(data stored in ACNUC7421 zone)

EMBL: CP000031.GSHB

CP000031.GSHB        Location/Qualifiers
FT   CDS_pept        413677..414609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="SPO0401"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="identified by similarity to SP:P04425; match to
FT                   protein family HMM PF02951; match to protein family HMM
FT                   PF02955; match to protein family HMM TIGR01380"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0401"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93719"
FT                   /db_xref="GOA:Q5LWE1"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWE1"
FT                   /protein_id="AAV93719.1"
FT                   /translation="MKIAFQMDPIGAVNINADSSFRLAEEAQARGHELFYYGPDQLAYQ
FT                   EGRITARGHDMTVQRVAGDPAVLGPLREVDLAEFDVVWLRQDPPFDMHYITSTHLLDRL
FT                   KGQTLVVNDPFWVRNYPEKLLVLNFPELTPPTTIARDLDTIRAFKARHGDIILKPLYGN
FT                   GGAGVFRLDENDRNLSSLHELFVGFSREPLIVQKYLPDVRKGDKRVILVDGEAVGAINR
FT                   VPAEGEVRSNMHVGGRPEKIGLTDRDREICTAIGPLLREKGQIFVGIDVIGDYLTEINV
FT                   TSPTGIQELERFDGGNIAGRIWEAIEAKL"
     atgaagatcg cctttcagat ggacccgatc ggggccgtga acatcaatgc cgacagctct        60
     ttccggctgg ccgaagaggc gcaggcgcgt gggcatgagc tgttctatta cggccctgat       120
     caactggcct atcaagaggg ccggatcacc gcgcgtgggc atgacatgac cgtgcagcgc       180
     gtggctggcg acccggccgt tcttgggccg ctgcgcgagg tcgatctggc cgaattcgat       240
     gtggtctggc tgcgccagga tccgccgttc gacatgcatt acatcacctc gacccatctg       300
     ctggaccggc tcaaggggca gacgcttgtg gtcaacgacc cgttctgggt gcgcaactat       360
     cccgagaagc tgctggttct gaatttcccc gagctgaccc cgcccaccac catcgcgcgt       420
     gatctggaca ccatccgcgc gttcaaggcc cgacatggcg acatcatcct gaagccgctt       480
     tatggcaatg gcggtgctgg cgtgttccgt ctggacgaga atgaccgcaa cctgtcgtcg       540
     ctgcacgaat tgttcgtggg gttctcgcgt gagccgctga tcgtgcagaa atacctgccg       600
     gatgtgcgca agggcgacaa gcgggtgatc ctcgtcgatg gagaggccgt cggtgccatc       660
     aaccgggtgc ccgccgaggg cgaggtgcgg tcgaacatgc acgtgggcgg gcggcccgag       720
     aagatcgggt tgaccgaccg cgaccgcgag atttgcaccg ccatcggccc gctcctgcgg       780
     gaaaagggac agatctttgt cgggatcgac gtgatcggcg actatctgac cgagatcaac       840
     gtgacctcgc cgaccggtat tcaggaactg gagcgcttcg atggggggaa catcgccggt       900
     cgtatctggg aagccatcga ggccaagctc tga                                    933
//

If you have problems or comments...

PBIL Back to PBIL home page