(data stored in ACNUC7421 zone)

EMBL: CP000031.GLND

CP000031.GLND        Location/Qualifiers
FT   CDS_pept        complement(408330..411056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="SPO0397"
FT                   /product="protein-P-II uridylyltransferase"
FT                   /EC_number="2.7.7.59"
FT                   /note="identified by match to protein family HMM PF01842;
FT                   match to protein family HMM PF01909; match to protein
FT                   family HMM PF01966; match to protein family HMM TIGR01693"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0397"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93715"
FT                   /db_xref="GOA:Q5LWE5"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWE5"
FT                   /protein_id="AAV93715.1"
FT                   /translation="MFDTPAVFARITEAAAEAADNAALRGAVVAILRDVQNAGRAAIAE
FT                   GFAEDPFAARPLTRAYTYLTDGMVKTAMYVASEILHPLATPTQGERIAVLAVGGFGRGE
FT                   MAPFSDVDLLFLTPYKITAWAESVIESMLYILWDLRLKVGHSSRTVKDCIRLGRDDFTI
FT                   RTAMLEHRFLAGHAPLARSLDQRLKSELYKDTQREFIEAKLEERDARHRKQGERYMVEP
FT                   NVKEGKGGLRDLQSLYWIAKYIYEVKETAELVPLGLFTPSEYRTFVQAEEFLWAVRAHL
FT                   HLVTGRATEQLTFDLQVEVAARMGYQDRAGRRGVEVFMQKYFREATRVGELTRIFLTKL
FT                   EAAHMKGAPLLERIFRRRRRIKQGYKVVRGRLDVVDPEAFLADKLNLLRIFEEALRTGM
FT                   LIHPDAMRLVTANLDLIDDGMRNDKEARRIFLDLLLKHGNPERALRRMNELGVLSAFVP
FT                   EFEPIVAMMQFNMYHSYTVDEHTIQTIVNLAQIEKGELVESLPLASSILKAGVNRKVLY
FT                   VALLLHDIGKGRPEDHSILGARIARKVAPRLGLSKADCETVEWLVRYHLLMSDMAQKRD
FT                   ISDPRTVRDFAKAVQTTKRLDLLTVLTVCDIRGVGPNTWNNWKATLLRALHAETKRALE
FT                   MGMEALNREGRGNEAKKALRTALSDWPAGEVKTEIARHYPPYWQGFNVETHVTFAEMLR
FT                   QLEHSGDPGGIEIRLDPDEDRDATRACFAMADHPGIFSRMAGALALVGANVVDARSYTT
FT                   KDGYVTDAFWIQDAEGHPYEAARLPRLSQMILKTLKGEVVARDALKSRDKIKKREKAFN
FT                   VPTHITFDNEGSDIYTIIEVDTRDRPGLLYDLARALAAANVYIANAVIATYGEQVVDSF
FT                   YVKDMFGLKYHSEAKQRTLETKLRKAITEGAERAAAS"
     gtgttcgaca ccccggccgt gttcgcgcgg atcaccgagg cggcggccga ggccgccgac        60
     aacgccgccc tgcgcggcgc cgtcgtggcc atcctgcgcg atgtccagaa tgcgggccgc       120
     gccgcgattg ccgaaggctt cgccgaggat ccctttgccg cccgcccgct gacccgcgcc       180
     tatacctatc tgaccgacgg gatggtcaag acggcgatgt atgtggcctc ggaaattctg       240
     cacccgctgg ccacgccgac ccagggcgaa cggatcgctg tactggcggt gggcggtttc       300
     gggcgcggcg agatggcgcc gttttccgat gtcgatctgc tgttcctgac cccctacaag       360
     atcaccgcct gggccgagag tgtcatcgaa tcgatgctct acatcctctg ggatctgcgg       420
     ctgaaggtcg ggcattcctc gcgcacggta aaggattgca tcaggctggg acgcgacgat       480
     ttcaccatcc gcaccgcgat gctggaacac cggtttctgg ctgggcacgc cccgctggcg       540
     cgctcgctgg atcagcgtct gaaaagcgag ctttacaaag atacgcagcg cgaattcatc       600
     gaggccaagc tggaagaacg cgacgcccgc caccgcaagc agggcgagcg gtacatggtc       660
