(data stored in ACNUC7421 zone)

EMBL: CP000031.BPHC3

CP000031.BPHC3       Location/Qualifiers
FT   CDS_pept        complement(403532..404017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bphC3"
FT                   /locus_tag="SPO0391"
FT                   /product="biphenyl-2,3-diol 1,2-dioxygenase III"
FT                   /EC_number="1.13.11.39"
FT                   /note="identified by similarity to SP:P47233; match to
FT                   protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0391"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93709"
FT                   /db_xref="GOA:Q5LXH2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXH2"
FT                   /protein_id="AAV93709.1"
FT                   /translation="MTYSAPAGTCVGHVHLKVSDLDRAIAFYRDVLGFEVQQRYGDAAA
FT                   FLGAGGYHHHIGLNTWHSRGGPQPPARATGLYHSAFLYPDRKALGTVLRQVIEAGIPID
FT                   GSADHGVSEAVYLRDPDGNGVELYRDRAPEDWPRDGEGNLAMTNAPLDIPALLAEAG"
     atgacctatt ccgcccctgc cggcacctgt gtcggccatg tccacctgaa agtatccgat        60
     ctggaccggg ccatcgcctt ttaccgcgat gtgctgggat tcgaggtgca acagagatac       120
     ggcgacgccg ccgcctttct gggtgccggt ggctatcacc atcatatcgg gctgaacacc       180
     tggcacagcc ggggcggccc gcaaccgccc gcgcgggcga ccggtctgta tcattcggcc       240
     ttcctctatc ccgaccgcaa ggcgctggga acggtgctcc ggcaggtgat cgaggccggg       300
     ataccgatcg acggctctgc cgatcacggg gtcagcgagg cggtctatct gcgcgacccc       360
     gacggcaacg gggtcgaact gtatcgcgac cgcgcacccg aggactggcc gcgcgatggc       420
     gagggcaatc tcgcgatgac aaacgcgccg ctcgacatcc ccgcgctgct ggccgaggcc       480
     ggatag                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page