(data stored in ACNUC9435 zone)

EMBL: CP000031.LPDA

CP000031.LPDA        Location/Qualifiers
FT   CDS_pept        complement(351721..353109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /locus_tag="SPO0340"
FT                   /product="2-oxoglutarate dehydrogenase, E3 component,
FT                   dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF02852; match to protein
FT                   family HMM TIGR01350"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0340"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93660"
FT                   /db_xref="GOA:Q5LXD1"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXD1"
FT                   /protein_id="AAV93660.1"
FT                   /translation="MATYDVIIIGAGPGGYVCAIRCAQLGLKTAVVEGRETLGGTCLNV
FT                   GCIPSKALLHASHSLHEAQHNFAKMGLKGKSPSVDWKQMLAYKDEVIEGNTKGIEFLFK
FT                   KNKIDWIKGWASIPAAGKVQVGDDTHEAKNIIIASGSEPASLPGVEVDEKTVVTSTGAL
FT                   ELGKIPKSLVVIGAGVIGLELGSVYARLGAEVTVVEFLDVITPGMDGEVQKTFQRILKK
FT                   QGLTFVMGAAVQKTEIARGKAKVTYKLLKKDTEHEIEADTVLVATGRKPYTAGLGLDKL
FT                   GIEMTQRGQIKVGKDWQTNVPGIYAIGDVIEGPMLAHKAEDEGMAAAEQVAGKHGHVNY
FT                   GVIPGVIYTTPEVANVGATEESLKAEGRAYKVGKFMFMGNGRAKANFASDGFVKILADK
FT                   ETDRILGAHIIGPAAGELIHEVCVAMEFGASAEDLALTCHAHPTYSEAVREAALACGDG
FT                   PIHS"
     atggcaacct atgacgtcat catcatcggc gcaggccccg gcggctatgt ctgcgccatc        60
     cgctgcgccc agctgggttt gaaaaccgcc gtggtcgagg gccgcgaaac cctgggcggc       120
     acctgcctga acgtgggctg catcccgtcc aaggcgctgc tgcacgcctc gcattcgctg       180
     cacgaggcgc aacacaactt tgccaagatg ggactcaagg gcaaaagccc ttcggtcgac       240
     tggaagcaga tgctcgccta caaggacgag gtgatcgagg gcaataccaa gggcatcgaa       300
     ttcctgttca agaagaacaa gatcgactgg atcaagggct gggcctcgat ccctgccgcg       360
     ggcaaggtgc aggtgggcga cgacacccac gaggcgaaga acatcatcat cgcctccggc       420
     tccgaaccgg cctcgttgcc gggtgtcgag gtggacgaga agaccgtcgt gacctcgacc       480
     ggcgcgctgg aactgggcaa gatcccgaaa tccctggtgg tgatcggcgc cggtgtcatc       540
     gggctggaac tgggctcggt ctatgcccgc ctgggtgccg aggtgacggt ggtcgagttc       600
     ctcgacgtga tcacccccgg catggacggc gaagtgcaaa agaccttcca gcgcatcctg       660
     aaaaagcagg gcctgacctt cgtcatgggt gccgcggtgc aaaagaccga aatcgccagg       720
     ggcaaggcca aggtcaccta caagctgctg aaaaaggaca ccgagcacga gatcgaggca       780
     gataccgtgc tggttgccac cgggcgcaaa ccctatactg cgggtctggg cctcgacaag       840
     ctggggatcg agatgaccca gcgcggccag atcaaggtgg gcaaggactg gcagaccaac       900
     gtgcccggca tctacgccat cggcgacgtg atcgaaggcc cgatgctcgc ccacaaggcc       960
     gaggacgagg ggatggccgc cgccgaacag gtcgcgggca agcatggtca tgtcaactat      1020
     ggcgtcattc ccggcgtgat ctacacaacg cccgaggtcg ccaatgtcgg cgccaccgag      1080
     gaaagcctca aggccgaggg ccgcgcctac aaggtcggca agttcatgtt catgggcaat      1140
     ggccgcgcca aggccaattt cgctagtgac ggcttcgtca agatcctcgc cgacaaggag      1200
     acagaccgca tccttggcgc ccatatcatc ggcccggcag cgggcgaact gatccacgag      1260
     gtctgcgtcg ccatggaatt cggcgcctcg gccgaggatc tggcgctgac ctgccacgca      1320
     cacccgacct attccgaggc tgtgcgcgag gcggcgctgg cctgcggcga cggcccgatc      1380
     cactcgtaa                                                              1389
//

If you have problems or comments...

PBIL Back to PBIL home page