(data stored in ACNUC7421 zone)

EMBL: CP000031.HEMH

CP000031.HEMH        Location/Qualifiers
FT   CDS_pept        74429..75424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="SPO0073"
FT                   /product="ferrochelatase"
FT                   /EC_number="4.99.1.1"
FT                   /note="identified by match to protein family HMM PF00762;
FT                   match to protein family HMM TIGR00109"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0073"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93404"
FT                   /db_xref="GOA:Q5LWM0"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWM0"
FT                   /protein_id="AAV93404.1"
FT                   /translation="MGRVGVLLANLGTPDDYSYWPMRRYLNEFLSDKRVIDYPAWKWQP
FT                   ILQGIILTKRPFSSGAAYESIWNHDKGESPLMTITKDQTAKLRAALAERYGDRVMVDFC
FT                   MRYGNPSTKSKVRQMVTEGCDRILFFPLYPQYAGATTATANDQFFRALMDETWQPAART
FT                   VPAYFDQPAYVDALAQSIERAYAAMDSRPDVLVCSYHGMPERYLMQGDPYHCQCVKTTR
FT                   LLRERLGWDESEVVSTFQSRFGPEEWLKPYTVDHVAELARQGKRNIAVVAPAFSADCIE
FT                   TLEEINEEIRESFEHAGGERFTYIPCLNDEDAHIAALAGVVASNLGGWLD"
     atgggccgcg tcggcgtgtt gctggccaat ctcggcacgc ctgacgacta ttcctattgg        60
     ccgatgcggc gctatctgaa cgagttcctg tcggacaagc gggtgatcga ctatccggcc       120
     tggaaatggc agccgatcct gcagggcatc atcctgacca agcggccgtt cagctcgggt       180
     gcggcctatg aatccatctg gaatcacgac aagggcgaaa gcccgctgat gacgatcacc       240
     aaggaccaga ccgccaagct gcgcgcggcg ctggccgagc gctatggcga ccgggtgatg       300
     gtggatttct gcatgcgcta cggcaatccc tcgaccaagt cgaaggtgcg ccagatggtg       360
     accgagggct gcgaccgtat cctgttcttt ccgctctacc cgcaatatgc cggggcgacg       420
     acggcaacgg ccaacgacca gttctttcgc gcgctgatgg acgagacctg gcagcccgcc       480
     gcgcgtaccg tgccggccta tttcgatcag cccgcctatg tcgatgcgct ggcgcagtcg       540
     atcgaacggg cctatgcggc gatggacagc cgccccgacg tgctggtctg ctcgtatcac       600
     ggcatgcccg agcgctatct gatgcaaggc gacccgtacc attgccagtg cgtgaaaacc       660
     acgcgactgc tgcgcgagcg gctgggctgg gacgagagcg aggtggtatc gacctttcag       720
     tcgcgattcg gccccgaaga gtggctcaaa ccctatacgg tcgaccacgt ggccgaactg       780
     gcgcggcagg gtaagcggaa catcgcggtg gtggcgccgg ccttttcagc cgattgcatc       840
     gagacgctgg aagagatcaa cgaggaaatc cgcgagagct ttgaacatgc gggcggtgag       900
     cggttcacct atatcccctg cctcaatgac gaggatgccc atatcgcggc gctggccggt       960
     gtggtggcaa gcaatctggg gggctggctg gactga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page