(data stored in ACNUC7421 zone)

EMBL: CP000031.DNAN

CP000031.DNAN        Location/Qualifiers
FT   CDS_pept        165999..167117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="SPO0150"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00712;
FT                   match to protein family HMM PF02767; match to protein
FT                   family HMM PF02768; match to protein family HMM TIGR00663"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0150"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93478"
FT                   /db_xref="GOA:Q5LWV3"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWV3"
FT                   /protein_id="AAV93478.1"
FT                   /translation="MKISIERGALLKAVAQAQSVVERRNTIPILANVLIEAEGEGAQFR
FT                   ATDLDIEVVDKAPAMIERAGATTVSATTLHEIVRKLPDGALVTLTADAAAGRLTVEAGR
FT                   SNFSLATLPREDFPVMASSEYQSNFTANAAVLRRLFDKSKFAISTEETRYYLNGVYMHV
FT                   ADGDGGKVLRCVATDGHRLARIDADLPAGATDMPGVIVPRKTVGELRKLLDDDEMDIAV
FT                   SVSETKVRFATPDITLTSKVIDGTFPDYTRVIPQANTRRLEVDASEFAKAVDRVATVSS
FT                   ERSRAVKLQLDEDKLVLSVNAPDSGAAEEELAVAYSDERLEIGFNAKYLLEIASQVDRE
FT                   NAVFLFNSSGDPTLMREGNDQSAVYVVMPMRV"
     atgaagatca gcatcgaacg cggcgccctg ctcaaggctg ttgcgcaagc gcaatccgtt        60
     gtcgagcgcc ggaacacgat cccgatcctc gccaatgtgc tgatcgaggc cgagggcgaa       120
     ggcgcgcaat tccgcgccac cgacctggat atcgaagtgg tcgacaaggc gcccgcgatg       180
     atcgagcggg caggtgccac cacggtatcg gccaccacgc tgcacgagat cgtgcgcaag       240
     ctgccggacg gcgcgctggt caccctgacg gcggatgcgg cggccgggcg gttgacggtc       300
     gaggccgggc gctcgaactt ctcgctggcc accctcccgc gcgaggattt tccggtcatg       360
     gcttcgtcgg aatatcagtc gaatttcacc gccaatgccg cggttctgcg gcgtctgttc       420
     gacaagtcga aattcgccat ctcgaccgaa gagacccgct attacctgaa cggtgtctac       480
     atgcatgtgg ccgatggcga tggcggcaag gttctgcgct gcgtggctac cgatggtcac       540
     cgtctggccc ggatcgacgc ggacctgccg gcgggggcca ccgatatgcc aggcgtgatc       600
     gtgccccgca agaccgtggg tgagctgcgc aagctgctag acgatgacga gatggatatc       660
     gcggtgtcag tgagcgagac caaggtccgc tttgccacgc ccgatatcac gcttacctca       720
     aaggtaatcg acggcacctt ccccgattat acccgcgtga tcccgcaggc gaatacacgg       780
     cggctcgagg tggatgcctc ggaattcgcc aaggcggtgg accgggtcgc caccgtcagc       840
     tcggagcgct cgcgcgcggt caagctgcag ctggacgagg acaagctggt cctgtcggtc       900
     aatgcacccg acagcggagc cgccgaagag gaactggccg tcgcctatag cgatgaacgg       960
     ctggagatcg ggttcaatgc gaaatatctg ctggagattg ccagccaggt ggatcgcgaa      1020
     aacgcggtgt tcctgttcaa ctcttcgggg gatccgaccc tgatgcgcga aggcaatgat      1080
     cagagcgcgg tctacgtggt catgccgatg cgcgtctga                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page