(data stored in ACNUC7421 zone)

EMBL: CP000031.FDHD

CP000031.FDHD        Location/Qualifiers
FT   CDS_pept        319140..320021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdhD"
FT                   /locus_tag="SPO0306"
FT                   /product="formate dehydrogenase accessory protein FdhD"
FT                   /note="identified by match to protein family HMM PF02634;
FT                   match to protein family HMM TIGR00129"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0306"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93624"
FT                   /db_xref="GOA:Q5LX92"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX92"
FT                   /protein_id="AAV93624.1"
FT                   /translation="MAISDDLSDYIIAPDPGAARLTRAVEGLDQTGAPTRLSVVEERPL
FT                   TIFLNSQEIVTAMTIGDYPEYLALGFLRNQGMLRPDEEITGVDFDEDLETVVVRTAVET
FT                   SHEEKLKKKTRTSGCAVGTVFGDMMEGLEEVRLPQVEVRTSWLYDLAARINRTPSLYLE
FT                   AGAIHGTVLCHRNRPLVYMEDVGRHNAVDKIAGWMLSTGEGADDKILYTTGRLTSEMVI
FT                   KTAMMGIPVLASRSGFTAWGVEIARQVGLTLIGRMRGQRFVCLSGAERLVWDADPDSVP
FT                   VEDRKHRRKSAQ"
     ttggctatct cggacgacct gtcggattac atcatcgccc ccgacccggg cgccgcccgc        60
     ctgacccgcg cggtcgaggg gctggaccag accggcgcgc ccacgcgcct ctcggtggtc       120
     gaggaacgcc cgctgacgat cttcctcaac agtcaggaga tcgtgaccgc catgaccatc       180
     ggggattacc ccgagtatct ggcgctgggg ttcctgcgca atcagggcat gctgaggccg       240
     gatgaagaga tcaccggcgt agatttcgac gaggatctgg aaacggtcgt ggtgcgcacc       300
     gcggtggaaa ccagccacga ggaaaagctg aagaaaaaga cccgcaccag cggctgcgcg       360
     gtgggcaccg tattcggcga catgatggag gggctggagg aggttcgctt gcctcaggtg       420
     gaggtacgca catcctggct ctacgatctg gcggcgcgga tcaaccgcac gccctcgctg       480
     tatctggagg ccggggccat ccatggcacg gtgctgtgcc accggaaccg gccgctggtc       540
     tatatggagg atgtgggccg ccacaacgcg gtggacaaga tcgcgggctg gatgctgtcc       600
     acgggcgagg gggcggacga caagatcctt tacaccaccg ggcggttgac ctccgagatg       660
     gtgatcaaga ccgcgatgat gggcatcccg gtgctggcct cgcgctcggg ctttaccgcc       720
     tggggggtcg agatcgcgcg tcaggtgggg ttgaccctga tcggcaggat gcgcggccaa       780
     cggtttgtct gcctgtcggg agccgagcgg ctggtctggg atgccgaccc cgacagcgta       840
     ccggtcgagg acaggaaaca ccgccggaag agtgcgcaat ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page