(data stored in ACNUC9435 zone)

EMBL: CP000031.FLGH

CP000031.FLGH        Location/Qualifiers
FT   CDS_pept        complement(195319..196059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgH"
FT                   /locus_tag="SPO0175"
FT                   /product="flagellar L-ring protein FlgH"
FT                   /note="identified by similarity to SP:P75940; match to
FT                   protein family HMM PF02107"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0175"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93501"
FT                   /db_xref="GOA:Q5LWX7"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWX7"
FT                   /protein_id="AAV93501.1"
FT                   /translation="MMQKCLSPKTLIAALVVLSACGRADHLGKAPSFTPNTESPEHVAM
FT                   LWPGLPLHTQPQRSVDRASLWSGGQNSLLGDQRAMKKGDILTVVIEIDEKAEISNDTNR
FT                   SRSGSESLGVPHLLGLPQRIDEKLPEGASMSNAVAVDSSSASGGKGSVKRKEKLTLRVA
FT                   ATVVDVLPNGVLSITGSQELRVNFELRELLVSGYVRPEDISRQNEITYDKIASARVSYG
FT                   GRGQITDVQQPRYGQQVLDMVLPF"
     atgatgcaga aatgtctttc ccccaaaacc ctgattgccg cgctggtggt gctgtcggcc        60
     tgtggtcgcg ccgatcatct gggcaaggcg cccagtttta ccccaaacac cgagtcgccc       120
     gaacatgtgg ccatgctctg gcccggcctg ccgctgcaca cacagccgca gcgctcggtc       180
     gatcgcgcct cgctgtggag cggcggccag aactcgctgc tgggcgatca gcgggcgatg       240
     aagaagggcg acattctgac cgtggtgatc gagatcgacg aaaaggccga gatctcgaac       300
     gacaccaacc ggtcgcgttc gggttcggaa agcctgggcg tgccgcatct tctgggcctg       360
     ccgcagcgga tcgatgaaaa actgcccgag ggcgcgtcga tgagcaacgc ggtcgcagtc       420
     gattcctcca gcgcctctgg cggaaagggg tcggtgaaac gcaaggaaaa actgaccctg       480
     cgcgtggccg cgaccgtggt cgacgtgctg cccaacggtg tcctgtcgat cactggctcg       540
     caggagctgc gggtgaattt cgaactgcgc gagcttctgg tttcaggcta tgtgcggccc       600
     gaggatatct cgcgccagaa cgagattacc tatgacaaga tcgcctcggc gcgggtgtct       660
     tatggcggtc gcggccagat caccgatgtg cagcaaccgc gctatggcca gcaggtgctg       720
     gacatggttc tgccgttctg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page