(data stored in ACNUC7421 zone)

EMBL: CP000031.ISPE

CP000031.ISPE        Location/Qualifiers
FT   CDS_pept        330431..331270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="SPO0318"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="identified by match to protein family HMM PF00288;
FT                   match to protein family HMM TIGR00154"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0318"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93636"
FT                   /db_xref="GOA:Q5LX98"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LX98"
FT                   /protein_id="AAV93636.1"
FT                   /translation="MAIEAFAPAKINLTLHVTGQRDDGYHLLDSLVVFADIGDTIRVSA
FT                   SDRVSLDIDGPEAGGLAAEPDNLVLRAARLLAPERGAAISLTKRLPVASGIGGGSADAA
FT                   ATLRALAQLWGLAAPSAEQALTLGADVPVCLFPVPARMQGIGDRLGPIPPLPAMDIVLV
FT                   NPRVAVSTPAVFKSLIVKENAPMNPELPRWRDLPEFTCWLADQRNDLAEPAIAQQPVIA
FT                   DVLNALRDAGALFAGMSGSGATCFGLFPSDGHSAKSVAKAVLRLAHPGWWCAHGRVL"
     atggcgattg aggcctttgc gccggccaag atcaacctga ccctgcatgt gaccggccag        60
     cgggatgatg gctatcactt gctcgattcg ctggttgtct tcgcggatat cggagacacc       120
     atccgagtgt ctgcgtcaga cagggtgtcg ttggatatcg acgggccaga ggcgggcgga       180
     cttgccgccg agccggacaa tctggtgctg cgcgcggccc gccttctggc gcctgaacgc       240
     ggcgctgcga tctcgctgac gaaacggctg cccgtggcct cgggtatcgg tggggggtcg       300
     gccgatgccg ccgccaccct gcgcgccctg gcgcagcttt ggggcctcgc cgcgcccagt       360
     gcagaacagg cgctgacact tggcgctgat gttcctgtct gtctgttccc ggtgccggcc       420
     cgcatgcaag gtatcggtga ccggctgggc ccgataccgc cactgcccgc gatggatatc       480
     gttctggtca atccgcgcgt cgcggtttcg acgcccgccg ttttcaagtc gctgatcgtg       540
     aaggaaaacg cgcccatgaa cccggaactg ccgcgctggc gcgacctgcc cgagttcacc       600
     tgctggctcg ccgatcagcg caacgacctt gccgaacctg ccatcgcgca gcagccggtg       660
     atcgccgatg tgctgaatgc cctgcgcgac gcaggggcgc ttttcgccgg tatgtccggc       720
     tcgggggcca cctgttttgg tctcttcccg tccgatgggc attccgccaa gtcggttgcc       780
     aaggccgtgc tccgcctagc gcatccaggg tggtggtgcg cccacgggcg tgttctctag       840
//

If you have problems or comments...

PBIL Back to PBIL home page