(data stored in ACNUC7421 zone)

EMBL: CP000031.ACKA

CP000031.ACKA        Location/Qualifiers
FT   CDS_pept        122521..123705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="SPO0116"
FT                   /product="acetate kinase"
FT                   /EC_number="2.7.2.1"
FT                   /note="identified by match to protein family HMM PF00871;
FT                   match to protein family HMM TIGR00016"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0116"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93446"
FT                   /db_xref="GOA:Q5LWR6"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWR6"
FT                   /protein_id="AAV93446.1"
FT                   /translation="MTDVVLVLNAGSSSIKFAVYPSGTNTVPLIRGKVAGVGRDPVFSA
FT                   VRADGTAIDMVMPKNIDAAADHEALISLLLDWLAEHRADRRLVAVGHRVVHGGRDFLKP
FT                   VIVDDSVLSQLEQLIPLAPLHQPHNLAAIRAISRLQPTVPQVACFDTSFHQTQDRLAQL
FT                   FALPRDLSDEGIIRYGFHGLSYEYIAGILPDHLGERAEGRVIVAHLGNGASMCAMKNRQ
FT                   SVATSMGFTALDGLMMGRRCGALDAGVVLYLMQSKGLNATEIETLLYRRCGLLGVSGIS
FT                   NNMRELERSDDPKAREAIELFCFRAASVLGGLVTALGGLDAIVFTAGIGENSALVRKLI
FT                   CDRLACFGVDLDPNSNEGNSPRIGSVQSSIDVLVLPTDEEIVISNATNETVALG"
     atgacggacg tagtactggt tctcaatgcc ggttcgtcga gtatcaagtt cgccgtctac        60
     ccgagtggta cgaacacggt tcccctgatc cgcggcaagg tggccggtgt cggacgtgat       120
     cccgtcttct ccgcagttcg cgcggacggt actgcaatcg acatggtcat gccaaagaac       180
     atcgacgccg cagccgatca tgaagcgttg atatcactcc ttctggattg gctggcagag       240
     catcgcgcgg acagaagact tgtcgccgtc gggcacagag tcgttcacgg tggacgtgat       300
     ttcctcaagc cggttatcgt cgatgactca gttctgagcc agttggaaca actgattccg       360
     ctcgcaccgc tgcatcagcc gcacaacctt gctgccatcc gcgcaatatc gcggttgcag       420
     ccgacagtac cccaggtcgc ctgcttcgac acgagctttc accagaccca ggaccggctt       480
     gcccaactat tcgccctgcc tcgggatctg agcgatgaag gcattatccg ctatggcttt       540
     cacgggctgt cctatgagta tatcgcagga attctgcccg atcatcttgg cgaaagggcc       600
     gagggccggg tgatcgttgc tcatctcggt aacggcgcca gcatgtgcgc gatgaagaac       660
     cggcaaagtg tcgcgacaag catggggttt acggcgcttg acgggctgat gatggggcgg       720
     cgctgtggcg cgctcgacgc gggcgtcgtt ctctacctca tgcaaagcaa gggtctgaac       780
     gcgaccgaga tcgaaacgct gctctatcga cgctgcggcc ttctcggtgt ctcggggatc       840
     agcaacaaca tgcgggagct ggaacggagc gacgacccga aggcccgcga ggcgatcgag       900
     ctattctgct tccgggcggc gagcgttctt ggcggcctgg tcacggcgct tggcgggctt       960
     gacgcgatcg ttttcactgc agggattgga gagaattcgg cgctggttcg caaattgatt      1020
     tgtgaccggc ttgcgtgttt tggcgtcgat ctggatccaa acagcaatga aggcaactcg      1080
     cctcgcattg gttcggtgca atcttctatt gacgtgcttg ttctgccgac cgacgaagaa      1140
     atcgtcatat ccaatgccac gaacgaaacg gtcgcgctcg ggtag                      1185
//

If you have problems or comments...

PBIL Back to PBIL home page