(data stored in ACNUC7421 zone)

EMBL: CP000031.LUXR-1

CP000031.LUXR-1      Location/Qualifiers
FT   CDS_pept        385883..386602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxR-1"
FT                   /locus_tag="SPO0371"
FT                   /product="autoinducer-binding transcriptional regulator
FT                   LuxR"
FT                   /note="identified by match to protein family HMM PF00196;
FT                   match to protein family HMM PF03472"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0371"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93689"
FT                   /db_xref="GOA:Q5LXF5"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:Q5LXF5"
FT                   /protein_id="AAV93689.1"
FT                   /translation="MGRKVNLNPILEDLDATSALEDLERVTIKLRDTLEIDHIVYHWVD
FT                   SAGDQYGCATYPKAWQERYLERNYHRIDPVILGCFQRFHPVDWKRLDWSGKVAKAFLQD
FT                   ALKHGVGNQGYSIPIRGPNGQFALFTVNHVCDDQAWSEFTEIYGRDLILIAHFFNRKAL
FT                   EFERSRQPDQPRNLSPREVDAMTLLALGYSRAQVAHSLSISEHTLRVYIESARFKLGAL
FT                   NTTHAIATAMSRGLIVV"
     atgggcagaa aggtcaacct gaacccgatt ttggaggatt tggacgccac cagcgcgctt        60
     gaagacctcg aacgggtaac gatcaagctc cgcgacacgc tcgagattga ccacatcgtc       120
     tatcactggg tcgacagtgc gggcgatcaa tatggctgtg cgacctatcc caaagcctgg       180
     caggaaagat atctggagcg gaactatcac cgtatcgacc cggtaatctt ggggtgtttc       240
     caacggtttc acccggttga ctggaaacgg ctcgattggt cgggcaaggt tgccaaggcc       300
     ttcttgcagg acgcgttgaa acatggggtc ggcaatcaag gatattcgat cccgatccgg       360
     gggccgaacg ggcaatttgc cctcttcacg gtaaaccatg tctgcgatga ccaggcctgg       420
     tccgaattta ccgaaatcta tgggcgcgac ctgatcctga tcgcgcattt cttcaaccgc       480
     aaggcgctgg aattcgaacg ctcgcgccag ccggaccaac cccgcaacct gtcgccgcgc       540
     gaagtggatg caatgacctt gctggcgctt ggttacagcc gggcccaggt ggcgcattct       600
     ctgtcgatct cagagcatac cctgcgggtc tatatcgaaa gcgcccgctt caaactgggg       660
     gcgctcaata caacccacgc gatagcaacc gccatgagtc gcgggcttat cgtggtttag       720
//

If you have problems or comments...

PBIL Back to PBIL home page