     gagcccaacg tcaaggaagg caagggcggg ctgcgcgacc tgcaatcgct ctactggatc       720
     gccaagtata tctacgaggt gaaggaaacc gccgaactgg tgccgctggg cctgttcacc       780
     ccgtcggaat accgcacctt cgtgcaagcc gaggaattcc tgtgggcggt gcgcgcgcat       840
     ctgcatctgg tgaccgggcg ggccaccgaa cagctgacct tcgaccttca ggtagaggtg       900
     gctgcgcgca tgggctatca ggaccgcgcc gggcgacgcg gggtcgaggt gttcatgcag       960
     aaatacttcc gcgaggccac gcgcgtgggc gagctgacgc ggattttcct gaccaagctg      1020
     gaggcggcgc atatgaaggg cgcgccgctg ctggagcgca tctttcgccg ccgccgccgg      1080
     atcaagcagg gctataaggt ggtccgtggc cggctggacg tggtcgaccc cgaggcgttc      1140
     ctggccgaca agctgaacct gttgcgcatc ttcgaggaag cgctgcgcac cggcatgctg      1200
     atccatcccg atgcgatgcg gctggtcacc gccaatctgg acctgattga tgacggaatg      1260
     cgcaacgaca aggaggcgcg gcgcatcttc ctggacctgc tcctgaaaca cggcaacccg      1320
     gaacgggcgc tcagacggat gaacgagttg ggggtgctgt cggcctttgt gcccgagttc      1380
     gaacccatcg tcgcgatgat gcagttcaac atgtatcaca gctatacggt ggacgagcac      1440
     acgatccaga ccatcgtcaa cctggcccag atcgaaaagg gagagctggt cgagtcgctg      1500
     ccgctggcct cgtccatcct caaggccggg gtgaaccgca aggttctcta tgtggcgctg      1560
     ctgctgcacg atatcggcaa aggccggccc gaggatcact cgatcctggg ggcccgcatc      1620
     gcccgcaagg tagccccccg cctgggcctg tccaaagccg attgcgaaac ggtggaatgg      1680
     ctggtgcgct atcacctgct gatgtcggac atggcgcaga aacgcgatat ctccgatccg      1740
     cgcaccgtgc gcgactttgc caaggcggtg cagacgacca agcggctgga cctgctgacg      1800
     gtgctgaccg tctgcgacat tcgcggcgtc ggccccaaca cctggaacaa ctggaaggcc      1860
     acgttgttgc gcgccctgca tgcggaaacc aagcgggcgc tggaaatggg gatggaagcg      1920
     ctcaaccgcg aagggcgcgg caacgaggcc aagaaggcgc tgcgcaccgc cctgtccgac      1980
     tggcccgctg gcgaggtcaa gaccgagatc gcccgccact atccccccta ttggcagggg      2040
     ttcaacgtcg aaacccatgt cacctttgcc gagatgctgc gccagctgga acacagcggc      2100
     gaccccggcg gcatcgaaat ccggctcgac ccggacgagg accgcgacgc cacccgcgcc      2160
     tgtttcgcaa tggcggatca ccccggcatc ttttcgcgca tggccggtgc gctggcgctg      2220
     gtcggggcca atgtggtcga tgcccgcagc tataccacca aggacggcta tgtgaccgat      2280
     gcgttctgga tccaggatgc cgaaggccac ccctacgagg cggcccgcct gccccggctc      2340
     agccagatga tcctgaaaac cctcaagggc gaggtggtgg cccgcgatgc gctgaaatcc      2400
     cgcgacaaga tcaagaagcg ggaaaaggcg ttcaacgtgc cgacccatat caccttcgac      2460
     aacgagggat cagacatcta cacgatcatc gaggtcgata cccgcgaccg gcccggcctg      2520
     ttgtatgatc tggcccgggc gctggcggcg gccaatgtct atatcgccaa tgcggtgatc      2580
     gcgacctatg gcgaacaggt ggtcgacagt ttctatgtca aggacatgtt cgggctgaag      2640
     taccattccg aggccaagca gcgcacgctg gagaccaagc tgcgcaaggc catcaccgaa      2700
     ggcgccgaac gggccgccgc atcatga                                          2727
//

If you have problems or comments...

PBIL Back to PBIL home page