(data stored in ACNUC9435 zone)

EMBL: CP000031.GLPK

CP000031.GLPK        Location/Qualifiers
FT   CDS_pept        106644..108122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="SPO0104"
FT                   /product="glycerol kinase"
FT                   /EC_number="2.7.1.30"
FT                   /note="identified by match to protein family HMM PF00370;
FT                   match to protein family HMM PF02782; match to protein
FT                   family HMM TIGR01311"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0104"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93435"
FT                   /db_xref="GOA:Q5LWR1"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWR1"
FT                   /protein_id="AAV93435.1"
FT                   /translation="MTFILAIDQGTTSSRAILFDGEMRRVATAQREFTQHFPEAGWVEH
FT                   DAEEIWQTTVEVCREVIAGQGIGPEQIAGIGITNQRETTVVWDKAGGAPVHRAIVWQDR
FT                   RTAAICERLRHAGCEDDFTAQTGLLLDPYFSGTKVKWILDTVPGARDRAAAGELLFGTI
FT                   DSFLIWRLTGGRVHASDATNAARTLMFDIHQGEWSKDICELLDVPMSMLPEVRDCAADF
FT                   GTTDLFGGQVPILGVAGDQQAATIGQACFQPGMMKSTYGTGCFALLNTGTQPVASQNRL
FT                   LTTIAYQLDGQRTYALEGSIFIAGAAVQWLRDGLGIIENAAQSGALAARADPAQNVILV
FT                   PAFTGLGAPYWKPDCRGAMFGLTRNSGPAEFCKAALESVAYQTRDLWEAMQGDWGADAD
FT                   VILRVDGGMSASDWAMQGLADRLGAPVDRPVMQETTALGAAWLAGMRAGVYPDQAGFAA
FT                   TWALDARFTPKMVEGDREAAYRRWKAAVAAAMMV"
     atgaccttta ttctggcgat cgaccagggc accacttcga gccgggcgat cctgttcgat        60
     ggcgagatgc ggcgggtggc gaccgcgcag cgtgaattca cccagcattt ccccgaagcg       120
     ggctgggtgg aacacgacgc cgaagagatc tggcaaacga cggtcgaggt ctgccgcgag       180
     gtgatcgccg ggcaggggat cgggcccgaa cagatcgccg ggatcggcat caccaaccag       240
     cgggaaacca ccgtggtctg ggacaaggcc ggcggtgcgc ccgtgcatcg cgccatcgtc       300
     tggcaggacc ggcgcaccgc tgcgatttgt gagcggctgc gccatgcggg gtgcgaggat       360
     gactttaccg cccagaccgg tctgctgctg gacccgtatt tctcgggcac caaggtgaaa       420
     tggatcctcg acaccgtgcc gggcgcgcgg gatcgcgcgg cggcgggcga gctgctgttc       480
     ggcaccatcg attcgttttt gatctggcgg ctgaccggtg gccgggttca tgcgagtgat       540
     gcgaccaacg ccgcgcgcac gctgatgttc gatatccatc agggggaatg gagcaaggac       600
     atctgcgagc ttcttgacgt gccgatgtcg atgctgcccg aggtgcgcga ctgcgctgcc       660
     gatttcggca cgacggatct gtttggcggg caggtgccga tcctgggcgt tgccggcgac       720
     cagcaggcgg ccaccatcgg gcaggcctgt ttccagcccg gcatgatgaa atccacctat       780
     ggcaccggtt gttttgcgct gctcaatacc gggacacagc cggtcgcctc gcagaaccgg       840
     ctgctgacga ccatcgccta tcagctggac ggccagcgga cctatgcgct ggaaggctcg       900
     atcttcattg ccggggcggc ggtgcagtgg ctgcgcgacg ggctgggtat catcgagaac       960
     gcggcgcaaa gcggcgcgtt ggcggctcgc gccgatccgg cccagaatgt catcctggtg      1020
     cccgccttta ccggtctggg cgccccctat tggaagcccg attgccgggg cgcaatgttc      1080
     gggctgacgc gcaactccgg tccggccgag ttctgcaagg cggcgctgga aagcgtggcc      1140
     tatcagaccc gcgatctgtg ggaggcgatg cagggcgatt ggggtgcgga tgcggatgtg      1200
     atcctgcgtg tcgatggcgg tatgagcgcg tccgactggg cgatgcaggg cctggccgat      1260
     cgtctgggcg cgccggtgga ccgcccggtg atgcaggaga ccacggcgct gggcgcggcc      1320
     tggctggccg ggatgcgggc aggggtttac cccgatcagg caggctttgc cgcgacctgg      1380
     gcgctagatg cccggttcac ccccaagatg gtcgagggcg accgcgaagc cgcctatcgc      1440
     cgctggaaag cggcagtggc ggcggcgatg atggtctag                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page