(data stored in ACNUC7421 zone)

EMBL: CP000031.ARGG

CP000031.ARGG        Location/Qualifiers
FT   CDS_pept        complement(17129..18358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="SPO0018"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="identified by match to protein family HMM PF00764;
FT                   match to protein family HMM TIGR00032"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0018"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93349"
FT                   /db_xref="GOA:Q5LWG3"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWG3"
FT                   /protein_id="AAV93349.1"
FT                   /translation="MSAPKKVVLAYSGGLDTSIILKWLQTEYGCEVVTFTADLGQGEEL
FT                   EPARKKAELLGIKPENIHIEDVREEFVRDFVFPMFRANAVYEGLYLLGTSIARPLISKR
FT                   LVEIAAEHGADAVAHGATGKGNDQVRFELSAYALNPEIRVIAPWRLWDLTSRTRLLEFA
FT                   EAHQIPISKDKRGEAPFSVDANLLHTSSEGKVLEDPGVEAPDYVAQRIVAVEDAPDTPE
FT                   FIEVTFEKGDAVAINGEAMSPATILTRLNELGGKHGIGLLDFVENRFVGMKSRGVYETP
FT                   GGTILLEAHRGIEQITLDSGAGHLKDSIMPRYAELIYNGFWFSPEREMLQALIDKSQEH
FT                   VTGTVRLKLYKGSARTVARWSDHSLYSEAHVTFEEDAGAYDQQDAKGFIQLNALRLKLL
FT                   ATRNRRVAGK"
     atgtccgcgc ccaagaaagt tgtcctggcc tattccggtg gcctcgatac ctcgatcatc        60
     ctgaaatggt tgcagaccga atatggctgc gaggttgtca cctttaccgc cgatctcggc       120
     cagggagagg agctggaacc cgcccgcaaa aaggccgagc tgctgggcat caagcccgag       180
     aacatccata tcgaggatgt ccgcgaagag ttcgtgcgcg actttgtctt tccgatgttc       240
     cgcgccaatg cggtgtacga ggggctgtat ttgctgggca cttcgatcgc gcggccgctg       300
     atctcgaaac gtctggtcga gatcgccgcc gaacacggcg ctgacgcggt ggcccatggc       360
     gccaccggca agggcaacga ccaggtgcgg ttcgagcttt ccgcctatgc gctgaacccc       420
     gagatcaggg tgatcgcgcc ctggcgcctg tgggatctga ccagccgcac ccgtctgctg       480
     gaattcgccg aagcgcatca gattccgatt tcgaaggaca agcgcggcga ggcgccgttc       540
     tcggtcgacg cgaacctgct gcacacctcg tccgagggca aggtgctgga ggatccgggc       600
     gtcgaggcgc ccgattacgt cgcccaacgc atcgtcgcgg tcgaagacgc ccccgacacg       660
     cccgagttca tcgaagttac ctttgaaaag ggtgacgcgg tggcgatcaa cggcgaggcg       720
     atgtcgcccg caaccatcct gacccgtctg aacgagttgg gtggcaagca cggtatcggc       780
     ctcttggatt tcgtcgaaaa ccgctttgtc gggatgaaat cgcgcggcgt ctacgagacc       840
     cccggcggga ccatcctgct cgaggcacat cgcggcatcg aacagatcac gctggacagc       900
     ggcgcgggcc acctgaagga ttcgatcatg ccccgctatg ccgagctgat ctataacggc       960
     ttctggttca gccccgagcg cgagatgctg caggccctga tcgacaagag ccaggagcac      1020
     gtcaccggca ccgtccggct gaaactctac aagggttcgg cgcgcaccgt cgcccgctgg      1080
     tcggatcact cgctctattc cgaggcccac gtgaccttcg aagaggacgc cggcgcctat      1140
     gaccagcagg atgccaaggg cttcatccag ctgaacgcgc tgcggctgaa actgcttgcg      1200
     acccgcaacc gtcgcgttgc tggcaagtga                                       1230
//

If you have problems or comments...

PBIL Back to PBIL home page