(data stored in ACNUC7421 zone)

EMBL: CP000031.CCPA

CP000031.CCPA        Location/Qualifiers
FT   CDS_pept        340918..341967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccpA"
FT                   /locus_tag="SPO0330"
FT                   /product="cytochrome c peroxidase"
FT                   /EC_number="1.11.1.5"
FT                   /note="identified by similarity to SP:P14532; match to
FT                   protein family HMM PF03150"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0330"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93648"
FT                   /db_xref="GOA:Q5LXC2"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR026259"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXC2"
FT                   /protein_id="AAV93648.1"
FT                   /translation="MSPKSLFSFSLTALSCTAGLAAANPLREQALELFQPLPSTVPAVK
FT                   DNPITPEKIDLGKALFFDPRMSASGVFSCNSCHNLATGGDDNLETSIGHGWQKGPRNAP
FT                   TVLNAVFNAAQFWDGRAPDLAEQAKGPVQAGVEMANTPGQVVATLNSMPEYVAWFQAAF
FT                   PDQPDPVSFDSFAKAIEAYEATLITPAPFDAWLNGDDAALSGEQKQGLSLFIDAGCASC
FT                   HGGVNLGGQDYYPFGLVETPDAEVLPSGDKGRFAVTATEDDEYVFRAAPLRNIAVTAPY
FT                   FHSGKVWELEAAVSIMASSQLGADLSEEETAAITAFLHSLTGEVPQVVYPVLPAETSGT
FT                   PRPDGAVQR"
     atgtccccta aatccctctt ctcattcagc cttaccgctt tgtcctgtac cgccggcctg        60
     gccgccgcca acccgttgcg cgaacaggcg ctggagctgt ttcagccact gccctcgacc       120
     gtgcccgcgg tcaaggacaa cccgatcacg cccgaaaaga tcgacctggg caaggcgctg       180
     ttctttgatc cgcgcatgtc cgcatcgggg gttttttcct gcaactcctg ccacaatctg       240
     gcgacggggg gcgatgacaa tctggaaacc tcgatcggtc atggctggca aaaggggccg       300
     cgcaacgcgc cgaccgtgct gaacgccgtg ttcaatgcgg cgcagttctg ggacgggcgc       360
     gcgcccgacc tggccgaaca ggccaagggg cctgtgcagg ccggggtcga gatggcgaac       420
     accccggggc aggtggttgc gacgctgaat tcgatgcccg aatatgtcgc ttggtttcag       480
     gcggcctttc ccgaccagcc cgatccggtg agctttgaca gttttgccaa ggcgatcgag       540
     gcctatgagg caacgctgat cacgcctgcg cccttcgatg cctggctgaa cggggacgat       600
     gccgcgctga gcggcgagca gaagcagggt ctgagcctgt tcatcgacgc cggttgcgcc       660
     agctgccatg gcggcgtcaa tctgggcggg caggactatt acccgttcgg cctggtcgaa       720
     accccggatg ccgaggtgct gccctcgggc gacaaggggc gttttgcggt gaccgcgacc       780
     gaggatgacg aatacgtgtt ccgtgccgcg ccgctgcgca atatcgcggt gaccgcgccc       840
     tatttccact cgggcaaggt ctgggagttg gaggcggcgg tgtccatcat ggccagttca       900
     cagttgggag ccgatctgag cgaagaggag acggcggcga tcaccgcgtt tctacactcg       960
     ctgaccggcg aggtgccaca ggtggtctat ccggtcttgc ccgctgagac atcgggcaca      1020
     ccgcgccctg acggcgcggt tcagcgctag                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page