT   misc_feature    complement(order(186520..186522,186649..186651,
FT                   186709..186714,186787..186792,186796..186798,
FT                   186901..186909,186913..186915,186919..186921,
FT                   186925..186927))
FT                   /note="FeS/SAM binding site; other site"
FT                   /db_xref="CDD:100105"
FT                   /locus_tag="Closa_0171"
FT   gene            187196..187690
FT                   /db_xref="GeneID:9505420"
FT                   /locus_tag="Closa_0172"
FT   CDS_pept        187196..187690
FT                   /locus_tag="Closa_0172"
FT                   /gene_family="HOG000085050" [ FAMILY / ALN / TREE ]
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /codon_start="1"
FT                   /product="CMP/dCMP deaminase zinc-binding protein"
FT                   /transl_table="11"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   ere:EUBREC_0302 cytidine and deoxycytidylate deaminase
FT                   family protein"
FT                   /db_xref="GI:302384616"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="GeneID:9505420"
FT                   /translation="MTIDEKYMRAAIRQAEKAGAMGEVPIGCVIVYEDKIIARGYNRRT
FT                   IDKNVLSHAEINAIRKACRKVGDWRLEGCTMYVTLEPCPMCAGAIVQARIPKVIMGCMN
FT                   AKAGCAGSVLDLFHQDGLNHQVETESGVLGDECSRLMKDFFKALREKSKKKPEGISFIT
FT                   P"
FT                   /protein_id="YP_003820438.1"
FT   misc_feature    187217..187540
FT                   /note="Nucleoside deaminases include adenosine, guanine and
FT                   cytosine deaminases. These enzymes are Zn dependent and
FT                   catalyze the deamination of nucleosides. The zinc ion in
FT                   the active site plays a central role in the proposed
FT                   catalytic mechanism, activating a...; Region:
FT                   nucleoside_deaminase; cd01285"
FT                   /db_xref="CDD:29828"
FT                   /locus_tag="Closa_0172"
FT   misc_feature    order(187271..187273,187319..187321,187352..187360,
FT                   187442..187444,187451..187453)
FT                   /note="nucleoside/Zn binding site; other site"
FT                   /db_xref="CDD:29828"
FT                   /locus_tag="Closa_0172"
FT   misc_feature    order(187346..187348,187361..187363,187373..187375,
FT                   187445..187450,187457..187462,187469..187474)
FT                   /note="dimer interface; other site"
FT                   /db_xref="CDD:29828"
FT                   /locus_tag="Closa_0172"
FT   misc_feature    order(187352..187360,187439..187444,187451..187453)
FT                   /note="catalytic motif; other site"
FT                   /db_xref="CDD:29828"
FT                   /locus_tag="Closa_0172"
FT   gene            187854..187957
FT                   /db_xref="GeneID:9505421"
FT                   /locus_tag="Closa_R0012"