(data stored in ACNUC7421 zone)

EMBL: CP000031.CCRA

CP000031.CCRA        Location/Qualifiers
FT   CDS_pept        384226..385512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccrA"
FT                   /locus_tag="SPO0370"
FT                   /product="crotonyl-CoA reductase"
FT                   /note="identified by match to protein family HMM PF00107;
FT                   match to protein family HMM TIGR01751"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0370"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93688"
FT                   /db_xref="GOA:Q5LXF6"
FT                   /db_xref="InterPro:IPR010085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXF6"
FT                   /protein_id="AAV93688.1"
FT                   /translation="MALDTDSGIASYAAPEKDLYEMGEIPPMGFVPKKMYAWAIRKERH
FT                   GDPDTAMQVEVVDVPTLDSHEVLVLVMAAGVNYNGVWASKGVPISPFDGHGQPYHIAGS
FT                   DASGIVWAVGDKVKRWKVGDEVVIHCNQDDGDDEHCNGGDPMYSPSQRIWGYETPDGSF
FT                   AQFTNVQAQQLMPRPKHLTWEEAACYTLTLATAYRMLFGHEPHDLKPGQNVLVWGASGG
FT                   LGSYAIQLINTAGANAIGVISDESKRQFVMDLGAKGVINRKDFNCWGQLPTVNTPEYAE
FT                   WFKEARKFGKAIWDITGKGVNVDMVFEHPGESTFPVSTFVVKKGGMVVICAGTSGYNLT
FT                   FDVRYMWMHQKRLQGSHFAHLKQAMAANQLMVERRLDPCMSEVFTWADLPEAHMKMMRN
FT                   EHKPGNMSVLVQSPRTGLRTLEEVLDARG"
     atggctttgg acaccgacag cggtatcgcg tcctacgcgg cgcccgagaa agacctctat        60
     gagatgggtg aaatcccccc gatgggattc gtgcccaaga agatgtatgc gtgggcgatc       120
     cgcaaagagc gccacggtga tcccgatacc gcgatgcagg tcgaagtggt tgacgtgccg       180
     acgctcgaca gccacgaggt gctggttctg gtgatggccg ctggcgtcaa ctacaatggc       240
     gtctgggcct ccaaaggtgt tccgatttcc cccttcgatg gccacggaca gccctatcac       300
     atcgccggtt ccgatgcttc gggtatcgtc tgggccgtgg gggacaaggt caagcgctgg       360
     aaggtcggcg acgaggtcgt gatccactgc aatcaggatg atggtgacga cgagcactgc       420
     aatggcggtg acccgatgta ttcgcccagt cagcggatct ggggttacga gacgccggac       480
     ggatcctttg ctcagttcac caatgtgcag gcgcagcagc tgatgccgcg gcccaagcac       540
     ctgacctggg aagaagcggc atgttacacg ctgacgctgg cgaccgccta ccggatgctg       600
     tttggccatg agccgcatga tctcaagccc ggtcagaacg ttctggtctg gggtgcgtcc       660
     ggtggtctgg ggtcctatgc gatccagctt atcaatacgg cgggtgcgaa cgcgattggc       720
     gtcatctcgg atgaaagcaa gcgccagttt gtcatggacc ttggcgcaaa gggtgtcatc       780
     aaccgcaagg atttcaactg ctggggtcaa ctgcccacgg tgaacacccc cgaatatgcc       840
     gagtggttca aggaagcccg caagttcggc aaggcgatct gggacattac cggcaagggc       900
     gtgaacgtgg acatggtctt cgagcacccc ggcgagagca cgttcccggt ctcgaccttc       960
     gtggtgaaga agggcggtat ggttgtgatc tgcgcgggca ccagcggcta caacctgacc      1020
     tttgacgtgc gctatatgtg gatgcaccag aagcgccttc agggcagcca cttcgcccat      1080
     ctcaagcagg caatggccgc gaaccagctg atggtcgagc gccggctcga cccgtgcatg      1140
     tccgaggtgt tcacctgggc cgatctgccc gaggcgcata tgaagatgat gcgcaacgag      1200
     cacaagccgg gcaacatgtc ggtgctggtg caatcgcccc gcaccgggct gcgcaccctc      1260
     gaagaggttc tggacgcccg cggttaa                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page