(data stored in ACNUC7421 zone)

EMBL: CP000031.FLIF

CP000031.FLIF        Location/Qualifiers
FT   CDS_pept        complement(216632..218236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="SPO0199"
FT                   /product="flagellar M-ring protein FliF"
FT                   /note="identified by similarity to SP:P25798; match to
FT                   protein family HMM PF01514; match to protein family HMM
FT                   TIGR00206"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0199"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93525"
FT                   /db_xref="GOA:Q5LWY9"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWY9"
FT                   /protein_id="AAV93525.1"
FT                   /translation="MQQIRSVWASLDKKKQFIVIGAALVVFLGVLGLTRMAGSPNMQLL
FT                   YAGLESGSAGEVVRSLEQQGVPYEVRGGSIYVPAARRDELRLTLASEGLPANGGRGYEL
FT                   LDSLSGFGTTSQMFDAAYWRAKEGELARTIVASPHVAQARVHIANSSSNPFQRSIEPTA
FT                   SVSVVPSGSEVTPAQANAIRYLVASAVSGMVAEGVTVVDSNGNVIGTPETPTSSTSEDR
FT                   AQQMRERVLRLVEARVGRGNAIVEVSLDTVTETESIRERRFDPNGRVAISTDVEERSDA
FT                   SKNQTTDVTVASNLPDGDGAVGDESNSSTSATRERVNYEVSETETEILRTPGAIKRLSV
FT                   AVLVNGLPGAAQDGSSQFTPRPEEELAALRELVESAVGFNQDRGDVITLKSMELPNLEP
FT                   QGTLASSSMLQGLTFDLMSLIQMATLALVTLVLGLFVVRPILTKPAVSAPLLAVAPPPN
FT                   QSGAQSAGPALTGEIDDGSPRQNQLPGAATQQRGTVPALVGSSGTPVDRLRAMIGDKQE
FT                   ETVEILRSWLEENEEKA"
     gtgcagcaga taagaagtgt ctgggcaagt ttggacaaaa agaagcagtt catcgttatc        60
     ggtgctgcct tggtggtgtt tctgggcgtg cttggcctga ccagaatggc cgggtcgcca       120
     aatatgcagc tgctttatgc aggacttgaa agcggttcag cgggcgaggt cgtgcgctcg       180
     ctggaacagc agggcgttcc atacgaggtg cgcggcggct cgatctatgt gccagcagct       240
     cgacgtgacg agttgcgcct gacgctggcc tccgaagggt tgccggcaaa tggtggccgg       300
     ggttacgagc tgctcgattc gctgagtgga ttcggcacca catcccagat gttcgatgcc       360
     gcctattggc gggcgaagga gggcgagctg gcccgcacca tcgtggccag cccccatgtg       420
     gcccaagccc gggtgcatat cgccaacagc tcctccaacc cgtttcagcg cagcatcgaa       480
     ccaacagcct ctgtctcggt tgttccatca gggtcagagg tgacaccagc gcaggcaaat       540
     gcgatccgct acctggtcgc ctcggcggtg tcgggcatgg tcgccgaggg tgttacggtc       600
     gttgattcca atggcaatgt gatcggcacg cccgagaccc cgacgtcaag cacctccgag       660
     gatcgcgcac aacagatgcg cgaacgggtc ctgaggcttg tcgaagcacg agtcgggcgt       720
     ggcaacgcaa ttgtcgaggt cagcctggac accgtgaccg agacggaatc gatccgtgaa       780
     cgccggttcg atcccaatgg ccgcgttgcc atcagcaccg atgtcgaaga acgctcggac       840
     gcctccaaga accagacgac cgatgtgacg gtggcctcca atctgcccga tggggacggt       900
     gcggtcggtg acgaatcgaa ctcgagtacc agcgcaaccc gtgagcgtgt caattacgag       960
     gtctcggaaa ccgagacaga gattctgcgc accccgggcg ccatcaaaag gttgagtgtc      1020
     gcggtcctgg ttaacggatt gccgggtgcc gcccaggatg ggtccagcca gtttacgccg      1080
     cggcccgagg aagaactggc cgcactgcgg gaactggtgg aatcggcggt cggcttcaat      1140
     caggaccggg gtgatgtgat caccttgaaa tccatggagc tgcccaatct ggaaccgcaa      1200
     ggcaccctgg cgagcagttc gatgctgcaa gggctgacat tcgatctgat gtcgttgatc      1260
     cagatggcca cgctggccct ggtcacgctg gttctggggc tcttcgtcgt gcgcccgatc      1320
     ctgaccaaac cggcggtttc cgcgccgctt ctggcagtgg cgccgccgcc gaatcagagc      1380
     ggcgcacaat ccgccggtcc ggcgctgacc ggcgagatcg atgacggcag cccgcggcaa      1440
     aaccaactac ccggcgcagc tacccaacaa cgcggcaccg ttcctgccct ggtcgggtcc      1500
     agcggaacgc ccgtcgaccg cctgcgcgca atgatcggcg acaagcagga agagaccgtg      1560
     gaaatcctgc gcagctggct ggaagagaat gaggagaaag cctga                      1605
//

If you have problems or comments...

PBIL Back to PBIL home page