(data stored in ACNUC7421 zone)

EMBL: CP000031.KDSB

CP000031.KDSB        Location/Qualifiers
FT   CDS_pept        complement(38766..39566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsB"
FT                   /locus_tag="SPO0038"
FT                   /product="3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /note="identified by match to protein family HMM PF02348"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0038"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93369"
FT                   /db_xref="GOA:Q5LWI2"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWI2"
FT                   /protein_id="AAV93369.1"
FT                   /translation="MSVLIAIPARYASTRYPGKPLVSLTGASGTEMTLIERSWRAAMAV
FT                   SGADRVVVATDDDRIRAVAEGFGAEVVMTSSDCVNGTERCAEAHAVLGGGFDIVVNLQG
FT                   DAPLTPHWFVEDLIAGLRAAPEADIATPVLRCDGMALNGFLNDRKHGRVGGTTAVFAAD
FT                   RSALYFSKEVIPFTSQIYADDAPTPVFHHVGVYAYRPGALADYPTWPMGPLETLEGLEQ
FT                   LRFMENGRKVLCVEVEARGRQFWELNNPEDVARIEEMMAAMGLD"
     atgtccgtcc tcatcgccat tcccgcccgc tatgcctcga cccgctatcc cggcaagccg        60
     ctggtcagcc tgaccggcgc cagtggcacg gaaatgacgc tgatcgaacg ctcgtggcgg       120
     gcggcgatgg cggtgagcgg cgccgaccgg gtggtggtcg ccaccgatga cgaccgcatc       180
     cgcgcggtgg ccgaaggctt cggggccgag gtcgtcatga cctcgtcaga ttgcgtcaac       240
     gggaccgagc gctgcgccga ggcacatgcg gtgctgggtg gcggtttcga catcgtggtg       300
     aacctgcagg gcgatgcgcc gctgaccccg cactggtttg tcgaggatct gatcgcgggc       360
     ctgcgcgccg cgcccgaggc cgatatcgca acaccggtgc tgcgctgtga cggcatggcg       420
     ctgaacgggt ttctgaacga tcgcaaacat ggccgggttg gtggcaccac ggcggtgttc       480
     gcggccgacc gcagcgcgct ctatttctcc aaggaggtga tccccttcac ctcgcagatc       540
     tatgccgatg acgcacccac tccggtgttc caccatgtcg gcgtctatgc ctatcggcct       600
     ggcgcgctgg cggattatcc gacctggccg atggggccgc tggaaacgct cgaagggctg       660
     gaacagctgc gtttcatgga aaacgggcgc aaggttctgt gtgtcgaggt cgaggcgcgc       720
     gggcgccagt tctgggagct gaacaacccc gaggacgtgg cccggatcga agagatgatg       780
     gccgcgatgg ggctggactg a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page