(data stored in ACNUC9435 zone)

EMBL: CP000031.ARGH

CP000031.ARGH        Location/Qualifiers
FT   CDS_pept        342602..343993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="SPO0332"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="identified by similarity to SP:P59615; match to
FT                   protein family HMM PF00206; match to protein family HMM
FT                   TIGR00838"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0332"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93650"
FT                   /db_xref="GOA:Q5LXC0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LXC0"
FT                   /protein_id="AAV93650.1"
FT                   /translation="MTDKTSNQMWGGRFAAGPDAIMEAINASIGFDKRLAAQDIAGSRA
FT                   HAAMLAATGVITDSDAEAIREGLLTVLSEIEAGEFTFSTALEDIHMNVEARLKEIIGEP
FT                   AGRLHTARSRNDQVATDFKLWVRDQFDAAEAGLLALLRALLGQAEAGADWVMPGFTHLQ
FT                   TAQPVTWGHHMMAYVEMFGRDLSRVRDARARMNESPLGSAALAGTSFPIDRHMTAAALG
FT                   FDRPTANSLDAVSDRDFALEFLSVASICAMHLSRFAEELVIWSSAQFRFVTLSDRFSTG
FT                   SSIMPQKKNPDAAELIRAKVGRIFGANTALMMVMKGLPLAYSKDMQEDKEQVFDAADNW
FT                   MLALAAMEGMVRDMTANRDSLAAAAGSGFSTATDLADWLVRVLGLPFRDAHHVTGALVA
FT                   LAESKGCDLPDLSLDEMQSAHAAITEDVYGVLGVENSVNSRQSYGGTAPAQVRAQVARW
FT                   KEMLA"
     atgaccgaca agacctcgaa ccagatgtgg ggcggccgct ttgccgccgg accggacgcg        60
     atcatggagg cgatcaacgc ctcgatcggg ttcgacaagc gactggcggc ccaggacatc       120
     gcgggttcgc gggcccatgc ggccatgttg gcggccacgg gcgttattac ggatagtgat       180
     gccgaggcca ttcgggaagg cctgctcacc gttttgtcag agatcgaggc gggagagttt       240
     accttttcca ccgcgctgga ggacattcac atgaatgtcg aggcgcggct gaaggaaatc       300
     atcggcgaac cggcgggccg gctgcatacc gcgcggtcgc gcaacgacca ggtggcgacc       360
     gatttcaaac tgtgggtgcg cgatcagttc gatgccgccg aagcgggcct cctcgcgctc       420
     ttgcgagcgc tcctcggcca ggccgaggcg ggggccgatt gggtgatgcc gggcttcacc       480
     catctccaga ccgcacagcc ggtgacctgg ggccatcaca tgatggccta tgtcgagatg       540
     ttcggccgcg atctgagccg ggtgcgcgac gcccgcgcac ggatgaacga atcgcccctg       600
     ggttcggcgg cgctggcggg aacgtcgttc ccgatcgacc ggcacatgac ggcggcggcg       660
     ctgggctttg accggcctac cgccaactcg ttggacgcag tgagtgatcg tgatttcgcg       720
     ctggagttcc tgtcggtcgc ctcgatctgt gccatgcatc tgagccgctt tgccgaggag       780
     ctggtgatct ggtccagcgc ccagttccgc tttgtcacgc tcagcgaccg gttttcgacc       840
     ggctcgtcga tcatgccgca gaagaagaac cccgacgcgg ccgaactgat ccgggccaag       900
     gtgggccgca tctttggcgc caataccgcg ctgatgatgg tgatgaaggg gctgccgcta       960
     gcttattcca aggacatgca ggaggacaag gaacaggtct tcgatgctgc cgacaactgg      1020
     atgctggcac tggcggcgat ggaaggcatg gtgcgcgaca tgaccgccaa ccgcgacagc      1080
     ctcgccgcgg ctgcgggctc tggtttctcg accgcgaccg atctggccga ctggctggtg      1140
     cgtgtgctgg gcctgccgtt ccgggatgcc catcacgtga ccggtgcgct ggttgcgctg      1200
     gccgaaagca aaggctgcga tctgccggac ctgagcctgg atgagatgca atcggcccat      1260
     gccgcgatca ccgaggatgt ctatggtgtc cttggggtgg aaaattcggt aaactcgcgc      1320
     cagagctatg gcggcaccgc gcccgcgcag gtgcgcgcgc aggtcgcccg ctggaaggag      1380
     atgctggcat ga                                                          1392
//

If you have problems or comments...

PBIL Back to PBIL home page