(data stored in ACNUC7421 zone)

EMBL: CP000031.FTSE

CP000031.FTSE        Location/Qualifiers
FT   CDS_pept        349240..349971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsE"
FT                   /locus_tag="SPO0337"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /note="identified by similarity to SP:P10115; match to
FT                   protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0337"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93655"
FT                   /db_xref="GOA:Q5LXB5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXB5"
FT                   /protein_id="AAV93655.1"
FT                   /translation="MKPRAPSGKKSRKRQGADVIELENVGYSYGGGELLGEISVELSPG
FT                   SFHFLTGPSGSGKTTLLKLCYGALLATSGQVRAFGEDMRRLDRDQMALFRRRIGVVHQD
FT                   CRFLDHLPLTENIALPLTVSGHDLAGEHENLRELMAWVGLSKRAEALPPELSGGERQRA
FT                   ALARAVIMSPDVVVADEPTGNVDWEMSQRLLQLLVELNRMGKTVLIATHDLSLIRAAKS
FT                   QVQARVLRISNKRLQLAGADL"
     ttgaaaccgc gtgccccatc gggcaagaag agccggaaac gtcagggggc cgatgtgatc        60
     gagcttgaga atgtgggcta cagctatggg ggcggcgaat tgctgggcga gatctcggtc       120
     gaactgtcgc cggggtcttt ccatttcctg accggcccct cggggtccgg caagaccacg       180
     ctgctgaaac tctgctacgg ggcgctgttg gcgacctcgg ggcaggtgcg cgcctttggc       240
     gaggatatgc ggcggctgga ccgggatcag atggcgctgt ttcgccgccg catcggcgtg       300
     gtgcatcagg attgccgttt tctcgaccat ctgccgctga ccgaaaatat cgcgttgccg       360
     ctgaccgttt cgggccatga tctggcaggc gagcacgaga acctgcgcga gttgatggcc       420
     tgggtcggac tgtcaaaacg ggccgaagct ctgccaccgg aactgtccgg cggcgagcgc       480
     cagcgcgcgg cactggcccg tgcggtgatc atgtcgcccg atgtggtggt ggcggatgaa       540
     cccaccggca atgtcgattg ggagatgtcg cagcgcctgt tgcagctgct ggtcgaactg       600
     aaccggatgg gcaagacggt gctgatcgcc actcatgatt tgagcctgat ccgcgccgcc       660
     aaaagccagg ttcaggcgcg ggttctgcgg atctcgaaca agcggctgca actggcgggg       720
     gcggatctgt ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page