(data stored in ACNUC7421 zone)

EMBL: CP000031.LEUB

CP000031.LEUB        Location/Qualifiers
FT   CDS_pept        complement(230495..231598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="SPO0210"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="identified by similarity to SP:Q51375; match to
FT                   protein family HMM PF00180; match to protein family HMM
FT                   TIGR00169"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0210"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93535"
FT                   /db_xref="GOA:Q5LWZ5"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LWZ5"
FT                   /protein_id="AAV93535.1"
FT                   /translation="MSNPSLLILPGDGIGPEVMAEVRKIIGWFGDKRGLNFDVSEDLVG
FT                   GAAYDVHGVPLADETMAKAQEADAVLLGAVGGPKYDDLDFSVKPERGLLRLRKEMDLFS
FT                   NLRPAQCFDALADFSSLKKDIVAGLDIMIVRELTSGVYFGEPRGIFEEGNERVGINTQR
FT                   YTESEIERVARSAFELAMRRSKKLCSMEKANVMESGILWREVVTRVAKDYPEVELSHMY
FT                   ADNGAMQLVRAPKQFDVILTDNLFGDILSDCAAMLTGSLGMLPSASLGAPMANGRPKAL
FT                   YEPVHGSAPDIAGQGKANPIACILSFAMALRYSFDQGAEADRLEAAVEQVLADGVRTAD
FT                   LLGTEGVTPVSTTEMGAAILAKLDASL"
     atgtccaatc cctcgctcct catcctgccc ggtgacggaa ttggccccga agtcatggcc        60
     gaagtgcgca agatcatcgg ctggttcggc gacaagcgcg gcctgaattt cgacgtcagc       120
     gaggacctgg tcggcggtgc cgcctatgac gtccatggcg tgccgctggc ggacgagacc       180
     atggccaagg cgcaagaggc cgatgccgtg ttgctgggcg ccgtgggtgg ccccaaatac       240
     gacgatctcg atttcagcgt caaacccgaa cgcggcctgc tgcgcctgcg caaggagatg       300
     gacctgttct ccaacctgcg cccggcccag tgtttcgacg cgctggccga tttctcatcg       360
     ctgaaaaagg acatcgttgc cgggctcgac atcatgatcg tgcgcgagct gacctcgggt       420
     gtctatttcg gcgagccgcg cggcatcttc gaagagggca acgagcgggt gggcatcaac       480
     acccagcgct ataccgaaag cgagatcgaa cgggtcgcac gctcggcttt tgagttggcg       540
     atgcgccgca gcaagaagct gtgctcgatg gaaaaggcca acgtgatgga atcgggcatc       600
     ctgtggcgcg aggtggtgac ccgcgtggcc aaggactatc ccgaggtcga actcagccac       660
     atgtatgccg acaacggtgc catgcagctg gtccgcgcgc ccaagcagtt tgacgtgatc       720
     ctgaccgaca acctgttcgg cgacatcctg tcggactgcg ccgcgatgct gaccggcagc       780
     cttggcatgc tgccctcggc ctcgctgggc gcaccgatgg ccaatggccg ccccaaggcg       840
     ctgtacgagc ccgtgcacgg ctcggccccc gatatcgcag gccaaggcaa ggccaacccg       900
     atcgcctgta tcctcagctt tgccatggcg ctgcgctaca gctttgacca gggcgccgag       960
     gccgaccggc tagaagcagc ggtggaacag gttctggccg acggtgtgcg caccgccgac      1020
     ctgctgggaa ccgagggtgt gaccccggtc tcgaccaccg aaatgggtgc cgcgatcctg      1080
     gcgaaactgg acgccagcct ctaa                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page