(data stored in ACNUC7421 zone)

EMBL: CP000031.DDSA

CP000031.DDSA        Location/Qualifiers
FT   CDS_pept        complement(331351..332349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddsA"
FT                   /locus_tag="SPO0319"
FT                   /product="decaprenyl diphosphate synthase"
FT                   /EC_number="2.5.1.31"
FT                   /note="identified by similarity to GB:CAD24417.1; match to
FT                   protein family HMM PF00348"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0319"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93637"
FT                   /db_xref="GOA:Q5LX97"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX97"
FT                   /protein_id="AAV93637.1"
FT                   /translation="MDAKVSTKPHEMLAATLSQEMAAVNALIRTRMASEHAPRIPEVTA
FT                   HLVEAGGKRLRPMLTLAAARLCGYQGEDHVKLAATVEFIHTATLLHDDVVDESGQRRGR
FT                   PTANLLWDNKSSVLVGDYLFARSFQLMVETGSLRVLDILANAAATIAEGEVLQMTAASD
FT                   LRTDESVYLQVVRGKTAALFSAATEVGGVIAGVPEAQVRALFEYGDALGIAFQIADDLL
FT                   DYQGDAKATGKNVGDDFRERKLTLPVIKAVAQATDEERAFWVRTIEKGKQAEGDLEQAL
FT                   ALMEKYGTLAATRADAHAWAEKARTALELLPNHEIRTMLSDLADYVVARLS"
     atggacgcca aggtgagcac gaaaccgcat gagatgctgg cggcaaccct gtcccaggag        60
     atggcggcgg taaatgcgtt gatccgcacc cggatggcgt cggagcacgc cccgcgcatt       120
     ccggaggtga cagcgcatct ggtcgaggcc ggcggcaaac gcctgcgccc gatgctgacg       180
     ctcgcggcgg cgcggctgtg cggctatcag ggcgaggatc atgtcaagct ggccgctacg       240
     gtcgaattca tccacaccgc caccctgctg catgacgatg tggtggacga aagcggccag       300
     cgccgcgggc ggcccaccgc caacctgctc tgggacaaca aatcctcggt gctggtgggc       360
     gattacctgt ttgcccgcag cttccagctg atggtggaaa caggctcgct cagggtgctg       420
     gatatcctgg ccaatgccgc cgccaccatc gccgagggcg aggtgctgca aatgaccgcc       480
     gccagcgacc tgcgcacgga tgagagcgtt tatctgcaag ttgtgcgggg caagacggcg       540
     gcactgtttt ccgccgcgac cgaggtcggc ggcgtgatcg ccggggtgcc cgaagcgcag       600
     gtcagggcgc tgttcgagta cggcgacgcg ctgggcatcg cctttcagat cgccgacgat       660
     ttgctggatt atcagggcga cgccaaggcg acgggcaaga atgtaggcga cgatttccgc       720
     gaacgcaaac tgaccctgcc ggtgatcaag gcggtggcgc aggcgacgga cgaagagcgc       780
     gcgttctggg tgcgcaccat cgagaaaggc aagcaggccg agggtgacct ggaacaggcg       840
     ctggccctga tggagaagta cggcaccctt gcggcgaccc gcgccgacgc ccatgcctgg       900
     gccgagaagg cgcgtaccgc attggaattg ctgcccaatc acgaaatccg caccatgctg       960
     agcgatctgg ccgattacgt ggtggcccgg ctgagctga                              999
//

If you have problems or comments...

PBIL Back to PBIL home page