(data stored in ACNUC9435 zone)

EMBL: CP000031.KDSD

CP000031.KDSD        Location/Qualifiers
FT   CDS_pept        complement(80401..81369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsD"
FT                   /locus_tag="SPO0082"
FT                   /product="arabinose 5-phosphate isomerase"
FT                   /EC_number="5.3.1.13"
FT                   /note="identified by similarity to SP:P45395; match to
FT                   protein family HMM PF00571; match to protein family HMM
FT                   PF01380; match to protein family HMM TIGR00393"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0082"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93414"
FT                   /db_xref="GOA:Q5LWM9"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWM9"
FT                   /protein_id="AAV93414.1"
FT                   /translation="MTDRSSFIDTARQVVLDEARALDALSESLGDGFAEAVELILRTKG
FT                   RVIVSGIGKSGHIGHKIAATLASTGTPAYFVHPAEASHGDLGMLSGDDVVLAISNSGEA
FT                   PELANLLAFTRRFAIPLIGLSSKSESSLMQQADVHLLIPALGEACGFGMVPSISTTLTL
FT                   AMGDALAIALMKYRDFRPENFRVFHPGGKLGARLSRVSDLMHGGEAVPLIAADTPMSEA
FT                   LLEISRKGFGVVGVTDGAGHLAGIVTDGDLRRHMSGLLDKTAAQVMTANPTTIAPDSLA
FT                   EEAVAIMNARKITSLFVVDPAEPGVARGLLHIHDCLRVGLG"
     atgaccgatc gcagctcttt catcgacacc gcacgccagg tcgtgctgga cgaggcccgg        60
     gcgcttgatg cgctgtccga gagcctgggc gacgggttcg ccgaggcggt ggagctgatc       120
     ctgcgcacca aggggcgcgt gatcgtttcg ggcattggca agtcgggcca tatcggccac       180
     aagatcgccg cgacgctggc cagcaccggc acgcccgcct atttcgtgca cccggccgag       240
     gcgagccatg gcgatctggg aatgctctcc ggggatgacg tggttctggc catctcgaac       300
     tcgggcgagg cgccggaact ggccaatctg ctggccttta cccgccgctt cgccattccg       360
     ctgatcgggc tgtcgagcaa atctgagagc tcgctgatgc agcaggccga tgtgcatctg       420
     ctgatcccgg cgctgggcga ggcctgcggc tttggcatgg tgccgtcgat ctcgaccacg       480
     ctgacgctgg ccatgggcga cgcactggcc atcgcgctga tgaagtaccg cgatttccgg       540
     cccgagaact tccgcgtctt ccatcccggc ggcaagctgg gcgcgcggct cagccgggtg       600
     tcagacctga tgcatggcgg cgaggcggta ccgttgatcg ccgccgacac cccgatgagc       660
     gaggcgctgc tggagattag ccgcaagggg tttggcgtgg tcggcgtgac cgatggcgcc       720
     ggacatctgg ccggaatcgt caccgatggc gacctgcgtc gtcacatgtc gggcctgctc       780
     gacaagaccg ccgcccaggt gatgaccgcc aacccgacca ccatcgcccc cgactcgctg       840
     gccgaggaag cggtggctat catgaacgcg cgcaagatca cctcgctttt cgtggtcgat       900
     ccggcggaac cgggcgtggc gcgcgggctg ctgcatatcc acgactgtct gcgcgtcgga       960
     ctgggctag                                                               969
//

If you have problems or comments...

PBIL Back to PBIL home page