(data stored in ACNUC7421 zone)

EMBL: CP000031.LEUD-1

CP000031.LEUD-1      Location/Qualifiers
FT   CDS_pept        complement(235799..236404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD-1"
FT                   /locus_tag="SPO0215"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="identified by similarity to SP:P96196; match to
FT                   protein family HMM PF00694; match to protein family HMM
FT                   TIGR00171"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0215"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93540"
FT                   /db_xref="GOA:Q5LX07"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LX07"
FT                   /protein_id="AAV93540.1"
FT                   /translation="MEKFTKIQGIAAPMPLVNIDTDMIIPKVFLKSIQRTGFGKNLFDE
FT                   MRYNRDGTEIPDFVLNKPQYRDAEILVAGDNFGCGSSREHAPWAIADFGIKCIISTSFA
FT                   DIFFNNSFKNGILPIVLPQEQVDILMKDAEKGANARMTVDLEAQEITTSDGEVIPFEVD
FT                   AFKKHCLLNGLDDIGLTMEKAAAIDTFEAQAAQARPWV"
     atggaaaaat tcaccaaaat ccagggcatc gcggccccca tgccgctggt caatatcgac        60
     accgacatga tcatccccaa ggtgttcctg aaatccatcc agcggaccgg gttcggcaag       120
     aacctgttcg acgagatgcg ctataaccgc gacggcaccg agatccccga tttcgtgctg       180
     aacaagccgc aataccgcga tgccgaaatc ctggtggccg gcgacaattt cggctgcggc       240
     tcctcgcgcg aacacgcccc ctgggcgatc gccgatttcg gcattaaatg catcatctcg       300
     acctcctttg ccgacatctt cttcaacaac agcttcaaga acggcatcct gccgatcgtg       360
     ctgccgcagg aacaggtcga tatcctgatg aaggatgccg agaagggggc caatgcccgc       420
     atgaccgtgg acctggaagc gcaagagatc actacctcgg atggagaggt gatcccgttc       480
     gaagtcgacg ccttcaagaa gcactgcctg ctcaacggtc tggacgatat cgggctgacc       540
     atggaaaagg ccgccgccat cgacacgttc gaagcgcagg ccgcgcaggc gcgtccctgg       600
     gtttga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page