(data stored in ACNUC7421 zone)

EMBL: CP000031.COMM

CP000031.COMM        Location/Qualifiers
FT   CDS_pept        complement(414677..416191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comM"
FT                   /locus_tag="SPO0402"
FT                   /product="competence protein ComM"
FT                   /note="identified by similarity to SP:P45049; match to
FT                   protein family HMM PF01078; match to protein family HMM
FT                   TIGR00368"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0402"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93720"
FT                   /db_xref="GOA:Q5LWE0"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWE0"
FT                   /protein_id="AAV93720.1"
FT                   /translation="MVARAHTVAFQGVEARPVEVQCAVTPGLPAFSIVGLPDKAVSEAR
FT                   DRVRSALSGMAIALPSKRITINLSPADLPKEGSHFDLPIALALLAALEIVPADAAEATL
FT                   ALGELSLDGSLVPVVGALPAAMTAAAEDWLLLCPEASSAEAAWVDAAKVIGATSLSAVV
FT                   RHFTGQAPIDAARPGEVSAAAFERDLREVKGQERAKRALEIAAAGRHHMIMIGTPGSGK
FT                   SMLAARIPGILPPLTPVEALETSMIHSLCGLLDQGGISRTRPFREPHHTASMAAIVGGG
FT                   KGAKPGEISLAHNGVLFMDEFPEFPRTVLETLRQPIETGEVMVARANAHVKYPCRFMLV
FT                   AAANPCRCGYLSDPARACARVPVCGEDYLGRISGPLMDRFDLRIEVPPVAFTDLDLPPS
FT                   AEGSAEVAARVAAARAVQTARFGGHPTLRQNADAEGKALEEIATPDAEGRDLLLTAADR
FT                   FGLSARAYHRILRVARTIADLAGEPDIRRPHIAEALSFRVSAKALN"
     atggtcgccc gcgcccatac cgttgcgttt cagggggtcg aggcccgccc ggtcgaggtg        60
     caatgcgccg tcacgccggg cctgcccgcc ttctccattg tcggcctgcc ggacaaggcg       120
     gtgtccgagg cgcgcgaccg ggtgcgcagc gcgctcagcg gcatggccat cgcgctgcca       180
     tcgaaacgga tcaccatcaa cctgtccccc gccgacctgc ccaaggaggg cagccatttc       240
     gacctgccca tcgcgctggc cttgctggcc gcgctggaga tcgtgcccgc agatgccgcg       300
     gaggcgacgc tggcgctggg ggaactgtcg ctcgacgggt cgttggtgcc ggtggttggc       360
     gcgctgcccg ccgcgatgac ggcagctgca gaggactggc tgctgctctg ccccgaagcg       420
     tccagcgccg aggcggcctg ggttgacgcg gccaaggtga tcggggccac atccctatca       480
     gcggtggtgc gccattttac cgggcaggcc ccgatcgacg cagcccgccc cggagaggtc       540
     agcgccgccg cctttgagcg cgatctgcgc gaggtcaagg gacaggaacg ggccaaacgg       600
     gcgctggaaa tcgcggcggc gggccgacat cacatgatca tgatcggcac acccgggtcg       660
     ggcaaatcca tgctggccgc ccgcatcccc ggcatcctgc cgccattgac ccccgtcgag       720
     gcactggaaa cctcgatgat ccattcgctc tgcggcctgc tcgaccaggg cgggatcagc       780
     cgcacccggc cgtttcgcga accccatcac accgcctcga tggccgcgat tgtgggcggc       840
     ggcaagggcg cgaaaccggg agagatcagc ctggcccata acggggtgct gttcatggat       900
     gaattccccg agtttccgcg caccgtgctg gaaaccctgc gccagccaat cgagaccggc       960
     gaggtgatgg tggcgcgcgc caacgcccat gtgaaatatc cctgccggtt catgctggtg      1020
     gcggcggcca atccctgccg ctgcggctat ctcagcgatc cggcgcgggc ctgtgcccgg      1080
     gtgcccgtct gtggcgaaga ctatctgggt cgcatctcgg gacccctgat ggatcggttc      1140
     gacctcagga tcgaggtgcc accagtggcc ttcaccgatc tcgacctgcc gcccagcgcc      1200
     gaaggctcgg ccgaggtggc ggcccgggtg gcggcggcgc gggcggttca gaccgcgcgc      1260
     ttcggcggcc atccgacatt gcggcagaat gccgatgccg agggcaaggc gctggaagaa      1320
     atcgccacgc cggatgccga gggacgcgat ctattgctca ccgccgccga ccggttcggc      1380
     ctgtcggcgc gcgcctatca ccgcatcctg cgggtggcac gcaccatcgc cgatcttgcc      1440
     ggagaacccg atattcgccg cccccatatc gccgaagcgc tcagctttcg ggtatcagcc      1500
     aaggcattga attga                                                       1515
//

If you have problems or comments...

PBIL Back to PBIL home page