(data stored in ACNUC7421 zone)

EMBL: CP000031.DEOD

CP000031.DEOD        Location/Qualifiers
FT   CDS_pept        complement(379410..380120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoD"
FT                   /locus_tag="SPO0366"
FT                   /product="purine nucleoside phosphorylase"
FT                   /EC_number="2.4.2.1"
FT                   /note="identified by similarity to SP:O34925; match to
FT                   protein family HMM PF01048; match to protein family HMM
FT                   TIGR00107"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0366"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93684"
FT                   /db_xref="GOA:Q5LXG0"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR004402"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXG0"
FT                   /protein_id="AAV93684.1"
FT                   /translation="MTIHIGANPGEIAETVLLPGDPYRAKWAAETFLDNPVLVNEVRGM
FT                   LGFTGMWRGNRVTIHGSGMGMPSLSIYANELIRDYGAKTLIRIGSCGGMQDSVEVRDVI
FT                   LAMTASTLGTPSRGIFRELSFAPCADWSLLHAAARAAEDKGVRTHVGGIYSSDVFYDER
FT                   PDLNEQMVRHGVLGVEMEAAELYILAARHKCRALAVLTVSDHLLTGAALPSAERETSFG
FT                   DMVEIALHAAFPGA"
     atgacgatcc atatcggcgc caatcccgga gagattgcgg aaacggttct attacccggc        60
     gatccttatc gcgcgaaatg ggcagcggaa acgtttctgg ataacccggt cctggtgaat       120
     gaggttcgcg gcatgttggg gtttaccggc atgtggcgag gcaaccgggt gaccattcac       180
     gggtctggca tgggtatgcc gtcactgtcg atctatgcca atgagctgat ccgtgactat       240
     ggggcgaaga cactgatccg tatcggatcc tgcggcggca tgcaggacag tgtcgaagtt       300
     cgtgacgtga tcctggcaat gacggcatcg acgctgggca ctccgtcgcg ggggatcttt       360
     cgcgagctga gctttgcccc ctgcgccgat tggtccctgt tgcacgcggc tgcgcgtgca       420
     gccgaggaca agggcgtacg gacccatgtg ggcggcatct attcgtcgga cgtgttttat       480
     gacgaacggc ccgatctgaa cgaacagatg gtgcgccatg gggtgctggg ggtcgagatg       540
     gaggccgccg agctttacat tctggccgca cggcacaaat gccgggcgct ggcggtgctg       600
     acggtttccg accacctgct gaccggcgct gccctgccca gtgcagagcg cgaaaccagc       660
     ttcggcgaca tggtcgagat tgcgctgcac gcagcctttc ccggcgcctg a                711
//

If you have problems or comments...

PBIL Back to PBIL home page