(data stored in ACNUC7421 zone)

EMBL: CP000031.FLGA

CP000031.FLGA        Location/Qualifiers
FT   CDS_pept        complement(196056..196472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgA"
FT                   /locus_tag="SPO0176"
FT                   /product="flagellar basal-body P-ring formation protein
FT                   FlgA"
FT                   /note="identified by similarity to SP:Q44339; match to
FT                   protein family HMM PF03240"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0176"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93502"
FT                   /db_xref="GOA:Q5LWX6"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWX6"
FT                   /protein_id="AAV93502.1"
FT                   /translation="MRYLGPILALVLAQTAAAEVLVPTRTIRAKEIIGAEDLMLKSAEV
FT                   PGSFTDPAEVIGQEARVALYAGRPIRYADIGPPAIVDRNDLVTLFFDNGPLVITTEGRA
FT                   LGRGAAGDVIRVMNLTSRTTVSGQIRPNGSIEVK"
     atgcggtatc ttggcccgat cctcgccctt gtcctggcgc agacggcagc agccgaggta        60
     ctggtgccca cccgcaccat ccgcgccaag gagatcatcg gcgctgagga tctgatgctg       120
     aaatcggccg aggtcccggg cagtttcacc gacccggccg aggtgatcgg gcaagaggcg       180
     cgggtcgcgc tctatgccgg gcggccgatc cgctatgccg atatcggccc ccccgccatc       240
     gtcgaccgca atgatcttgt gacgctcttt tttgacaatg gcccgctggt catcaccacc       300
     gaaggccgcg cgctgggtcg cggtgcggcg ggcgatgtca tccgggtgat gaacctgacg       360
     tcccgcacca ccgtttccgg ccagatccgg cccaatggct ccatcgaggt aaaatga          417
//

If you have problems or comments...

PBIL Back to PBIL home page