(data stored in ACNUC9435 zone)

EMBL: CP000031.ILVE

CP000031.ILVE        Location/Qualifiers
FT   CDS_pept        273044..273910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="SPO0253"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /note="identified by similarity to SP:P00510; match to
FT                   protein family HMM PF01063; match to protein family HMM
FT                   TIGR01122"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0253"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93573"
FT                   /db_xref="GOA:Q5LX36"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005785"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LX36"
FT                   /protein_id="AAV93573.1"
FT                   /translation="MASYDDRDGVIWMDGELVDWRDAKVHILTHAMHYASSVFEGERAY
FT                   NGKIFKSREHSERLVASAQALDMPMPYTVDQIEAAKEETLKASGLTDAYVRALVWRGSG
FT                   EDMGVASARNPVRMAIAVWPWGAYYGDAKMQGAKLDIAEWKRPSPETIPVHAKAAGLYM
FT                   ICTISKHKAEAKGCSDALFMDWRGYVAEATGANVFFVKDGEVHTPLADCFLNGITRQTV
FT                   IGMLKDKGITVHERRIKPEEMEGFEQCWLTGTAAEVTPVGQIGPYTFEVGQMTRDIAAE
FT                   YEALVRA"
     atggcgagtt atgacgatcg cgatggcgtg atctggatgg atggggagct ggtcgattgg        60
     cgcgacgcca aggtgcatat cctgacccat gccatgcatt atgcctcgtc cgtgttcgaa       120
     ggtgagcgcg cctataacgg caagattttc aaaagccgcg agcattccga acggctggtt       180
     gccagcgccc aggcgctgga catgccgatg ccctatacgg tcgatcagat cgaggcggcc       240
     aaggaggaga cgctgaaggc cagtggtctg accgatgcct atgtgcgcgc gctggtctgg       300
     cgtggctcgg gcgaggacat gggcgtggcc tcggctcgca acccggtgcg gatggcgatc       360
     gcggtctggc cctggggcgc ctattacggc gacgccaaga tgcagggcgc caagctggac       420
     atcgccgagt ggaagcggcc cagccccgag acgatcccgg tgcatgccaa ggcggctggc       480
     ctttacatga tctgcaccat ctccaagcac aaggccgagg ccaagggctg ttcggatgcg       540
     ctgttcatgg actggcgcgg ttatgtggcc gaggcgaccg gcgccaacgt gttctttgtc       600
     aaggacggag aggtgcatac gccgctggcc gactgcttcc tgaacggcat cacccggcag       660
     acagtgatcg ggatgctcaa ggacaagggc atcaccgtgc acgagcgccg catcaagccg       720
     gaagagatgg aagggttcga acagtgctgg ctgaccggca ccgccgccga ggtcaccccg       780
     gtgggccaga tcggtcccta cacgttcgaa gtgggccaga tgacgcgcga tatcgcggcg       840
     gagtacgagg cgctggttcg ggcgtaa                                           867
//

If you have problems or comments...

PBIL Back to PBIL home page