(data stored in ACNUC7421 zone)

EMBL: CP000031.FLGG

CP000031.FLGG        Location/Qualifiers
FT   CDS_pept        complement(196472..197257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgG"
FT                   /locus_tag="SPO0177"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /note="identified by similarity to SP:P75939; match to
FT                   protein family HMM PF00460; match to protein family HMM
FT                   PF06429"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0177"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93503"
FT                   /db_xref="GOA:Q5LWX5"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWX5"
FT                   /protein_id="AAV93503.1"
FT                   /translation="MRALKIAATGMSAQQMRVETISNNLANMNTTGYNARRAEFADLHY
FT                   QQIARAGTVNASDGTVLPTGVQLGLGVRPAAVTVHLEQGALSATGNDLDLAIEGRGYFE
FT                   VTLPSGQSAFTRDGSLKRSAEGLIVTSDGLSVVPEITIPSDARSISINAAGEVYAYFDD
FT                   AAEGQLLGQVTLAGFTNAKGLEAIGSNLFKETEASGSPITGNPGEDGLGTLRQGYLEDS
FT                   SVDAVREVTELIEAQRGYEMNAKVISAVDQMMSATTQVR"
     atgcgcgccc tgaaaatcgc cgccaccggc atgtccgccc agcagatgcg ggtcgagacg        60
     atctcgaaca acctcgccaa catgaacacc accggctaca atgcccggcg cgcggaattc       120
     gccgacctgc attaccagca gatcgcccgc gccggcacgg tgaatgcctc tgacggcacg       180
     gttctgccca ccggggtgca actgggtctc ggcgtgcgcc cggcggcggt gaccgtccat       240
     ctggaacagg gcgcgctgtc ggccaccggc aacgatctgg atcttgccat cgaagggcgc       300
     ggctatttcg aggtgacgct gccctcgggc cagtcggcct ttacccgcga cgggtcgctg       360
     aaacgctcgg ccgagggatt gatcgtcacc tcggacgggc tgtcggtggt gcccgagatc       420
     accattccca gcgatgcgcg gtcgatctcg ataaacgcgg cgggcgaggt ctatgcctat       480
     ttcgacgatg ccgccgaggg ccagctgctg ggtcaggtca cactcgccgg tttcaccaat       540
     gccaaggggc tcgaggcgat cggcagcaac ctgttcaagg agaccgaggc ctcgggctct       600
     ccgatcaccg gcaacccggg cgaggatggg ctgggcaccc tgcgccaggg atatctcgaa       660
     gacagttcgg tcgacgcggt gcgcgaggtg accgaactga tcgaggcgca gcgcggctat       720
     gaaatgaatg ccaaggtcat ctcggcggtg gaccagatga tgagcgccac cacgcaggtg       780
     cgctga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page