(data stored in ACNUC7421 zone)

EMBL: CP000031.COBO

CP000031.COBO        Location/Qualifiers
FT   CDS_pept        complement(280092..280691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobO"
FT                   /locus_tag="SPO0262"
FT                   /product="cob(I)alamin adenosyltransferase"
FT                   /EC_number="2.5.1.17"
FT                   /note="identified by match to protein family HMM PF02572;
FT                   match to protein family HMM TIGR00708"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0262"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93582"
FT                   /db_xref="GOA:Q5LX46"
FT                   /db_xref="InterPro:IPR003724"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX46"
FT                   /protein_id="AAV93582.1"
FT                   /translation="MTDAQDHKEKMKAVQAEHRKKVSEAVDPGRGLVLINTGKGKGKSS
FT                   AAFGVVIRALGWGQKVAVVQFIKGKWKTGERRFFEEHNLVTWHTMGEGFTWDTQDRDRD
FT                   IAAATAAFGKARELMESGDYDLVVLDEINIALRYEYLSVDTVLDGLQARSDRTSVFLTG
FT                   RDAPQALRDYADLVTEMTVEKHPFEAGIKAQRGVDF"
     atgaccgacg cgcaggacca caaggaaaag atgaaggccg tacaggccga acaccgcaag        60
     aaagtctccg aggcggtcga ccccggccgc gggctggtgc tgatcaatac cggcaaaggc       120
     aagggcaaat cctcggccgc cttcggcgtg gtgatccgcg cgctcggctg ggggcaaaag       180
     gttgccgtgg tccagttcat caagggcaag tggaagaccg gcgagcgccg ctttttcgag       240
     gaacacaacc tggtgacctg gcacacgatg ggcgagggct tcacctggga cacccaggat       300
     cgcgaccgcg acatcgccgc cgccacagcc gcctttggca aggcgcgcga gctgatggaa       360
     agcggcgact acgacctcgt ggtgctcgac gagatcaata tcgcgctgcg ctatgaatac       420
     ctctcggtcg atacggtact cgacgggctt caggcgcgct cggaccgcac cagcgtgttc       480
     ctgacggggc gcgacgcacc gcaggcgctg cgcgactatg ccgatctggt gaccgagatg       540
     acggtcgaga aacacccgtt cgaggccggg atcaaggcgc aacgcggcgt ggatttctga       600
//

If you have problems or comments...

PBIL Back to PBIL home page