(data stored in ACNUC9435 zone)

EMBL: CP000031.GRPE

CP000031.GRPE        Location/Qualifiers
FT   CDS_pept        8205..8768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="SPO0010"
FT                   /product="co-chaperone GrpE"
FT                   /note="identified by match to protein family HMM PF01025"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0010"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93341"
FT                   /db_xref="GOA:Q5LWF4"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWF4"
FT                   /protein_id="AAV93341.1"
FT                   /translation="MAKPNNEEFLDDIATAEAEELAEEMAEISDEAAELDTLRAERDAF
FT                   KDKFMRALADAENVRKRGERARREAEQYGGSKLARDMLPVYDNMKRALETVTDEQRAVS
FT                   GALIEGIELTMRALLDVFGKHGIQVLSPQVGDRFDPQMHEAMFEAPVPGTKAGDIIQVS
FT                   AEGFMLHDRLLRPAQVGVSSMPAG"
     atggcaaagc cgaacaacga agagtttctg gacgatatcg caaccgccga ggccgaggaa        60
     ctggccgagg agatggccga gatcagcgac gaggcggcag agctggatac gctgcgggcc       120
     gagcgggatg cgttcaagga caaattcatg cgcgcgctgg cagatgccga gaacgtgcgc       180
     aagcggggcg aacgcgcccg gcgcgaggcc gagcaatatg gcggttcgaa actggcccgc       240
     gacatgctgc cggtctatga caacatgaaa cgcgcgctgg aaaccgtgac cgacgaacag       300
     cgcgcggtat cgggggcgct gatcgagggc atcgaactga cgatgcgggc gctgctggat       360
     gtgttcggca agcatggcat ccaggtgctg tcgccgcagg tgggcgaccg gttcgacccg       420
     cagatgcacg aagcgatgtt cgaggcgccg gtgcccggca ccaaggcggg cgatatcatc       480
     caggtttcgg ccgaaggctt catgctgcac gaccgtctgc tgcgcccggc gcaggtcggc       540
     gtatcgtcga tgcccgcggg ctga                                              564
//

If you have problems or comments...

PBIL Back to PBIL home page