(data stored in ACNUC7421 zone)

EMBL: CP000031.FLIN

CP000031.FLIN        Location/Qualifiers
FT   CDS_pept        complement(215756..216085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /locus_tag="SPO0197"
FT                   /product="flagellar motor switch protein FliN"
FT                   /note="identified by similarity to SP:Q03593; match to
FT                   protein family HMM PF01052"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0197"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93523"
FT                   /db_xref="GOA:Q5LWZ1"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWZ1"
FT                   /protein_id="AAV93523.1"
FT                   /translation="MRWTPSCIRPKRYRDMSDPQKPIEAKNPFNSVPIEITVSVGRARP
FT                   LIRDLIGLGENAVLTLDKRVEDPVDLYVGDRLVARGQLEELTGEQAGQLAVRLTEISDL
FT                   ASDLG"
     atgcgatgga ctccttcctg catcaggcca aagaggtatc gtgacatgag cgacccgcaa        60
     aaaccgatcg aggcaaagaa cccgttcaac tcggtcccga tcgagatcac cgtttcggtc       120
     gggcgtgcgc gaccgctgat ccgcgatctg atcgggctcg gtgaaaacgc cgtgctgacc       180
     ctcgacaaac gtgtcgagga cccggtcgat ctctatgttg gcgatcgcct ggtagcacgc       240
     ggccagctcg aagagttgac cggcgaacag gcgggacagc tcgcggttcg gctcaccgag       300
     atctcggatc tggccagcga cctgggatga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page