(data stored in ACNUC9435 zone)

EMBL: CP000031.GREA

CP000031.GREA        Location/Qualifiers
FT   CDS_pept        complement(324840..325310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="greA"
FT                   /locus_tag="SPO0312"
FT                   /product="transcription elongation factor GreA"
FT                   /note="identified by similarity to SP:P21346; match to
FT                   protein family HMM PF01272; match to protein family HMM
FT                   PF03449; match to protein family HMM TIGR01462"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0312"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93630"
FT                   /db_xref="GOA:Q5LXA4"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LXA4"
FT                   /protein_id="AAV93630.1"
FT                   /translation="MEKIPMTPSGFAALEAELKQLKSVERPAIIKAIAEAREHGDLSEN
FT                   AEYHSAREKQSFIEGRIKELEGVLSLADVIDPTKLSGAIKFGARVTLVDEDTDEEKTWQ
FT                   IVGEHEANIEKGLLNIKSPIARALIGKDEGDSVEVKTPGGQKSYEILSIEYS"
     atggaaaaga tccccatgac gccttcgggc tttgccgcgc tcgaagccga gctgaaacag        60
     ctcaagagcg tagagcgccc agccatcatc aaggccatcg ccgaggcgcg cgaacatggc       120
     gacctttcgg aaaatgccga ataccattcg gcgcgcgaga agcagtcctt tatcgagggc       180
     cgcatcaagg aactggaagg cgtgctgtcg ctggccgatg tcatcgaccc cacaaaactg       240
     tccggcgcga tcaagttcgg ggcccgggtg acgctggtgg acgaggacac cgacgaggaa       300
     aagacctggc agatcgtcgg tgaacacgag gccaatatcg aaaagggcct gttgaacatc       360
     aaatcgccga ttgcccgcgc gctgatcggc aaggacgaag gcgacagcgt cgaggtgaag       420
     acccccggcg gccagaaatc ctatgaaatc ctgagtatcg agtactcctg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page