(data stored in ACNUC9435 zone)

EMBL: CP000031.FLGB

CP000031.FLGB        Location/Qualifiers
FT   CDS_pept        complement(198978..199394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="SPO0182"
FT                   /product="flagellar basal-body rod protein; FlgB"
FT                   /note="identified by similarity to SP:P24500; similarity to
FT                   SP:P75934"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0182"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93508"
FT                   /db_xref="GOA:Q5LWX1"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWX1"
FT                   /protein_id="AAV93508.1"
FT                   /translation="MKLIEGEAPMFSDLNVFKMAYAMATHAGTRQAVIAQNMANADTPG
FT                   YRERDIAPFAETFARETAGTAMQASRTSHLNGTAASAASWAPFETNAAGDPNRNNVSIE
FT                   EQMLKAVEVKRQHDRALAIYKSSMNMLRVGLGRG"
     ttgaaattga tcgagggaga agccccgatg ttctcggact tgaacgtctt taagatggcg        60
     tacgccatgg caacacatgc aggcacacgg caagccgtga tcgcccagaa catggccaat       120
     gccgacacgc ccggatatcg cgaacgcgac atcgccccct ttgccgaaac ctttgcccgc       180
     gaaactgccg gcaccgccat gcaggccagc cgcacgagcc atctgaatgg caccgcggcg       240
     tccgccgcca gctgggcacc gttcgaaacc aacgcagcgg gcgaccccaa ccgcaacaat       300
     gtcagcatcg aggaacagat gctcaaggcg gtcgaggtca agcgtcagca tgaccgcgcg       360
     ctcgcgatct acaaatcctc gatgaacatg ctgcgcgtcg gcctgggtcg tgggtga          417
//

If you have problems or comments...

PBIL Back to PBIL home page