(data stored in ACNUC7421 zone)

EMBL: CP000031.FLIR

CP000031.FLIR        Location/Qualifiers
FT   CDS_pept        192414..193187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliR"
FT                   /locus_tag="SPO0171"
FT                   /product="flagellar biosynthetic protein FliR"
FT                   /note="identified by similarity to SP:P35537; similarity to
FT                   SP:Q45975; match to protein family HMM PF01311"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0171"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93497"
FT                   /db_xref="GOA:Q3V7J6"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V7J6"
FT                   /protein_id="AAV93497.1"
FT                   /translation="MIALPPELLALISGELWQLFAVFLRVSALVSVLPAFGEQSIPMRV
FT                   RLGVAAAFAVIVAPATPQAPEITNVLQFAMLAGTEALAGLVMGLGIRLFAMALQVAGMI
FT                   AAQATSLSQLLGNAVAEPTPAMGHLLMMDGLALAVMSGLHVRVAEFLIHSYTIFPIGKL
FT                   PHPGDLSQWGVAQIGRMFALAFALAAPFVIASLIYNLALGAINRAMPQLMVAFVGAPVI
FT                   TFGGMALLLVGTPLLLSVWLDALWSFFQDPVGARP"
     atgatcgcgc tgccgcccga gttgctggcg ctgatctcgg gcgagctgtg gcagctcttt        60
     gccgtgttcc tgcgggtctc ggccctggtc tcggtcctgc ccgcctttgg cgagcagtcg       120
     atcccgatgc gggtgcggct gggggtcgcc gccgcgtttg ccgtgatcgt ggctccggcc       180
     acgccccagg cgcccgagat cacaaatgtc cttcaattcg caatgcttgc ggggaccgag       240
     gcgcttgccg ggctggtcat ggggctgggc atccggctgt ttgccatggc cttgcaggtg       300
     gcgggcatga tcgcggcgca ggccacgtct ctgtcgcagc ttctgggcaa tgcggtggcc       360
     gagccgacgc ctgccatggg tcatctgctg atgatggacg ggctggcgct ggcggtcatg       420
     tcgggcctgc atgtgcgggt tgccgagttc ctgatccact cctacacgat ctttccgatc       480
     ggcaagctgc cccatcccgg agacctcagc caatggggtg tcgcccagat cggccgcatg       540
     ttcgcgctgg cctttgcgtt ggcggcgccc tttgtcatcg cctcgctgat ctataacctg       600
     gccctggggg cgatcaaccg ggcgatgcca cagttgatgg tcgcctttgt cggcgcgccg       660
     gtgatcacct tcggcggcat ggcgctgttg ctggtcggca cgccgcttct gctgtcggtc       720
     tggctcgacg cgctgtggag cttcttccag gatccggtcg gggcacgtcc atga             774
//

If you have problems or comments...

PBIL Back to PBIL home page