(data stored in ACNUC9435 zone)

EMBL: CP000031.LEUA

CP000031.LEUA        Location/Qualifiers
FT   CDS_pept        complement(435291..436865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="SPO0422"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="identified by match to protein family HMM PF00682;
FT                   match to protein family HMM TIGR00973"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0422"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93740"
FT                   /db_xref="GOA:Q5LWC0"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LWC0"
FT                   /protein_id="AAV93740.1"
FT                   /translation="MTHVTDQDRVLIFDTTLRDGEQSPGATMTHTEKLEIAEMLDEMGV
FT                   DIIEAGFPIASEGDFKAVSEIAKRAQNSRICGLARANFADIDRCWEAVKHAEKNRIHTF
FT                   IGTSPLHRAIPNLTQDEMAEKIHETVSHARNLCDNVQWSPMDATRTEWDYLCRVIEIAI
FT                   KAGATTINIPDTVGYTAPAESADLIRRLIETVPGADDVIFATHCHNDLGMATANSLAAV
FT                   AGGARQIECTINGLGERAGNTALEEVVMAMKTRHDIMPWRTGIDTTKIMAISRRVATVS
FT                   GFNVQFNKAIVGKNAFAHESGIHQDGMLKNRENFEIMRPEDIGLSGTSLPLGKHSGRAA
FT                   LRDKLEHLGYEVGDNQLKDIFVRFKELADRKKEVFDDDVIALMRSGENAEQDHLQLVSM
FT                   KVICGTGGPAEATVEMEIDGKDVSATAHGDGPVDASFKAIRALHPNEAHLQLYQVHAVT
FT                   EGTDAQATVSVRLEEDGMIATGESANTDTVVASAKAYINALNRLIVRREKAGPGADARE
FT                   ISYKDLT"
     atgacccatg tgaccgacca agaccgcgtc ttgatctttg acaccacctt gcgcgacggt        60
     gagcagagcc ccggcgccac catgacccat accgaaaagc tcgagattgc cgagatgctc       120
     gacgagatgg gcgtggacat catagaggcc ggcttcccca tcgcctccga aggggatttc       180
     aaggcggtaa gcgagatcgc caaacgcgcg cagaacagcc gcatctgcgg gctggcacgc       240
     gccaatttcg ccgatatcga ccgctgctgg gaggcggtga aacacgccga aaagaaccgc       300
     attcacacct tcatcggtac ctcgccgctg caccgcgcca ttccgaacct gacccaggac       360
     gagatggccg agaagatcca cgaaaccgtc agccacgccc gcaacctgtg cgacaacgtg       420
     caatggtcgc cgatggatgc aacccggacc gagtgggatt acctctgccg ggtgatcgag       480
     atcgcgatca aggccggcgc caccaccatc aacatccccg ataccgtggg ctatacagcc       540
     cccgccgaaa gcgccgatct gatccggcgg ctgatcgaaa cggtgccggg tgccgacgat       600
     gtgatctttg ccacccattg ccacaacgac ctgggcatgg cgacggccaa cagcctcgcc       660
     gccgtcgccg gtggcgcgcg tcagatcgaa tgcaccatca acggtctggg cgaacgcgcc       720
     ggcaacaccg cgctggaaga ggtggtgatg gcgatgaaga cccgccacga catcatgccc       780
     tggcgcaccg ggatcgacac caccaagatc atggcgatct cgcgccgggt ggcgaccgtg       840
     tccgggttca acgtgcagtt caacaaggcc atcgtgggca agaacgcatt cgcccatgaa       900
     agcggcatcc accaggacgg gatgctgaag aatcgcgaga atttcgagat catgcggccc       960
     gaggatatcg gcctttccgg cacctcgctg ccgctgggca agcattcggg ccgggcggcg      1020
     ctgcgcgaca agctcgaaca ccttggctac gaggtgggcg acaaccagct caaggacatc      1080
     ttcgttcggt tcaaggaact ggccgaccgc aagaaagagg tgttcgacga cgatgtgatc      1140
     gcgctgatgc gctcgggcga gaatgccgag caggaccatt tgcaactggt gtcgatgaaa      1200
     gtgatctgcg gcaccggtgg cccggccgag gcgacggtcg agatggaaat cgacggcaag      1260
     gatgtcagcg ccaccgcgca tggcgacggg ccggtggatg ccagtttcaa ggcgatccgc      1320
     gcgttgcatc ccaacgaggc gcatctgcag ctttatcagg tgcacgcggt gaccgaaggc      1380
     accgacgccc aggcgactgt cagcgtgcgg ctggaagagg atggcatgat cgccaccggc      1440
     gagtcggcca ataccgacac ggtggtggca agcgccaagg cctatatcaa cgcgctcaac      1500
     cgtctgatcg tgcggcgcga gaaggccggt cccggcgccg atgcccgcga gatcagctac      1560
     aaggacctga cctga                                                       1575
//

If you have problems or comments...

PBIL Back to PBIL home page