(data stored in ACNUC7421 zone)

EMBL: CP000031.DNAJ

CP000031.DNAJ        Location/Qualifiers
FT   CDS_pept        44687..45832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="SPO0044"
FT                   /product="chaperone protein DnaJ"
FT                   /note="identified by similarity to SP:P08622; match to
FT                   protein family HMM PF00226; match to protein family HMM
FT                   PF00684; match to protein family HMM PF01556"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0044"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93375"
FT                   /db_xref="GOA:Q5LWJ5"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWJ5"
FT                   /protein_id="AAV93375.1"
FT                   /translation="MSKRDYYDVLGVSKGASADEIKKAYRGKAKELHPDRNKDNPDAES
FT                   LFKEVNEAYEVLKDAEKKAAYDRFGHAAFEGGMGGGQRPGGGFGSGDFSSAFSDVFEDL
FT                   FGDFMGGQRGGGGRRAARGSDLRYNLRVTLEEAFSGLQKTINVPTAVACSSCEGTGAEG
FT                   GVEPTTCPTCSGMGKVRAQQGFFTVERTCPTCSGLGQIIKNPCKSCRGQGRVEKDRALS
FT                   VNIPAGVETGTRIRLAGEGEAGMRGGPPGDLYIFVEVAKHELFERDGVNLYCRVPVSMA
FT                   KAALGGAIEVPTIDGGRGRVQVPAGSQSGRQMRLRSKGMPALRGGGIGDMFIELAVETP
FT                   VNLTSKQKDLLREFDELSEDNNPETKSFFSSVKSFWDGMKG"
     atgtcaaaac gcgactatta cgatgtgctc ggcgtgtcca agggcgcttc ggccgacgag        60
     atcaagaaag cctatcgcgg caaggccaag gagctgcatc ccgaccgcaa caaggacaat       120
     ccggatgccg agtcgctgtt caaggaagtg aacgaggctt atgaggtcct gaaggatgcc       180
     gagaagaagg ccgcctatga ccggttcggc catgccgcgt tcgaaggcgg catgggcggc       240
     ggtcagcgtc ccggtggcgg tttcgggtcg ggcgattttt ccagcgcctt ctcggatgtg       300
     ttcgaggacc tgttcggcga tttcatgggt ggccagcggg gtggcggtgg ccgccgcgct       360
     gcgcgcggct cggacctgcg atacaacctg cgggtcacgc tggaagaggc gttctcgggc       420
     ctgcaaaaga ccatcaacgt gcccaccgcg gttgcctgtt cgtcctgcga gggcaccggt       480
     gccgaaggcg gggtcgagcc gaccacctgt ccgacctgtt cgggcatggg caaggtgcgc       540
     gcacagcagg gcttctttac cgtcgagcgg acctgtccga cctgttcggg tctgggtcag       600
     atcatcaaga acccctgcaa atcctgccgc ggtcagggtc gggtcgaaaa ggaccgtgcg       660
     ctgagcgtca atatccccgc cggggtcgaa accggcaccc gcattcgcct ggccggtgaa       720
     ggcgaggccg ggatgcgcgg tggcccgccg ggcgatctct atatctttgt cgaggtcgcc       780
     aagcacgagc tgttcgaacg cgacggcgtg aacctctatt gccgggtgcc ggtcagcatg       840
     gctaaggcgg cgctgggtgg cgccatcgag gtgccgacca tcgacggcgg ccggggccgg       900
     gtgcaggtgc ccgccggcag ccagtcaggc cggcagatgc gcctgcgcag caagggcatg       960
     ccagccctgc gcggtggcgg catcggtgac atgttcatcg aactggcggt ggaaactccg      1020
     gtcaacctga ccagcaagca gaaagatctg ctgcgcgagt tcgacgagct gagcgaggac      1080
     aacaatcccg agaccaagag cttcttttcc tcggtcaagt cgttctggga cgggatgaag      1140
     ggttag                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page