(data stored in ACNUC9435 zone)

EMBL: CP000031.FLIP

CP000031.FLIP        Location/Qualifiers
FT   CDS_pept        complement(215016..215759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="SPO0196"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /note="identified by similarity to SP:P35528; similarity to
FT                   GB:BAC51081.1; match to protein family HMM PF00813; match
FT                   to protein family HMM TIGR01103"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0196"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93522"
FT                   /db_xref="GOA:Q3V7J8"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V7J8"
FT                   /protein_id="AAV93522.1"
FT                   /translation="MRRAAPVLAAITLLTGAMLAGPVAAQDISLSLGEGGSVSARTIQL
FT                   ILLITVLSLAPGLAIMITCFPFLVTVLAILRQGIGLQQSPPNMLIVSLALFLTYFVMEP
FT                   VFTEAWTTGIAPMMAEELALEPALEKAIAPFKAFMAARLDADTFFAMANLRPDGAALTA
FT                   TPEAPLSVLVPSFMLSEIARAFQIGFLVFLPFLIIDLVVAAVLMSMGMMMVPPATVSLP
FT                   FKLAFFVLADGWSLIASALVRSYMP"
     atgaggcgcg cagcccctgt tctggccgcg atcaccttgt tgaccggcgc gatgcttgcc        60
     gggccggtgg ccgcgcagga tatctccctt tcgctgggag agggtggatc ggtatcggcg       120
     cgcacgatcc agctgatcct gttgatcacc gtgctcagcc tggcccccgg gctggctatc       180
     atgatcacct gcttcccgtt tctggtcacg gttctggcga tcctgcgcca ggggatcggc       240
     ttgcagcagt cgcctcccaa tatgctcatc gtcagcctgg cgctgtttct gacctatttc       300
     gtaatggagc ccgtgttcac cgaggcctgg acaacgggta tcgctccgat gatggccgag       360
     gaactggcgc tggaacccgc tttggagaaa gcaatcgcgc cgttcaaggc cttcatggcc       420
     gcccggctcg acgcggatac gttctttgcc atggccaatc tgcggcctga cggtgcggcg       480
     ctgacggcga ctcccgaagc gccgctctcg gtgctggttc cctccttcat gctgtcagaa       540
     atcgcgcgcg cgtttcagat cggttttctg gtgtttctgc cgttcctgat catcgatctg       600
     gtggtggctg cggtgttgat gtcgatgggc atgatgatgg tgccgccggc gaccgtgtcc       660
     ctccccttca agctggcttt cttcgtgctg gcggatggct ggtcgcttat cgcaagcgct       720
     ttggttcgca gctacatgcc ctga                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page