(data stored in ACNUC7421 zone)

EMBL: CP000031.FLIL

CP000031.FLIL        Location/Qualifiers
FT   CDS_pept        218355..218861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliL"
FT                   /locus_tag="SPO0200"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="identified by similarity to SP:P34008; match to
FT                   protein family HMM PF03748"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0200"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93526"
FT                   /db_xref="GOA:Q5LWY8"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWY8"
FT                   /protein_id="AAV93526.1"
FT                   /translation="MTDATADEVEPEKKSGKKGLIVGLVLALVGAGGGFYATVSGLIPL
FT                   GAQPAEEHGESGGDHGAVVPDALPNVAYVDLQPIMVSLLGEGGQRHLRFHAQLEVPEQY
FT                   LADVEKIRPRIVDVLNGYLRAIEISDLSDPLALTRLRGHMQRRINIVAGEGRVKDVLVM
FT                   EFVLN"
     atgaccgacg caactgccga tgaggtcgaa ccagagaaga aatcaggcaa gaagggcctg        60
     attgttgggc tagttctggc gcttgtcggg gcgggcggcg gtttctacgc gacggtttcg       120
     gggctgattc ccctgggcgc tcaaccagcc gaagaacatg gagagtcggg cggagatcat       180
     ggcgctgtgg tgccggatgc cttgcccaat gtcgcctatg tcgacttgca gccgatcatg       240
     gtgtcgctgc tcggggaagg gggccagcgg cacctgcggt ttcatgccca gctggaagta       300
     cccgaacaat acctggccga tgtcgagaag atcaggccac gaatcgtcga tgtcctgaat       360
     ggctacctgc gtgcgatcga gatcagtgat ctcagcgatc cgctggctct gacccgtctg       420
     cgcggacata tgcaacgccg gatcaacatc gttgcgggtg aggggcgcgt gaaggacgtg       480
     ctcgtgatgg aattcgtgct gaactag                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page