(data stored in ACNUC7421 zone)

EMBL: CP000031.MDH

CP000031.MDH         Location/Qualifiers
FT   CDS_pept        complement(363558..364520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="SPO0349"
FT                   /product="malate dehydrogenase, NAD-dependent"
FT                   /EC_number="1.1.1.37"
FT                   /note="identified by similarity to SP:Q59202; match to
FT                   protein family HMM PF00056; match to protein family HMM
FT                   PF02866; match to protein family HMM TIGR01763"
FT                   /db_xref="EnsemblGenomes-Gn:SPO0349"
FT                   /db_xref="EnsemblGenomes-Tr:AAV93667"
FT                   /db_xref="GOA:Q5LXE1"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011275"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5LXE1"
FT                   /protein_id="AAV93667.1"
FT                   /translation="MARPKIALIGAGQIGGTLAHLVALKELGDVVLFDIAEGTPEGKAL
FT                   DIAESGPSEGFDAKLKGTQSYADIAGADVCIVTAGVPRKPGMSRDDLLGINLKVMKSVG
FT                   EGIRDNAPDAFVICITNPLDAMVWALQQFSGLPANKVCGMAGVLDSARFRHFLAEEFNV
FT                   SMKDVTAFVLGGHGDTMVPSVRYSTVAGIPLPDLIKMGWTSQEKLDAIVQRTRDGGAEI
FT                   VGLLKTGSAYYAPATSAIEMAEAYLKDQKRVLPCAAYCNGELGVKGMYVGVPTVIGAGG
FT                   IERIIDVSLTKEEQDMFDNSVNAVKGLVEACKGIDGSLA"
     atggccagac ccaagatcgc gcttatcggc gcaggtcaga tcggcggcac gctcgcccac        60
     ctcgtcgcgc tgaaggaact gggcgatgtt gtcctgttcg acatcgccga aggcacgccc       120
     gagggcaagg cgctcgacat cgcggaatcc ggcccctccg aagggttcga cgccaagctc       180
     aagggcaccc agtcctatgc cgatatcgct ggcgccgatg tctgcatcgt caccgccggt       240
     gtgccgcgca agccgggcat gagccgcgac gacctgctgg gcatcaacct caaggtcatg       300
     aagtcggtcg gcgaaggcat ccgcgacaac gcgcctgacg cgttcgtcat ctgcatcacc       360
     aacccgctcg acgcgatggt ctgggcgctg cagcagttct cgggcctgcc cgcgaacaag       420
     gtctgcggca tggcaggcgt gctcgactcg gcccgtttcc gccacttcct ggccgaagag       480
     ttcaacgtgt caatgaaaga cgtcaccgca ttcgtgctgg gcggccatgg cgacaccatg       540
     gtgccttcgg tgcggtattc gaccgttgcc ggcatcccgc tgcccgacct gatcaagatg       600
     ggctggacca gccaggagaa gctggacgcc atcgtgcagc gcacccgtga cggcggcgcc       660
     gagatcgttg gcttgctgaa gaccggttcg gcctattacg cacccgccac cagcgccatc       720
     gagatggccg aggcctatct gaaagaccag aagcgcgtcc tgccctgcgc cgcctattgc       780
     aacggcgaac tgggcgtaaa gggcatgtat gtgggcgtgc ccaccgtgat cggcgccggc       840
     ggcatcgaac gcatcatcga cgtgtcgctg accaaggaag agcaggacat gttcgacaat       900
     tcggtcaacg cggtcaaagg cctggtcgag gcttgcaaag gcatcgacgg ctcgctggcc       960
     tga                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page