(data stored in ACNUC7421 zone)

EMBL: CP000031.FLGC

CP000031.FLGC        Location/Qualifiers
FT   CDS_pept        complement(198574..198981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="SPO0181"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /note="identified by similarity to SP:P24501; match to
FT                   protein family HMM PF00460; match to protein family HMM
FT                   PF06429"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0181"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93507"
FT                   /db_xref="GOA:Q5LWX2"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWX2"
FT                   /protein_id="AAV93507.1"
FT                   /translation="MREAEMSEFSKSLSVTASALRAQATRLRHVSENISNADTPGYRRK
FT                   TVPFEVERGRDDGVERVTTGRVKLDRRQLPDIFDPSHPLADETGHYQGSNVDLMIEIAD
FT                   AREAQRSYEANLKLFDQARQMSASLMELLRK"
     gtgagggagg ctgagatgag cgaattttcc aaatccctct cggtgaccgc cagcgcgctg        60
     cgcgcccagg ccacccgctt gcgccatgtg tccgaaaaca tctcgaacgc cgacacgccg       120
     ggctatcgcc gcaagacggt ccctttcgag gtagagcgcg gccgtgacga cggggtcgag       180
     cgtgtcacca ccggtcgggt taaactcgac cggcggcaat tgcccgatat cttcgatccc       240
     tcgcatccac tggccgacga aaccggccat taccaggggt cgaatgtcga cctgatgatc       300
     gagatcgccg acgcccgcga agcgcagcgc agctacgagg cgaatctcaa gcttttcgac       360
     caggcgcggc agatgtccgc aagcctgatg gaacttctcc gcaaataa                    408
//

If you have problems or comments...

PBIL Back to PBIL home page