(data stored in ACNUC7421 zone)

EMBL: CP000031.HRCA

CP000031.HRCA        Location/Qualifiers
FT   CDS_pept        7130..8194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="SPO0009"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="identified by similarity to SP:P54305; match to
FT                   protein family HMM PF01628; match to protein family HMM
FT                   TIGR00331"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0009"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93340"
FT                   /db_xref="GOA:Q5LWF5"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWF5"
FT                   /protein_id="AAV93340.1"
FT                   /translation="MSDARKILDDLNDRSREVFRLIVESYLDSGEPVGSRTLTRTLSEK
FT                   VSAATVRNVMQDLEFLGLLDSPHISAGRIPTQMGLRMFVDGLLEVADLSLDDRAKLDAT
FT                   LGTNAGDVGGTLDRISATLSRVTQGASLVLTPKHEAEIRHIEFVSLAQDRALVVLVFSD
FT                   GHVENRLFAPPPGQTPSSMREAANFLNALIEGKTLSEVRRLMQTEIGARQQEIDQLARQ
FT                   MVESGLAVWDREGEEAARLIVRGRANLLEGTGQEQELERIRVLFDDLERKRDIAEFLQL
FT                   TEDGEGVRIFIGSENKLFSLSGSSLVVSPYMNADRKVIGAVGVIGPTRLNYGRIVPIVD
FT                   YTAQLVGRLISDRS"
     atgagcgatg cgcgcaaaat actggacgat ttgaacgacc gctcgcgcga ggtgtttcgc        60
     ctgatcgttg aatcctatct ggacagcggc gaaccggtcg gcagccgcac cctgacgcgt       120
     acactcagcg agaaggtcag cgccgcaacc gtgcgcaacg taatgcagga tctggagttc       180
     ctgggcctgc tcgacagccc ccatatcagc gccgggcgta tcccgacgca gatggggctg       240
     aggatgtttg tcgacgggct gctcgaggtg gcggatctga gcctggatga tcgggccaag       300
     ctggacgcga cactgggcac aaacgcgggc gacgtgggcg ggacgctgga ccggatcagc       360
     gccacgctca gccgggtgac acagggggcc tcgttggtgc tgacgcccaa gcacgaggcc       420
     gaaatccgcc atatcgagtt tgtctcgctg gcgcaggatc gggcgttggt ggtgctggtc       480
     ttttcggatg gccatgtgga aaaccgcctg tttgcgccgc ccccggggca gacccccagt       540
     tcgatgcgcg aggcggccaa tttcctgaac gcgctgatcg agggcaagac cctcagcgag       600
     gtgcgccgcc tgatgcagac cgagatcggc gcccgccagc aggaaatcga ccagctggcc       660
     cgtcagatgg tcgaaagcgg tctggcggtc tgggaccgcg agggcgaaga ggccgcccgg       720
     ctgatcgtgc gcgggcgggc gaatctgctg gagggaaccg gccaggaaca agagctggag       780
     cggatccggg tgctgttcga cgatcttgag cgcaagcgcg acatcgccga gtttctgcaa       840
     ctgaccgaag acggcgaagg tgtgcgcatt tttatcggct ccgagaacaa acttttctca       900
     ctttcgggtt cctctttggt ggtgtctcca tatatgaacg cggatcgaaa ggttatcggt       960
     gcggtggggg tgatcggccc gacgcgcctg aactatggtc gcatcgttcc gatcgtggat      1020
     tacacggcac agctggtcgg gcgtctgatt tccgaccgga gttag                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page